Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_811037126225225212361e-173
PHYRA_81102147542512317803e-104
PHYRA_72504695162512317803e-104
PHYCA_129485147542512347518e-100
PPTG_17125147542832347522e-99
PHYKE_6286599492502317152e-94
PITG_18453147542522347065e-93
PHYRA_7182580282542316911e-90
PHYCA_12149480282482296873e-90
PHYCA_10034368662742296852e-89
PHYCA_118548170262462316692e-87
PITG_19936157132492286581e-85
PPTG_07664170262452276502e-84
PPTG_16851236932492316483e-84
PHYCA_9298368522482286466e-84
PHYCA_132252157132492306459e-84
PPTG_0889380282512286372e-82
PHYRA_72386459152452276362e-82
PHYRA_72344817002452276362e-82
PITG_0971680282502286336e-82
PHYCA_118674205112812276313e-81
PHYSO_254108170262462256283e-81
PHYCA_129784817002462276232e-80
PHYSO_526774157132492286232e-80
PHYSO_526623599492492286223e-80
PYVX_22467135312362256204e-80
PITG_19938353892452266189e-80
PHYRA_74306205112452276162e-79
PHYSO_26126580282472296163e-79
PHYRA_74310599492492286163e-79
PHYSO_507736135312362256143e-79
PHYCA_122048693172362276143e-79
PPTG_17049237772552356154e-79
PITG_22053170262452286136e-79
PHYRA_74343698872492286111e-78
PITG_04208205112452286111e-78
PHYSO_329843510942392266092e-78
PPTG_15230817002522276076e-78
PHYRA_72438135312362246041e-77
PHYRA_74307422182492286051e-77
PHYSO_249692459152482276023e-77
PPTG_15233231122352246013e-77
PHYCA_11951135312342235995e-77
PITG_0426737012792296035e-77
PHYRA_71308231122362245971e-76
PHYRA_52440170262432255971e-76
PHYRA_76249246513262265972e-75
PHYKE_494670892632285912e-75
PPTG_17409743732352265883e-75
PHYCA_107869246513422275964e-75
PHYSO_52607137012492285885e-75
PPTG_17245238632572355885e-75
PHYCA_108039563202152245838e-75
PHYRA_74356698952442275859e-75
PHYRA_71404563202452295851e-74
PHYRA_72433694822452295841e-74
PHYRA_71931510942392275832e-74
PHYRA_4287689222132245793e-74
PYIR_13251817002362255805e-74
PPTG_19331246513682275891e-73
PYU1_G011231459142382255762e-73
PYU1_G011237817002352255743e-73
PPTG_0767136902462305728e-73
PHYRA_71477693172382295711e-72
PHYSO_397673703072242265691e-72
PHYSO_526832353892492305711e-72
PITG_0424836902452275711e-72
PHYSO_468315563202552295712e-72
PHYCA_123779173642772275713e-72
PHYKE_4438758943392315763e-72
PHYKE_7566459142602255704e-72
PHYKE_2376459153222295737e-72
PPTG_13736226162362275641e-71
PHYKE_7564459204732265822e-71
PHYKE_5753763302382255622e-71
PYIR_13252817012362255613e-71
PPTG_15231135312582255633e-71
PPTG_07089202542552285624e-71
PYU1_G011235963762382265614e-71
PPTG_0766037012162135578e-71
PHYSO_406265173642322275562e-70
PPTG_08017207076162265843e-70
PHYCA_11855136902452275554e-70
PITG_22668173645192265756e-70
PPTG_08005173647592265861e-69
PHYSO_51088870892552275512e-69
PPTG_19330563203162295521e-68
PHYSO_414520550602132245421e-68
PPTG_07661600202232195431e-68
PHYCA_9358368552522335442e-68
PPTG_19506247322232195395e-68
PHYRA_5432770892192255386e-68
PHYCA_119748423082612265418e-68
PYIW_25259817002462365399e-68
PYIR_13275135312372255362e-67
PYU1_G011230817012382255353e-67
PHYRA_46230550602122235314e-67
PPTG_1285370893422295419e-67
PPTG_12847511263312295409e-67
PHYSO_249751459202382255321e-66
PPTG_2217436987712295652e-66
PPTG_12852223223312295363e-66
PHYCA_10840970892822295323e-66
PHYSO_334487517562582265304e-66
PHYRA_74617699543372265364e-66
PITG_16866135312382265275e-66
PYU1_G011233694602392245268e-66
PHYRA_72345517562402265268e-66
PHYKE_8391147537781405591e-65
PITG_0420036612472285252e-65
PHYCA_69477391922132245212e-65
HYAP_0924370892662245253e-65
PHYRA_72475695022432305214e-65
PHYRA_72385694602372255205e-65
PHYRA_5242336901931955157e-65
PPTG_13769592663492265288e-65
PPTG_18464243182472335199e-65
PHYSO_527352600202452255191e-64
PHYSO_25411236902242245161e-64
PHYRA_71618578972432305172e-64
PPTG_15224963762462275182e-64
PYU1_G011236135312372245153e-64
PHYRA_71310459142372255153e-64
PHYRA_83592763302372305144e-64
PHYCA_683589222102085116e-64
PHALS_06162173644882275327e-64
PHYCA_69480391942132245107e-64
PITG_0852270893822295248e-64
PHYCA_69479391932132245109e-64
PHYRA_74630202543432265182e-63
PPTG_07277203402982295143e-63
PHYSO_336498177692382305093e-63
PHYRA_72390592662372305083e-63
PHYRA_72477695042382285084e-63
PHYSO_329114510052362195074e-63
PHYRA_71588693332422325085e-63
PHYRA_76657703212392324997e-62
PHYCA_69457511262132244969e-62
PHYRA_72165599392402324991e-61
PHYRA_41766511262092234961e-61
PHYKE_7568608783722245091e-61
PHYRA_86968733682392294972e-61
PHYRA_84273720242372284944e-61
PHYRA_49009690712162284925e-61
PPTG_06973368661651624875e-61
PHYCA_576423176762342244902e-60
PHYCA_11835636612522264912e-60
PHYSO_334498517572292134883e-60
PITG_22916720282482294903e-60
PHALS_0608470892602274913e-60
PHYSO_490000575402412274876e-60
PHYRA_72403694692392324851e-59
PHYRA_39489686262372274832e-59
PPTG_15234608782352244822e-59
PPTG_13026694282382284823e-59
PYVX_22469517584742265003e-59
PITG_23228177692542484833e-59
PHYSO_259736247322312324814e-59
PHYRA_71307608782372244814e-59
PHYCA_18373353892462074816e-59
PHYRA_84277720282402294806e-59
PHYRA_43347688002202014788e-59
PHYSO_496064578972542444801e-58
PPTG_004608462592254801e-58
PPTG_18463452582542454791e-58
PHYCA_124383426672802694802e-58
PHYRA_72531695292362284762e-58
PHYRA_72541695342392324762e-58
PHYRA_75425176762372244763e-58
PHYRA_76603703072392324763e-58
PHYRA_83851719182392314753e-58
PHYCA_124462426702802694775e-58
PHYCA_553546452582802694751e-57
PHYSO_560790608782372264711e-57
PHYSO_330015511262412284712e-57
PPTG_00471720282392234712e-57
PHYRA_52960691982232244692e-57
PHYRA_52955691972232244692e-57
PPTG_17295238912382304684e-57
PHYKE_4541759501471474604e-57
PPTG_11469451342532474686e-57
PHYSO_334500517582352244667e-57
PPTG_07991207012762304698e-57
HYAP_08306563202862284682e-56
PHYKE_208743731871484582e-56
PHYCA_129892608782342244623e-56
PITG_22734422181681514554e-56
PHALS_13513157132402284608e-56
PHYSO_253029461762522304608e-56
PPTG_04504368972532504609e-56
PPTG_17453177692542464601e-55
PHALS_12600147542672254592e-55
PHYRA_45457517571991954532e-55
PITG_23211177602452284572e-55
PHYRA_44405688542322284562e-55
PHYCA_109089173962772664593e-55
PPTG_08703209012542464556e-55
PHYSO_480350570062452454531e-54
PHYSO_516261592662272294511e-54
PITG_009578462982284571e-54
PHYRA_72430461762382294511e-54
PHYRA_72306694282382294511e-54
PPTG_14652229162572284521e-54
PHYCA_12462369161771614451e-54
PHYSO_249691459142251924502e-54
PHYCA_123797207012412314512e-54
PHYRA_52260691692342264493e-54
PITG_22981175962592254503e-54
PHYCA_544885451342562514486e-54
HYAP_06628642572452304477e-54
HYAP_05559637032622264487e-54
PHYSO_526541599392392324451e-53
PHALS_1442380283792344561e-53
PHALS_13512353892432254451e-53
PHYKE_5655578972432294451e-53
HYAP_05558637022622264452e-53
PHYSO_254223422182272264423e-53
HYAP_04977634662622264443e-53
HYAP_07436646842672294443e-53
PHYCA_123205425681771614364e-53
HYAP_07925649412672294435e-53
PHYRA_47103689972262204352e-52
PHYRA_52296691712372284363e-52
PPTG_04799194622452404363e-52
PHYCA_109163413312472374363e-52
PITG_23076176682762714384e-52
PPTG_05581173962752664375e-52
PPTG_03796191822552484356e-52
PPTG_13004176512552434347e-52
PHALS_14425357673022234379e-52
PPTG_15220176762362274321e-51
PPTG_16647236412542454331e-51
PHYCA_109174413332772684351e-51
PPTG_10591215032542464303e-51
PITG_22709173962812624323e-51
PHYRA_52426600201521574205e-51
PHYRA_47241690031761584201e-50
PITG_23051176512802394291e-50
PHYSO_504553689972572444271e-50
PPTG_06202176582752674281e-50
PHYSO_255972205112152294221e-50
PHYSO_365942537682332134242e-50
PHYSO_423056554102332104232e-50
PHYCA_109162413302572454252e-50
PHYSO_251206176682432364223e-50
PHYCA_69122177692492494224e-50
PHYSO_365377537622202314195e-50
HYAP_14846685472212304196e-50
PPTG_05868197782572494201e-49
PHYCA_114913419272242274162e-49
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_81103

Length=253
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_81103                                                           480        1e-173
PHYRA_81102                                                           305        3e-104
PHYRA_72504                                                           305        3e-104
PHYCA_129485                                                          293        8e-100
PPTG_17125                                                            294        2e-99 
PHYKE_6286                                                            280        2e-94 
PITG_18453                                                            276        5e-93 
PHYRA_71825                                                           270        1e-90 
PHYCA_121494                                                          269        3e-90 
PHYCA_10034                                                           268        2e-89 
PHYCA_118548                                                          262        2e-87 
PITG_19936                                                            258        1e-85 
PPTG_07664                                                            254        2e-84 
PPTG_16851                                                            254        3e-84 
PHYCA_9298                                                            253        6e-84 
PHYCA_132252                                                          253        9e-84 
PPTG_08893                                                            249        2e-82 
PHYRA_72386                                                           249        2e-82 
PHYRA_72344                                                           249        2e-82 
PITG_09716                                                            248        6e-82 
PHYCA_118674                                                          247        3e-81 
PHYSO_254108                                                          246        3e-81 
PHYCA_129784                                                          244        2e-80 
PHYSO_526774                                                          244        2e-80 
PHYSO_526623                                                          244        3e-80 
PYVX_22467                                                            243        4e-80 
PITG_19938                                                            242        9e-80 
PHYRA_74306                                                           241        2e-79 
PHYSO_261265                                                          241        3e-79 
PHYRA_74310                                                           241        3e-79 
PHYSO_507736                                                          241        3e-79 
PHYCA_122048                                                          241        3e-79 
PPTG_17049                                                            241        4e-79 
PITG_22053                                                            240        6e-79 
PHYRA_74343                                                           239        1e-78 
PITG_04208                                                            239        1e-78 
PHYSO_329843                                                          239        2e-78 
PPTG_15230                                                            238        6e-78 
PHYRA_72438                                                           237        1e-77 
PHYRA_74307                                                           237        1e-77 
PHYSO_249692                                                          236        3e-77 
PPTG_15233                                                            236        3e-77 
PHYCA_11951                                                           235        5e-77 
PITG_04267                                                            236        5e-77 
PHYRA_71308                                                           234        1e-76 
PHYRA_52440                                                           234        1e-76 
PHYRA_76249                                                           234        2e-75 
PHYKE_4946                                                            232        2e-75 
PPTG_17409                                                            231        3e-75 
PHYCA_107869                                                          234        4e-75 
PHYSO_526071                                                          231        5e-75 
PPTG_17245                                                            231        5e-75 
PHYCA_108039                                                          229        8e-75 
PHYRA_74356                                                           229        9e-75 
PHYRA_71404                                                           229        1e-74 
PHYRA_72433                                                           229        1e-74 
PHYRA_71931                                                           229        2e-74 
PHYRA_42876                                                           227        3e-74 
PYIR_13251                                                            228        5e-74 
PPTG_19331                                                            231        1e-73 
PYU1_G011231                                                          226        2e-73 
PYU1_G011237                                                          225        3e-73 
PPTG_07671                                                            224        8e-73 
PHYRA_71477                                                           224        1e-72 
PHYSO_397673                                                          223        1e-72 
PHYSO_526832                                                          224        1e-72 
PITG_04248                                                            224        1e-72 
PHYSO_468315                                                          224        2e-72 
PHYCA_123779                                                          224        3e-72 
PHYKE_4438                                                            226        3e-72 
PHYKE_7566                                                            224        4e-72 
PHYKE_2376                                                            225        7e-72 
PPTG_13736                                                            221        1e-71 
PHYKE_7564                                                            228        2e-71 
PHYKE_5753                                                            221        2e-71 
PYIR_13252                                                            220        3e-71 
PPTG_15231                                                            221        3e-71 
PPTG_07089                                                            221        4e-71 
PYU1_G011235                                                          220        4e-71 
PPTG_07660                                                            219        8e-71 
PHYSO_406265                                                          218        2e-70 
PPTG_08017                                                            229        3e-70 
PHYCA_118551                                                          218        4e-70 
PITG_22668                                                            226        6e-70 
PPTG_08005                                                            230        1e-69 
PHYSO_510888                                                          216        2e-69 
PPTG_19330                                                            217        1e-68 
PHYSO_414520                                                          213        1e-68 
PPTG_07661                                                            213        1e-68 
PHYCA_9358                                                            214        2e-68 
PPTG_19506                                                            212        5e-68 
PHYRA_54327                                                           211        6e-68 
PHYCA_119748                                                          213        8e-68 
PYIW_25259                                                            212        9e-68 
PYIR_13275                                                            211        2e-67 
PYU1_G011230                                                          210        3e-67 
PHYRA_46230                                                           209        4e-67 
PPTG_12853                                                            213        9e-67 
PPTG_12847                                                            212        9e-67 
PHYSO_249751                                                          209        1e-66 
PPTG_22174                                                            222        2e-66 
PPTG_12852                                                            211        3e-66 
PHYCA_108409                                                          209        3e-66 
PHYSO_334487                                                          208        4e-66 
PHYRA_74617                                                           211        4e-66 
PITG_16866                                                            207        5e-66 
PYU1_G011233                                                          207        8e-66 
PHYRA_72345                                                           207        8e-66 
PHYKE_8391                                                            219        1e-65 
PITG_04200                                                            206        2e-65 
PHYCA_69477                                                           205        2e-65 
HYAP_09243                                                            206        3e-65 
PHYRA_72475                                                           205        4e-65 
PHYRA_72385                                                           204        5e-65 
PHYRA_52423                                                           202        7e-65 
PPTG_13769                                                            207        8e-65 
PPTG_18464                                                            204        9e-65 
PHYSO_527352                                                          204        1e-64 
PHYSO_254112                                                          203        1e-64 
PHYRA_71618                                                           203        2e-64 
PPTG_15224                                                            204        2e-64 
PYU1_G011236                                                          202        3e-64 
PHYRA_71310                                                           202        3e-64 
PHYRA_83592                                                           202        4e-64 
PHYCA_6835                                                            201        6e-64 
PHALS_06162                                                           209        7e-64 
PHYCA_69480                                                           201        7e-64 
PITG_08522                                                            206        8e-64 
PHYCA_69479                                                           201        9e-64 
PHYRA_74630                                                           204        2e-63 
PPTG_07277                                                            202        3e-63 
PHYSO_336498                                                          200        3e-63 
PHYRA_72390                                                           200        3e-63 
PHYRA_72477                                                           200        4e-63 
PHYSO_329114                                                          199        4e-63 
PHYRA_71588                                                           200        5e-63 
PHYRA_76657                                                           196        7e-62 
PHYCA_69457                                                           195        9e-62 
PHYRA_72165                                                           196        1e-61 
PHYRA_41766                                                           195        1e-61 
PHYKE_7568                                                            200        1e-61 
PHYRA_86968                                                           196        2e-61 
PHYRA_84273                                                           194        4e-61 
PHYRA_49009                                                           194        5e-61 
PPTG_06973                                                            192        5e-61 
PHYCA_576423                                                          193        2e-60 
PHYCA_118356                                                          193        2e-60 
PHYSO_334498                                                          192        3e-60 
PITG_22916                                                            193        3e-60 
PHALS_06084                                                           193        3e-60 
PHYSO_490000                                                          192        6e-60 
PHYRA_72403                                                           191        1e-59 
PHYRA_39489                                                           190        2e-59 
PPTG_15234                                                            190        2e-59 
PPTG_13026                                                            190        3e-59 
PYVX_22469                                                            197        3e-59 
PITG_23228                                                            190        3e-59 
PHYSO_259736                                                          189        4e-59 
PHYRA_71307                                                           189        4e-59 
PHYCA_18373                                                           189        6e-59 
PHYRA_84277                                                           189        6e-59 
PHYRA_43347                                                           188        8e-59 
PHYSO_496064                                                          189        1e-58 
PPTG_00460                                                            189        1e-58 
PPTG_18463                                                            189        1e-58 
PHYCA_124383                                                          189        2e-58 
PHYRA_72531                                                           187        2e-58 
PHYRA_72541                                                           187        2e-58 
PHYRA_75425                                                           187        3e-58 
PHYRA_76603                                                           187        3e-58 
PHYRA_83851                                                           187        3e-58 
PHYCA_124462                                                          188        5e-58 
PHYCA_553546                                                          187        1e-57 
PHYSO_560790                                                          186        1e-57 
PHYSO_330015                                                          186        2e-57 
PPTG_00471                                                            186        2e-57 
PHYRA_52960                                                           185        2e-57 
PHYRA_52955                                                           185        2e-57 
PPTG_17295                                                            184        4e-57 
PHYKE_4541                                                            181        4e-57 
PPTG_11469                                                            184        6e-57 
PHYSO_334500                                                          184        7e-57 
PPTG_07991                                                            185        8e-57 
HYAP_08306                                                            184        2e-56 
PHYKE_208                                                             181        2e-56 
PHYCA_129892                                                          182        3e-56 
PITG_22734                                                            179        4e-56 
PHALS_13513                                                           181        8e-56 
PHYSO_253029                                                          181        8e-56 
PPTG_04504                                                            181        9e-56 
PPTG_17453                                                            181        1e-55 
PHALS_12600                                                           181        2e-55 
PHYRA_45457                                                           179        2e-55 
PITG_23211                                                            180        2e-55 
PHYRA_44405                                                           180        2e-55 
PHYCA_109089                                                          181        3e-55 
PPTG_08703                                                            179        6e-55 
PHYSO_480350                                                          179        1e-54 
PHYSO_516261                                                          178        1e-54 
PITG_00957                                                            180        1e-54 
PHYRA_72430                                                           178        1e-54 
PHYRA_72306                                                           178        1e-54 
PPTG_14652                                                            178        1e-54 
PHYCA_12462                                                           176        1e-54 
PHYSO_249691                                                          177        2e-54 
PHYCA_123797                                                          178        2e-54 
PHYRA_52260                                                           177        3e-54 
PITG_22981                                                            177        3e-54 
PHYCA_544885                                                          177        6e-54 
HYAP_06628                                                            176        7e-54 
HYAP_05559                                                            177        7e-54 
PHYSO_526541                                                          176        1e-53 
PHALS_14423                                                           180        1e-53 
PHALS_13512                                                           176        1e-53 
PHYKE_5655                                                            176        1e-53 
HYAP_05558                                                            176        2e-53 
PHYSO_254223                                                          174        3e-53 
HYAP_04977                                                            175        3e-53 
HYAP_07436                                                            175        3e-53 
PHYCA_123205                                                          172        4e-53 
HYAP_07925                                                            175        5e-53 
PHYRA_47103                                                           172        2e-52 
PHYRA_52296                                                           172        3e-52 
PPTG_04799                                                            172        3e-52 
PHYCA_109163                                                          172        3e-52 
PITG_23076                                                            173        4e-52 
PPTG_05581                                                            172        5e-52 
PPTG_03796                                                            172        6e-52 
PPTG_13004                                                            171        7e-52 
PHALS_14425                                                           172        9e-52 
PPTG_15220                                                            171        1e-51 
PPTG_16647                                                            171        1e-51 
PHYCA_109174                                                          172        1e-51 
PPTG_10591                                                            170        3e-51 
PITG_22709                                                            171        3e-51 
PHYRA_52426                                                           166        5e-51 
PHYRA_47241                                                           166        1e-50 
PITG_23051                                                            169        1e-50 
PHYSO_504553                                                          169        1e-50 
PPTG_06202                                                            169        1e-50 
PHYSO_255972                                                          167        1e-50 
PHYSO_365942                                                          167        2e-50 
PHYSO_423056                                                          167        2e-50 
PHYCA_109162                                                          168        2e-50 
PHYSO_251206                                                          167        3e-50 
PHYCA_69122                                                           167        4e-50 
PHYSO_365377                                                          166        5e-50 
HYAP_14846                                                            166        6e-50 
PPTG_05868                                                            166        1e-49 
PHYCA_114913                                                          164        2e-49 
PITG_23075                                                            166        2e-49 
PHYCA_10715                                                           164        3e-49 
PHYSO_521124                                                          165        3e-49 
PHYCA_108964                                                          165        4e-49 
PHYSO_328418                                                          163        4e-49 
PHYCA_109095                                                          164        7e-49 
PHYCA_132529                                                          162        1e-48 
PITG_23094                                                            162        1e-48 
PHYRA_52427                                                           158        2e-48 
PHYRA_45462                                                           160        2e-48 
PHYCA_109192                                                          163        2e-48 
PHYCA_10570                                                           163        2e-48 
PYAP_24304                                                            161        5e-48 
PHYCA_132177                                                          160        1e-47 
PPTG_15262                                                            160        1e-47 
PHYSO_480321                                                          160        1e-47 
PHYCA_123587                                                          161        2e-47 
PHYSO_514298                                                          160        2e-47 
PHYSO_527850                                                          158        2e-47 
PHYSO_482931                                                          159        3e-47 
PPTG_11475                                                            160        5e-47 
PHYSO_246397                                                          159        5e-47 
PITG_23062                                                            159        6e-47 
PHYKE_7565                                                            157        8e-47 
PHYSO_254099                                                          158        9e-47 
PHYCA_544875                                                          158        1e-46 
PPTG_00542                                                            157        2e-46 
PHYCA_118700                                                          156        3e-46 
HYAP_14784                                                            157        5e-46 
PHYRA_72357                                                           154        2e-45 
PHYCA_133455                                                          152        2e-45 
PPTG_15219                                                            154        4e-45 
PHALS_03592                                                           154        5e-45 
PHYSO_481543                                                          151        4e-44 
PHYCA_133546                                                          152        4e-44 
PITG_23055                                                            149        1e-43 
PHALS_08480                                                           150        1e-43 
PPTG_15218                                                            149        2e-43 
PPTG_07667                                                            145        3e-43 
PHYCA_59113                                                           145        7e-43 
PHALS_02474                                                           148        9e-43 
PPTG_07668                                                            143        3e-42 
PYAP_24757                                                            145        6e-42 
PPTG_11648                                                            147        8e-42 
PHYKE_5284                                                            144        2e-41 
PHYSO_449487                                                          140        2e-41 
PHYSO_327908                                                          152        5e-41 
PITG_10839                                                            139        6e-41 
PHALS_08947                                                           143        7e-41 
PYIW_24350                                                            141        7e-41 
PHALS_08445                                                           142        1e-40 
PHALS_05391                                                           140        8e-40 
PHALS_08945                                                           140        1e-39 
PHYCA_109151                                                          136        2e-39 
PPTG_15860                                                            137        3e-39 
PYAR_24955                                                            138        3e-39 
PHALS_05247                                                           137        1e-38 
PHYSO_327912                                                          135        3e-38 
PHYSO_263794                                                          134        7e-38 
PHYSO_477165                                                          132        7e-38 
PHALS_01213                                                           135        9e-38 
PHYSO_526791                                                          132        1e-37 
PYAP_24339                                                            132        4e-37 
PHYSO_245789                                                          129        2e-36 
PHYSO_264058                                                          129        3e-36 
HYAP_08846                                                            131        5e-36 
PHYRA_39485                                                           127        1e-35 
PHYCA_109441                                                          128        1e-35 
PHALS_08447                                                           129        2e-35 
PHYSO_260049                                                          127        3e-35 
PHYRA_44618                                                           125        4e-35 
PHYCA_11676                                                           127        5e-35 
PHYRA_39486                                                           125        7e-35 
PHYSO_246660                                                          126        2e-34 
PHYCA_5621                                                            125        3e-34 
PHYSO_257244                                                          126        3e-34 
PHYSO_327911                                                          123        1e-33 
PYAR_25201                                                            121        2e-33 
PHYSO_338051                                                          122        2e-33 
PHYKE_1224                                                            119        4e-33 
PPTG_11479                                                            122        5e-33 
PHYRA_52174                                                           119        6e-32 
PHYSO_342831                                                          116        2e-31 
PHYCA_507156                                                          115        2e-31 
PHYSO_508915                                                          116        3e-31 
PHALS_13274                                                           117        9e-31 
HYAP_05562                                                            110        9e-29 
HYAP_07033                                                            110        1e-28 
PHYCA_59410                                                           107        2e-28 
PYAR_21977                                                            109        6e-28 
PHYSO_335497                                                          108        2e-27 
PHYKE_7051                                                            103        5e-27 
HYAP_07922                                                            101        7e-26 
PHYSO_251461                                                          102        1e-25 
PHYCA_18619                                                           97.4       2e-24 
PHYCA_73404                                                           93.6       1e-23 
PHALS_14424                                                           95.5       1e-23 
PPTG_23721                                                            101        1e-23 
PHYSO_509491                                                          93.2       2e-23 
PPTG_11420                                                            95.9       3e-23 
PHYSO_341539                                                          97.1       3e-23 
PHYSO_444351                                                          91.3       8e-23 
PHYCA_73406                                                           87.8       2e-21 
PHYCA_73407                                                           87.8       2e-21 
PHYKE_4231                                                            88.2       4e-21 
PHYCA_119285                                                          85.9       1e-20 
PHYKE_6288                                                            84.7       5e-20 
PITG_22876                                                            85.5       6e-20 
PHYSO_333132                                                          85.9       8e-20 
PHYSO_264049                                                          83.2       3e-19 
PPTG_07690                                                            82.4       6e-19 
PHYSO_261711                                                          85.1       6e-19 
PPTG_05373                                                            83.6       9e-19 
HYAP_07496                                                            80.1       3e-18 
PHYSO_245887                                                          79.7       1e-17 
PYU1_G011232                                                          77.8       1e-17 
HYAP_08078                                                            79.7       2e-17 
PHYCA_73400                                                           77.4       2e-17 
PHYSO_526695                                                          77.8       3e-17 
PPTG_08713                                                            78.6       3e-17 
PITG_23039                                                            77.4       9e-17 
PYIW_25932                                                            73.9       3e-16 
PHYSO_377094                                                          73.2       7e-16 
PHYCA_108999                                                          73.2       2e-15 
PHYSO_445618                                                          71.6       4e-15 
PHYSO_515401                                                          70.5       2e-14 
PYAR_26314                                                            69.3       5e-14 
PPTG_19242                                                            65.1       2e-12 
PHYSO_336673                                                          64.7       4e-12 
PPTG_11472                                                            67.8       6e-12 
PHYSO_260072                                                          62.4       5e-11 
PPTG_04456                                                            56.2       1e-09 
HYAP_07372                                                            58.5       2e-09 
HYAP_11184                                                            55.5       4e-09 
PHYSO_335499                                                          57.8       1e-08 
PPTG_23679                                                            55.5       2e-08 
PYIR_26577                                                            50.8       1e-07 
PYAR_26415                                                            50.8       2e-07 
PPTG_20067                                                            50.8       3e-07 
PHYRA_85280                                                           52.4       8e-07 
PPTG_17455                                                            48.5       2e-06 
PPTG_20194                                                            48.5       3e-06 
PPTG_19622                                                            45.4       6e-06 
PHYKE_6287                                                            44.7       1e-05 
HYAP_08850                                                            47.4       2e-05 
HYAP_03446                                                            44.3       3e-05 
HYAP_12828                                                            42.4       8e-05 
PYVX_16508                                                            42.0       0.002 
PYIW_15316                                                            36.2       0.008 
PHYSO_333483                                                          38.1       0.013 
PYVX_21088                                                            37.4       0.056 
PYAP_24306                                                            35.4       0.058 
PPTG_17109                                                            31.2       0.74  
PPTG_23675                                                            28.5       3.9   
PYVX_13846                                                            31.6       5.4   
PITG_09411                                                            31.2       7.6   

>PHYRA_81103
Length=252

 Score = 480 bits (1236),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 252/252 (100%), Positives = 252/252 (100%), Gaps = 0/252 (0%)

Query  1    MNFCvffvatlvslvvltavqaqTNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG  60
            MNFCVFFVATLVSLVVLTAVQAQTNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG
Sbjct  1    MNFCVFFVATLVSLVVLTAVQAQTNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG  60

Query  61   CYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGS  120
            CYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGS
Sbjct  61   CYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGS  120

Query  121  ETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKV  180
            ETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKV
Sbjct  121  ETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKV  180

Query  181  SYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDD  240
            SYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDD
Sbjct  181  SYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDD  240

Query  241  VFTKKLKKSWPF  252
            VFTKKLKKSWPF
Sbjct  241  VFTKKLKKSWPF  252

>PHYRA_81102
Length=251

 Score = 305 bits (780),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 177/231 (77%), Gaps = 6/231 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV+PF QP+ +TVSQK AVKFKPQLK   GC+PYPAVQ DGS SGGL+W+   Q G
Sbjct  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG-PQDG  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL----GHRHNWEFVVVWID  142
            +CT   LGSQIYARS W  DVWAIMY WYFPKG   +         GHRHNWE+VVVWID
Sbjct  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140

Query  143  NPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            NP L+N+T+LGVSMSASIGYSK+AP   KY+DGTSVKV+Y+Y+ + GNTAL+LTED GE 
Sbjct  141  NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200

Query  203  QDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            QDLI WDQL  +AR +LN TDWD TL+ L   +MPLKD VF + L K+WPF
Sbjct  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251

>PHYRA_72504
Length=251

 Score = 305 bits (780),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 177/231 (77%), Gaps = 6/231 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV+PF QP+ +TVSQK AVKFKPQLK   GC+PYPAVQ DGS SGGL+W+   Q G
Sbjct  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG-PQDG  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL----GHRHNWEFVVVWID  142
            +CT   LGSQIYARS W  DVWAIMY WYFPKG   +         GHRHNWE+VVVWID
Sbjct  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140

Query  143  NPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            NP L+N+T+LGVSMSASIGYSK+AP   KY+DGTSVKV+Y+Y+ + GNTAL+LTED GE 
Sbjct  141  NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200

Query  203  QDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            QDLI WDQL  +AR +LN TDWD TL+ L   +MPLKD VF + L K+WPF
Sbjct  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251

>PHYCA_129485
Length=251

 Score = 293 bits (751),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 176/234 (75%), Gaps = 12/234 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV+PF QP  +TVS KAAVKFKPQLK  DGC+PYPAVQ DGS +GGL+W+   Q G
Sbjct  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSG-PQDG  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-------GHRHNWEFVVV  139
            +CT   LGSQIYARS W  DVWAIMY WYFPKG    G + L       GHRHNWE+V+V
Sbjct  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR---GAVPLPLITRLFGHRHNWEYVIV  137

Query  140  WIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDA  199
            WIDNP   NSTILGVSMSA++GY+ + PP++ Y+DG SVK+ Y+Y+ + G+T+L+LTED 
Sbjct  138  WIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDT  197

Query  200  GETQDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            GE QDLI WD+L  +AR +LN TDWD TL++L   +MPLKD VF + L K+WPF
Sbjct  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251

>PPTG_17125
Length=283

 Score = 294 bits (752),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 177/234 (76%), Gaps = 12/234 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I H+QV+PF +P  +T SQKAAVK+KPQLK  DGC+PYPAVQ DGS SGGL+W+   Q G
Sbjct  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP-QDG  112

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-------GHRHNWEFVVV  139
            +CT   LGSQIYARS W  DVWAIMY WYFPKG    G + +       GHRHNWE+ +V
Sbjct  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR---GAVPVPLILRLFGHRHNWEYAIV  169

Query  140  WIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDA  199
            WIDNP L+NSTILGVSMSAS+GY+ + PP+++Y+DG SVK+ Y+Y+ + G+T+L+LTE  
Sbjct  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229

Query  200  GETQDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            GE QDLI WD+L  +AR +LN TDWD TL+NL   +MPLKD VF + L K+WPF
Sbjct  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283

>PHYKE_6286
Length=250

 Score = 280 bits (715),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 171/231 (74%), Gaps = 5/231 (2%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            N+I HDQVQPFAQP  ++ ++KAAVKFKPQL    GC PYPAV ++GS S GL+W   G+
Sbjct  22   NTISHDQVQPFAQPEPVSDAEKAAVKFKPQLAVTYGCDPYPAVDSNGSISAGLKW--AGK  79

Query  85   -RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
              GDCT  PLGSQ+Y+R+ WY D WAIMY WYFPK  +       GHRH W++ VVWID+
Sbjct  80   PDGDCTGSPLGSQVYSRADWYEDKWAIMYAWYFPKARQRLSKYFYGHRHMWQWAVVWIDD  139

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVF-GNTALELTEDAGET  202
            PA DNST+ GVSMSAS+GY KR+PPKSKY+D +SVK+  +    + G  +L LTED GET
Sbjct  140  PASDNSTVQGVSMSASVGYQKRSPPKSKYVDDSSVKLDSYVDFWWSGKASLRLTEDTGET  199

Query  203  QDLIMWDQLPDVARDALNT-DWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            QDLI WDQL D AR++L++ D+D +LWN    +MPLKD VFTK LK+S+PF
Sbjct  200  QDLIQWDQLTDAARESLSSFDFDESLWNTKKIKMPLKDGVFTKNLKRSYPF  250

>PITG_18453
Length=252

 Score = 276 bits (706),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 174/234 (74%), Gaps = 12/234 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I H+QV+PF +P  +T SQKAAVK+KPQLK  DGC+PYPAVQ DGS SGGL+W+   Q G
Sbjct  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP-QDG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIG-------LGHRHNWEFVVV  139
            +CT   LGSQIYARS W  DVWAIMY WYFPKG    G +         GHRHNWE+ +V
Sbjct  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR---GAVPAPLILRLFGHRHNWEYAIV  138

Query  140  WIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDA  199
            WIDNP L+NSTILGVS+SASI Y+   PP++ ++DG SVK+ Y+Y+ +FG+T+L+LTED 
Sbjct  139  WIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDT  198

Query  200  GETQDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            GE QDL+ WDQL  +AR +L NTDWD TL+NL   +MPLKD  F + L K+WPF
Sbjct  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252

>PHYRA_71825
Length=254

 Score = 270 bits (691),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 170/231 (74%), Gaps = 6/231 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            IPHD V+PFAQP   T ++KAAVK+KP+L   DGC+PY AVQADG+ SGGL W+   Q G
Sbjct  25   IPHDTVEPFAQPRPKTDAEKAAVKYKPRLLVEDGCHPYAAVQADGAISGGLEWSG-PQDG  83

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKG-SETSGGIGL---GHRHNWEFVVVWID  142
            +C   PLGSQ+YAR    +DVWAIMY WYFPKG +     + L   GHR+ WE+ VVW+D
Sbjct  84   ECRGSPLGSQVYARWMKVKDVWAIMYAWYFPKGRAPLPVPLSLRFFGHRNGWEYAVVWLD  143

Query  143  NPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            N    NST+L  S+SA++G+SK APPK KY DGTS+ VSY+Y+ +FGNTA++ TEDAGE 
Sbjct  144  NLNAKNSTVLATSLSAAVGWSKEAPPKEKYFDGTSLMVSYYYNHIFGNTAVKYTEDAGEF  203

Query  203  QDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            Q LI WDQLPD+AR AL NTDWD T  N+   +MP+KD VF +KL+ ++PF
Sbjct  204  QPLITWDQLPDLARKALNNTDWDATPSNVARVKMPMKDGVFLEKLEGAYPF  254

>PHYCA_121494
Length=248

 Score = 269 bits (687),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 166/229 (72%), Gaps = 2/229 (1%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
             +IP+D V P     S T +QKAAVK+ PQL   DGC+PY AVQADG+ S GL+W+   Q
Sbjct  21   KAIPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSG-PQ  79

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             G C   PLGSQ+YARSTW +  WAIMY WYFP G      +GLGHR+ WE+ V+W+D P
Sbjct  80   DGACKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAPVPPVGLGHRNGWEYAVIWLDRP  139

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
              DNST+LGVS+SA++G+SK AP K K++DG S+KVSY+Y+ +F NTA++ TE+ GE Q 
Sbjct  140  TADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFRNTAVKYTEEKGEFQT  199

Query  205  LIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LI WDQLPD AR+AL NTDWD T +N+   +MP+KD VF +KL  ++PF
Sbjct  200  LITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  248

>PHYCA_10034
Length=274

 Score = 268 bits (685),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 165/229 (72%), Gaps = 2/229 (1%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
             +IP+D V P     S T +QKAAVK+ PQL   DGC+PY AVQADG+ S GL+W+    
Sbjct  47   KAIPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSG-PH  105

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             G C   PLGSQ+YARSTW +  WAIMY WYFP G      +GLGHR+ WE+ V+W+D P
Sbjct  106  DGACKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAPVPPVGLGHRNGWEYAVIWLDRP  165

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
              DNST+LGVS+SA++G+SK AP K K++DG S+KVSY+Y+ +F NTA++ TE+ GE Q 
Sbjct  166  TADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFHNTAVKYTEEKGEFQT  225

Query  205  LIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LI WDQLPD AR+AL NTDWD T +N+   +MP+KD VF +KL  ++PF
Sbjct  226  LITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  274

>PHYCA_118548
Length=246

 Score = 262 bits (669),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 158/231 (68%), Gaps = 8/231 (3%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
             N + HDQVQPFAQP  IT SQK+AVK+KPQL    GC+PY AVQADGS SGGL W+  G
Sbjct  22   VNRVNHDQVQPFAQPEPITDSQKSAVKYKPQLHISYGCHPYAAVQADGSASGGLEWS--G  79

Query  84   Q-RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWID  142
            +  GDCT   LGSQ+Y+RS WY D WAIMY WYFPKG    GG    HRH WE+ +VW D
Sbjct  80   RVDGDCTGSQLGSQVYSRSDWYHDKWAIMYAWYFPKGRYHLGG----HRHYWEYAIVWTD  135

Query  143  NPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            +P   NS+I GVSMSA +GY K  PP  KYIDG S+K    +S++    AL+LT++AGE 
Sbjct  136  SPTSSNSSIQGVSMSAGVGYGKATPPMLKYIDGNSIKFDSHFSLLGNKAALQLTKEAGER  195

Query  203  QDLIMWDQLPDVARDALNTD-WDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            QDLI WDQL   ARD LN D  D   W     ++P KDD+F K+L+K++PF
Sbjct  196  QDLITWDQLTVAARDTLNGDALDGKAWFTDKDEVPFKDDIFVKRLQKAFPF  246

>PITG_19936
Length=249

 Score = 258 bits (658),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 160/228 (70%), Gaps = 4/228 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD VQPFAQP     SQK+AVK+KPQL    GC+PYPAVQ DGS S GL+W      G
Sbjct  24   IDHDAVQPFAQPEPTMESQKSAVKYKPQLHISYGCHPYPAVQEDGSISAGLKW-AGWPNG  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+Y+RS WY+  WAIMY WYFPK  +       GHRH W + +VW +NP  
Sbjct  83   DCKGSALGSQVYSRSDWYKGKWAIMYAWYFPKSRQYVDKYRFGHRHYWSYAIVWTNNPNP  142

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            DNSTILGVSMS+ +GY KR+PPKSKY +DGT+VK+ +++S       L+LTE +GETQDL
Sbjct  143  DNSTILGVSMSSGVGYMKRSPPKSKYVVDGTTVKLDWYWSFWGSKQGLQLTEKSGETQDL  202

Query  206  IMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I W+QL + AR+AL+  D+D + W    A MPLKDD+FT +LKK++PF
Sbjct  203  ITWEQLSEEARNALSEADFDVS-WAFTKAVMPLKDDIFTSRLKKAYPF  249

>PPTG_07664
Length=245

 Score = 254 bits (650),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 161/227 (71%), Gaps = 6/227 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            + HD+VQPFAQ   IT SQK+AVK+KPQL    GC+PYPAVQA+GS SGGL W+     G
Sbjct  24   VNHDKVQPFAQLQPITDSQKSAVKYKPQLHISYGCHPYPAVQANGSASGGLEWSGPVD-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DCT  PLGSQ+Y+RS WY++ WAIMY WYFPKG     GI  GHRH WE+ +VW D+   
Sbjct  83   DCTGSPLGSQVYSRSAWYKEKWAIMYAWYFPKGRY---GI-TGHRHYWEYAIVWTDSATS  138

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             NS+I GVSMSA +G++K  PP  KY+DG+S+K+  ++S +    AL+LT++ GETQDLI
Sbjct  139  TNSSIQGVSMSAGVGHAKATPPMLKYVDGSSIKLDSYFSFMGNKAALQLTKEHGETQDLI  198

Query  207  MWDQLPDVARDALNTD-WDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             WDQL   ARD LN+D  D  +W     ++P KDD+F ++LK ++PF
Sbjct  199  TWDQLTVAARDTLNSDALDGNVWLTNKDEVPFKDDIFMQRLKNAFPF  245

>PPTG_16851
Length=249

 Score = 254 bits (648),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 167/231 (72%), Gaps = 4/231 (2%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            + +IP+D VQPF+Q    T +QKA +K+KPQLK  +GC+PYPAVQ DGS S GL+W+   
Sbjct  21   SKAIPYDSVQPFSQQVPNTDAQKAILKYKPQLKIEEGCHPYPAVQKDGSISSGLKWSGPD  80

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKG-SETSGGIGLGHRHNWEFVVVWID  142
              G C   PLGSQ+YAR+TW +  WA+MY WYFPKG +        GHRH WE+ VVW+D
Sbjct  81   NIG-CKGSPLGSQVYARATWLKGKWAVMYAWYFPKGRAPIPAPRSYGHRHGWEYAVVWLD  139

Query  143  NPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
              A  NST+LG SMSA+IG++K +P   +Y+DG S+KV+Y+++    NTA++ T+DAGE 
Sbjct  140  K-ASANSTLLGTSMSAAIGWAKESPTPKEYLDGNSLKVAYYFNDDSINTAVKYTQDAGEF  198

Query  203  QDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            QDLI+WDQLPDVAR+AL NTDWD T  N+   +MP+KD VF +KL  ++PF
Sbjct  199  QDLIIWDQLPDVARNALVNTDWDETPLNVARVKMPMKDGVFMEKLNGAYPF  249

>PHYCA_9298
Length=248

 Score = 253 bits (646),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 156/228 (68%), Gaps = 4/228 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQPFAQP   T S+K+AVK+KPQL   DGC+PYPAVQADG+ S GL+W      G
Sbjct  23   IDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHPYPAVQADGAVSAGLKWAGTAS-G  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C    LGSQ+Y+RS WY++ WAIMY WYFPKG +       GHRH W + +VW+D+   
Sbjct  82   QCKGSGLGSQVYSRSDWYKNKWAIMYAWYFPKGRQYISKYRFGHRHFWSYAIVWMDSDVP  141

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            DNSTILGVSMSA +GYSK  PPKSKY +DGT+VK   ++S      A+ LT   GE+QDL
Sbjct  142  DNSTILGVSMSAGVGYSKETPPKSKYVVDGTTVKFKSYHSFWGSKLAVGLTTKEGESQDL  201

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I W+QL D AR  L + D+D   W+     MP+ D VFT+KLKK++PF
Sbjct  202  IAWEQLTDEARSGLTDADFDVD-WSFRKVVMPMTDGVFTEKLKKNYPF  248

>PHYCA_132252
Length=249

 Score = 253 bits (645),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 159/230 (69%), Gaps = 8/230 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRW--TVVGQ  84
            I HDQVQPFAQP   T S+K+AVK+KPQL   DGC+ YPAVQADG+ S GL+W  +V GQ
Sbjct  24   IDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHSYPAVQADGAVSAGLKWAGSVSGQ  83

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
               C    LGSQ+Y+RS WY+D WAIMY WYFPKG +       GHRH W + +VW+D+ 
Sbjct  84   ---CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISKYRFGHRHFWSYAIVWMDSD  140

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
              DNSTILGVSMSA +GY+K+ PPKSKY +DGT+VK   + S   G  A+ LT   GETQ
Sbjct  141  VPDNSTILGVSMSAGVGYNKKTPPKSKYVVDGTTVKFDSYQSFWGGKLAVGLTTKEGETQ  200

Query  204  DLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLI W+QL D  R  L + D+D   W++    MP+ DDVF KKLKK++PF
Sbjct  201  DLITWEQLTDEGRTGLTDADFDVD-WSIRKVVMPMADDVFVKKLKKNYPF  249

>PPTG_08893
Length=251

 Score = 249 bits (637),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 161/228 (71%), Gaps = 3/228 (1%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            IP+D VQPF QP   T +QKA +K+KPQLK  +GC PYPAVQ DG+ S GLRW+     G
Sbjct  25   IPYDTVQPFPQPVPTTEAQKAILKYKPQLKVEEGCRPYPAVQQDGAISSGLRWSGPEDIG  84

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKG-SETSGGIGLGHRHNWEFVVVWIDNPA  145
             C     GSQIYARS  ++D WA+MYTWYFPKG +   G    GHRH WE+ VVW+D   
Sbjct  85   -CKGSLRGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPGPRSSGHRHGWEYAVVWLDKLT  143

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
             DNSTILG S+SA++G++K +P   +Y+DG S+KV+Y+++  F NTA++ T+  G  QDL
Sbjct  144  ADNSTILGTSLSAAVGWAKESPTPKEYLDGNSLKVAYYFNDDFKNTAVKYTQAGGAFQDL  203

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I+WDQL DVAR +L NTDWD T +N+   +MP+KD VF +KL  ++PF
Sbjct  204  IIWDQLSDVARASLSNTDWDETPFNVARVKMPMKDGVFEEKLSGAYPF  251

>PHYRA_72386
Length=245

 Score = 249 bits (636),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 156/227 (69%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQV+PFAQP  +T+S++AA+KFKPQL  +DGC+PYPAV   G   GGL+ T     
Sbjct  30   TISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTA  89

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQIY RSTW+RD+WAIMY+WYFPK S ++   GLGHRH+WE V+VWIDNP 
Sbjct  90   G-CKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPST---GLGHRHDWEHVIVWIDNPD  145

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            + N  IL VS SA  GYSK APP +  +DGTS K+ Y  S    N AL+ T DAGE QDL
Sbjct  146  VPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEFQDL  204

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMW+Q+ D+AR ALNT       N G+A +P+ D  F  KL K+WPF
Sbjct  205  IMWEQMSDLARQALNT------MNFGDANVPMNDGNFVGKLDKAWPF  245

>PHYRA_72344
Length=245

 Score = 249 bits (636),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 156/227 (69%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQV+PFAQP  +T+S++AA+KFKPQL  +DGC+PYPAV   G   GGL+ T     
Sbjct  30   TISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTA  89

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQIY RSTW+RD+WAIMY+WYFPK S ++   GLGHRH+WE V+VWIDNP 
Sbjct  90   G-CKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPST---GLGHRHDWEHVIVWIDNPD  145

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            + N  IL VS SA  GYSK APP +  +DGTS K+ Y  S    N AL+ T DAGE QDL
Sbjct  146  VPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEFQDL  204

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMW+Q+ D+AR ALNT       N G+A +P+ D  F  KL K+WPF
Sbjct  205  IMWEQMSDLARQALNT------MNFGDANVPMNDGNFVGKLDKAWPF  245

>PITG_09716
Length=250

 Score = 248 bits (633),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 162/228 (71%), Gaps = 3/228 (1%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            IP+D +QPF QP   T +QKA +K+KPQLK  +GC+PYPAVQ +G  S GLRW+     G
Sbjct  24   IPYDTLQPFPQPIPTTDAQKAILKYKPQLKVEEGCHPYPAVQRNGDISSGLRWSGPEDIG  83

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGI-GLGHRHNWEFVVVWIDNPA  145
             C    LGSQIYARS  ++D WA+MYTWYFPKG     G+   GHRH WE+ VVW+D   
Sbjct  84   -CKGSSLGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPGLRSSGHRHGWEYAVVWLDRLD  142

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
             ++STILG S+SA++G++K +P   +Y+DG S+KV+Y+++  F NTA++ T+D G  QDL
Sbjct  143  ANSSTILGTSLSAAVGWAKESPTPKEYLDGHSLKVAYYFNDDFSNTAVKYTQDGGAFQDL  202

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I WDQL D AR +L NTDWD TL+N+   +MP+KD VF +KL  ++PF
Sbjct  203  IQWDQLSDPARASLINTDWDETLFNVARVKMPMKDGVFEEKLSGAYPF  250

>PHYCA_118674
Length=281

 Score = 247 bits (631),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 151/227 (67%), Gaps = 3/227 (1%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQPF QP   T S+K+AVK+KPQL   DGC+PYPAVQA+GS SGGL+W      G
Sbjct  57   INHDQVQPFTQPEPTTDSEKSAVKYKPQLHISDGCHPYPAVQANGSVSGGLKWAGRSD-G  115

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQIY+RS W+ D WAIMY WYFPKG+E       GHRH W + +VW  +P  
Sbjct  116  DCKRSALGSQIYSRSDWHNDKWAIMYAWYFPKGNEFQANFDSGHRHYWSYAIVWTGSPNP  175

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            +NST+LGVSMS+S GY K+APPKSKY IDGT+VK   + S      A+ LT+  GE QDL
Sbjct  176  ENSTVLGVSMSSS-GYGKKAPPKSKYVIDGTTVKFDSYVSFWASKQAIRLTKKEGEAQDL  234

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I W+QL   AR AL+              MPLKDDVF+  LKK++PF
Sbjct  235  ITWEQLTQEARTALSEADFKAESTFSKVVMPLKDDVFSSILKKAYPF  281

>PHYSO_254108
Length=246

 Score = 246 bits (628),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 154/225 (68%), Gaps = 5/225 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQP AQP  +T +QK AVK+KPQL+   GC+PYPAVQA+GS SGGL W+     G
Sbjct  26   INHDQVQPMAQPTPVTDAQKLAVKYKPQLRVSYGCHPYPAVQANGSVSGGLEWSGPAD-G  84

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+YARS W++D WA MYTWYFPKG +       GHRH WE+ ++W D+P+ 
Sbjct  85   DCEGSSLGSQVYARSDWFKDKWATMYTWYFPKGRQDV----WGHRHFWEYAIIWTDSPSP  140

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            DNST LG+SMSA +G+ K+ P   KY++G SVK+   YS++    AL+LT+D+G+ QDLI
Sbjct  141  DNSTFLGISMSAGVGHGKQTPVLLKYMNGNSVKLESHYSVLGNKAALQLTKDSGDFQDLI  200

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
             W QLP  ARDALN D     +     +MPLKD VF   L K++P
Sbjct  201  TWGQLPVPARDALNGDAFDVTYFFNKFEMPLKDRVFMSVLNKAYP  245

>PHYCA_129784
Length=246

 Score = 244 bits (623),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 157/227 (69%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQV+PF QP  +T+S++AA+KFKPQL  +DGC+PYPAV   G T GGL+ T     
Sbjct  31   TIDHDQVKPFPQPQPVTISERAAMKFKPQLHVVDGCHPYPAVNDAGETGGGLKTTGSPTA  90

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQ+Y RSTW+RDVWAIMY+WYFPK S ++G   LGHRH+WE V+VWI NP 
Sbjct  91   G-CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPSTG---LGHRHDWEHVIVWISNPD  146

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            + N TIL V+ SA  GYSK APP +  +DGTS+KV Y  S    N A ++T +AGE QDL
Sbjct  147  VPNPTILAVTPSAHSGYSKYAPPSADTVDGTSIKVRY-ESTYPMNHATDVTTEAGEFQDL  205

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMWDQ+ D AR+ALNT       + G+A +P+ D  F  KL K+WPF
Sbjct  206  IMWDQMTDAARNALNT------VSFGDANVPMNDGNFVPKLDKAWPF  246

>PHYSO_526774
Length=249

 Score = 244 bits (623),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 151/228 (66%), Gaps = 4/228 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD VQP AQP   T S+K AVK+KPQL    GC+PYPAVQADGS S GL+W+     G
Sbjct  24   INHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWAN-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C    LGSQ+Y+RS WY+  WAIMY WYFPKG     G   GH H W + +VWIDNP  
Sbjct  83   KCKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGRRMGDGYNSGHHHYWSYAIVWIDNPNP  142

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            DNSTILGVSMSA +GY K +PPKSKY +DG +VK   + S       + LT  +G+ QDL
Sbjct  143  DNSTILGVSMSAGVGYRKASPPKSKYVVDGVTVKFDSYRSFWGSKQGVRLTTKSGDQQDL  202

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I W+QL D AR AL + D+D   W+L N  MPLKDD   ++L+K++PF
Sbjct  203  ITWEQLTDEARTALSDADFDVN-WSLKNVVMPLKDDALRERLEKAYPF  249

>PHYSO_526623
Length=249

 Score = 244 bits (622),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 152/228 (67%), Gaps = 4/228 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD VQPFAQP   T S+K AVKFKPQL    GC+PYPAV+A+GS S GL+WT     G
Sbjct  24   INHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVEANGSVSAGLKWTGWAD-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+Y+RS WY+D WAIMY WYFPKG + +     GHRH W + +VW D+   
Sbjct  83   DCKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYASQYRSGHRHFWSYAIVWTDSDKP  142

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            DNSTI GVSMSA +GY K  PPKSKY +DG +VK   ++S       +  T   GETQDL
Sbjct  143  DNSTIQGVSMSAGVGYGKATPPKSKYVVDGVTVKFDSYFSFWGSKVGIRTTTKTGETQDL  202

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I W+QL D AR AL + D+D   W+     MPL DDVFT+KL+K++PF
Sbjct  203  ITWEQLTDEARTALTDADFDVD-WSYKKVVMPLLDDVFTEKLEKAYPF  249

>PYVX_22467
Length=236

 Score = 243 bits (620),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 149/225 (66%), Gaps = 13/225 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP + + S KAAVKFKPQL   DGC+PYPAV + G+TSGGL+ +     G
Sbjct  22   IDHDQVVPFAQPTATSTSHKAAVKFKPQLHISDGCHPYPAVDSSGNTSGGLKPSGSSSAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY RSTWY  VWAIMY+WYFPK S ++G   LGHRH+WE VVVWI NPA+
Sbjct  82   -CKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPSTG---LGHRHDWEHVVVWISNPAV  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            D+ T+  VS SA  GYS   PP S Y+DG S K+ YF  IV  N A  +T  AGETQDLI
Sbjct  138  DSPTVYAVSTSAHSGYSIYYPPSSSYMDGNSAKIDYF-KIVVINHAFRMTSSAGETQDLI  196

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQ+ D AR AL NTD        G+A +P KD  F  KL  +W
Sbjct  197  MWDQMTDAARIALENTD-------FGDANVPFKDGNFMTKLASAW  234

>PITG_19938
Length=245

 Score = 242 bits (618),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 158/226 (70%), Gaps = 8/226 (4%)

Query  29   HDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDC  88
            HD+VQPF QP  IT SQK+AVK+KPQL    GC+PYPAV+ +GS SGGL W+     GDC
Sbjct  26   HDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPAD-GDC  84

Query  89   TDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GHRHNWEFVVVWIDNPALD  147
            T  PLGSQ+Y+RS WY++ WAIMY WYFPKG       GL GHRH WE+VVVW D+    
Sbjct  85   TGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR-----YGLTGHRHYWEYVVVWADSSTST  139

Query  148  NSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIM  207
            +S+I GVSMSA +G++K  PP  KYI G+SVK+  ++S +    AL+LT++ GETQDLI 
Sbjct  140  SSSIQGVSMSAGVGHAKATPPMLKYIHGSSVKLDSYFSFLGSKAALQLTKETGETQDLIT  199

Query  208  WDQLPDVARDALNTD-WDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            WDQ+   ARD LN+D  D  +W     ++P KD +F K+L+ ++PF
Sbjct  200  WDQMTVAARDTLNSDTLDGNVWLTNKDEVPFKDTIFLKRLEDAFPF  245

>PHYRA_74306
Length=245

 Score = 241 bits (616),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 154/227 (68%), Gaps = 6/227 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+VQPFA+P  +T S+KAAVKFKPQL    GCYPYPAVQADGS S GLR +     G
Sbjct  24   IDHDKVQPFAEPEPMTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLRGSGPAD-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C    LGSQ+Y+RS WY D WAIMYTWY PKG  T        RH WE  VVWID+PAL
Sbjct  83   ECRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRSTRHQ----RRHFWETAVVWIDDPAL  138

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             NSTILGVSM+      ++ P K KY+DG+SVK+  + +  F    L+ T++ G+ QDLI
Sbjct  139  ANSTILGVSMNYGWRSKEQTPVKVKYLDGSSVKLESYRAYGFPKPRLQFTQEDGQFQDLI  198

Query  207  MWDQLPDVARDALNT-DWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             W+QL + ARDAL+T D+DT L      +MPLKDD+F  +LK +WPF
Sbjct  199  TWEQLTEEARDALSTADFDTYLIEQKKREMPLKDDIFEYRLKDAWPF  245

>PHYSO_261265
Length=247

 Score = 241 bits (616),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 158/229 (69%), Gaps = 3/229 (1%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            N IP+D+V PFAQP  +T   K  +K+KP LK  +GC+PYPAVQ +G  SGGL W+    
Sbjct  21   NVIPYDEVHPFAQPAPVTDLHKTMLKYKPHLKIKEGCHPYPAVQKNGDISGGLEWSSPTD  80

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
              +C   PLGSQ+YARS+W +  +AIMY WYFP G   +  +  GHR+ WE+ +VW+D+ 
Sbjct  81   NAECKGSPLGSQVYARSSWVKGKFAIMYAWYFPMGR--APLLPFGHRNGWEYAIVWLDSV  138

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
            +  NSTILG S+SA++G++K  P   KY+DG ++KV+Y+++     TA+E TE+ GE QD
Sbjct  139  SSTNSTILGTSLSAAVGWAKEVPRNRKYLDGNNLKVAYYFNRDVRCTAVEYTEEIGEFQD  198

Query  205  LIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            +I WDQLP   RD+L NTDWD T +N+   +MP+KD VF +KL  ++PF
Sbjct  199  VITWDQLPAPTRDSLSNTDWDHTPFNVALLKMPMKDGVFQEKLNSAYPF  247

>PHYRA_74310
Length=249

 Score = 241 bits (616),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 153/228 (67%), Gaps = 4/228 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD VQPFAQP   T S+K AVKFKPQL    GC+PYPAV A+GS + GL+W      G
Sbjct  24   IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVDANGSVNAGLKWAGWAD-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    +GSQ+Y+RS WY+D WAIMY WYFPKG + +     GHRH W + +VW D+ + 
Sbjct  83   DCKGSAMGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTSKYRAGHRHYWSYGIVWTDSSSP  142

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            DNSTILGVSMSA +G+ K  PPKSKY IDGT+VK   F+S       ++LT   G TQ L
Sbjct  143  DNSTILGVSMSAGVGFGKATPPKSKYVIDGTTVKFDSFWSFWGSKLGVKLTTKEGATQAL  202

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I W+Q+ + AR AL + D+D   W+     MP+ DDVFTKKLKK++PF
Sbjct  203  ITWEQMTEEARTALTDADFDVD-WSFRKVVMPMSDDVFTKKLKKAYPF  249

>PHYSO_507736
Length=236

 Score = 241 bits (614),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 148/225 (66%), Gaps = 13/225 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP   + SQ AAVKFKPQL   +GC+PYPAV ADG+TSGGL  T     G
Sbjct  22   IDHDQVVPFAQPTPTSTSQTAAVKFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSSSAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY RSTWY  VWAIMY+WYFPK S  S   G GHRH+WE +VVW++NPA+
Sbjct  82   -CKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---GFGHRHDWEHIVVWLNNPAV  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             +  +L VS SA  GY+   PP S Y+DG S K+ Y Y+++  N A  +T D+GETQDLI
Sbjct  138  TSPELLAVSTSAHSGYTTYYPPSSSYLDGNSAKIDY-YNVLLINHAFRMTSDSGETQDLI  196

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL NTD        G+A +P KD  F  KL  +W
Sbjct  197  MWDQLTDAARTALENTD-------FGDANVPFKDANFETKLANAW  234

>PHYCA_122048
Length=236

 Score = 241 bits (614),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 152/227 (67%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I H+QV PFAQP + T+SQKAA+KFKPQ+   +GC+PYPAV   G TSGGL+ T     
Sbjct  21   TIDHNQVVPFAQPEATTISQKAAIKFKPQIHITNGCHPYPAVNEAGETSGGLK-TSGAPS  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C     GSQ+Y RSTWY   WAIMY+WYFPK S ++G   LGHRH+WE VVVWIDNP 
Sbjct  80   SSCKGSGWGSQVYGRSTWYNGKWAIMYSWYFPKDSPSTG---LGHRHDWEHVVVWIDNPD  136

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            + N TIL  S SA  GYS  APP S  +DGTSVKV+Y  +    N AL++T  +GETQDL
Sbjct  137  VANPTILATSPSAHSGYSFYAPPSSDSVDGTSVKVNYESNWPI-NHALDMTSKSGETQDL  195

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMWDQL + AR ALNT       + G A +P+ D  F  KL K+WPF
Sbjct  196  IMWDQLSEAARYALNTT------DFGKANVPMNDGNFVAKLGKAWPF  236

>PPTG_17049
Length=255

 Score = 241 bits (615),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 163/235 (69%), Gaps = 11/235 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            +S+ HD+V+PF QP  IT SQKAAVKFKPQL    GC+PYPAVQADG+ SGGL+++  G+
Sbjct  23   SSVGHDRVKPFPQPEPITTSQKAAVKFKPQLSIAFGCHPYPAVQADGAVSGGLKYS--GK  80

Query  85   -RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL--GHRHNWEFVVVWI  141
              GDC    LGSQ+Y+RSTWYRDVWAI Y WY PKG E   G+ +  GHRH W +V VWI
Sbjct  81   PDGDCKGSALGSQVYSRSTWYRDVWAITYAWYLPKGYERFSGLSMVEGHRHFWGYVTVWI  140

Query  142  DNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIV---FGNTALELTED  198
            +NPA++N+ ILGVSMS  +G+  +AP   K +DG+++K+ +   ++    G   L   E 
Sbjct  141  NNPAVENAYILGVSMSGQLGHDTQAPVDKKCVDGSTLKLEFDGHVMDGAKGKQGLRCVEA  200

Query  199  AGETQDLIMWDQLPDVARDALNT-DWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             G+ QDLI WDQL + ARD+LNT ++D+   ++G   +PLKD VFT  L  +WPF
Sbjct  201  VGKFQDLITWDQLTEAARDSLNTYNFDSIGRDMGT--VPLKDGVFTNLLNSTWPF  253

>PITG_22053
Length=245

 Score = 240 bits (613),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 155/228 (68%), Gaps = 8/228 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            + HD+VQPFAQP  IT SQK+AVK+KPQL    GC+PYPAV+ +   SGGL W      G
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPAD-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GHRHNWEFVVVWIDNPA  145
            DCT  PLGSQ+Y+RS WY++ WAIMY WYFPKG       GL GHRH WE+VVVW D P 
Sbjct  83   DCTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR-----YGLTGHRHYWEYVVVWTDTPT  137

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
              NS+I GVSMSA +G++K  PP  KYI G+S+K+  ++S +    AL+LT++ GE QDL
Sbjct  138  STNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQDL  197

Query  206  IMWDQLPDVARDALNTD-WDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I WDQ+   AR  LN+D  D  +W     ++P KD +F K+L+ ++PF
Sbjct  198  ITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLENAFPF  245

>PHYRA_74343
Length=249

 Score = 239 bits (611),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 152/228 (67%), Gaps = 4/228 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD VQPFAQP   T S+K AVKFKPQL    GC+PYPAV A+GS + GL+W      G
Sbjct  24   IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKW-AGWDDG  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+Y+RS WY+D WAIMY WYFPKG + +     GHRH W + +VW D+ + 
Sbjct  83   DCKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTSAYRTGHRHYWSYGIVWTDSSSP  142

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            DNSTILGVSMSA +G+ K  PPKSKY +DGT+VK   F S       ++LT   GE QDL
Sbjct  143  DNSTILGVSMSAGVGFGKATPPKSKYVVDGTTVKFDSFRSFWGSKMGVKLTTKEGEMQDL  202

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I W+Q+ + AR AL + D+D   W++    MP+ DDVF  KLKK++PF
Sbjct  203  ITWEQMTEEARTALTDADFDVD-WSVRKVVMPMSDDVFMTKLKKAYPF  249

>PITG_04208
Length=245

 Score = 239 bits (611),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 154/228 (68%), Gaps = 8/228 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            + HD+VQPFAQP  IT SQK+AVK+KPQL    GC+PYPAV+ +   SGGL W      G
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPAD-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GHRHNWEFVVVWIDNPA  145
            DCT  PLGSQ+Y+RS WY++ WAIMY WYFPKG       GL GHRH WE+VVVW D P 
Sbjct  83   DCTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR-----YGLTGHRHYWEYVVVWTDTPT  137

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
              NS+I GVSMSA +G++K  PP  KYI G+S+K+  ++S +    AL+LT++ GE QDL
Sbjct  138  STNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQDL  197

Query  206  IMWDQLPDVARDALNTD-WDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I WDQ+   AR  LN+D  D  +W     ++P KD +F K+L  ++PF
Sbjct  198  ITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLANAFPF  245

>PHYSO_329843
Length=239

 Score = 239 bits (609),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 151/226 (67%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP ++T+SQKAAVKFKPQ+   +GC+PYPA    G TSGGL+ T      
Sbjct  25   IDHDQVVPFAQPEAVTISQKAAVKFKPQIHITNGCHPYPAANEAGQTSGGLKPTGA-PSS  83

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTWY   WAIMY+WYFPK S ++G   LGHRH+WE VVVWIDNP +
Sbjct  84   SCKGSGWGSQVYGRSTWYSGRWAIMYSWYFPKDSPSTG---LGHRHDWEHVVVWIDNPDV  140

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +N TIL  S SA  GYS   PP +  IDGTSVKV+Y       N AL++T ++GE QDLI
Sbjct  141  ENPTILSTSPSAHSGYSYYVPPSADSIDGTSVKVNYESHWPI-NHALDMTSESGEFQDLI  199

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MWDQL D AR ALNT       + G+A +P+ D  F  KL K+WPF
Sbjct  200  MWDQLSDAARLALNTT------SFGSANVPMNDGNFLTKLGKAWPF  239

>PPTG_15230
Length=252

 Score = 238 bits (607),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 156/227 (69%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQV+PFAQP  +T+S++AA+KFKPQ+   DGC+PYPAV   G T GGL+ T     
Sbjct  37   TIGHDQVKPFAQPQPVTISERAAIKFKPQIHIGDGCHPYPAVNDIGETGGGLKTTGSPTA  96

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQ+Y RSTW+RDVWAIMY+WYFPK S ++   GLGHRH+WE V+VWI+NP 
Sbjct  97   G-CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST---GLGHRHDWEHVIVWINNPD  152

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            + +  IL V+ SA  GYSK APP +  +DGTSVKV+Y  S    N A ++T D GE QDL
Sbjct  153  VPDPIILAVTPSAHSGYSKYAPPNADTLDGTSVKVNY-ESTYPMNHATDVTTDPGEFQDL  211

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMWDQ+ D AR ALNT       + G+A +P+ D  F  KL K+WPF
Sbjct  212  IMWDQMTDAARLALNT------VSFGDANVPMNDGNFIPKLDKAWPF  252

>PHYRA_72438
Length=236

 Score = 237 bits (604),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 146/224 (65%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PFAQP   +VSQ AAV FKPQL   +GC+PYPAV ADG+TSGGL  T     G
Sbjct  22   IDHDTVVPFAQPTPTSVSQVAAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSSSAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY RSTWY  VWAIMY+WYFPK S  S   G GHRH+WE +VVW++NPA+
Sbjct  82   -CKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---GFGHRHDWEHIVVWLNNPAV  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             +  IL VS SA  GY+   PP S Y+DG S K+ Y YS++  N A  +T D GETQDLI
Sbjct  138  SSPEILAVSTSAHSGYTFYYPPDSDYLDGNSAKIDY-YSVLLINHAFRMTSDTGETQDLI  196

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL    DT   + G+A +P KD  F  KL  +W
Sbjct  197  MWDQLTDAARTALE---DT---DFGDANVPFKDTNFETKLANAW  234

>PHYRA_74307
Length=249

 Score = 237 bits (605),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 154/228 (68%), Gaps = 4/228 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD VQPFAQP   T S+K AVKFKPQL    GC+PYPAV A+GS + GL+W      G
Sbjct  24   IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWAD-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+Y+RS  Y+D WAIMY WYFPKG +       GHRH W + +VW D+ + 
Sbjct  83   DCKGSGLGSQVYSRSDSYKDKWAIMYAWYFPKGRQYIHKYHSGHRHYWSYGIVWTDSSSP  142

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            DNSTILGVSMSA +GY K +PPKSK+ IDGT+VK   + S       + LT+  G+TQDL
Sbjct  143  DNSTILGVSMSAGVGYRKVSPPKSKFVIDGTTVKFDSYKSFWGSKQGVRLTKKTGDTQDL  202

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I W+Q+ + AR AL +TD+D   W+L    MPL DD FT++L+KS+PF
Sbjct  203  ITWEQMTEEARTALVDTDFDVE-WSLKKVVMPLSDDAFTERLEKSYPF  249

>PHYSO_249692
Length=248

 Score = 236 bits (602),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 157/227 (69%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQV+PFAQP  +T+S++AAVKFKPQL   +GC+PYPAV   G TSGGL+ +     
Sbjct  33   TISHDQVRPFAQPEPVTISERAAVKFKPQLHVTNGCHPYPAVNDAGETSGGLKTSGAPSA  92

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQ+Y RSTW+RDVWAIMY+WYFPK S ++   GLGHRH+WE V+VWI+NP 
Sbjct  93   G-CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST---GLGHRHDWEHVIVWINNPD  148

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            + +  IL V+ SA  GYSK +PP +  +DGTS+KV+Y  +    N A ++T + G+ QDL
Sbjct  149  VPDPIILAVTPSAHSGYSKYSPPNADTLDGTSIKVNYESNYPM-NHATDVTTEGGDFQDL  207

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMWDQ+ D+AR ALN        + G+A +P+ D  F  KL ++WPF
Sbjct  208  IMWDQMSDLARRALNE------VSFGDANVPMNDGNFVGKLDRAWPF  248

>PPTG_15233
Length=235

 Score = 236 bits (601),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 146/224 (65%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP   +VSQ AA  FKPQL   +GC+PYPAV  DG+TSGGL  T     G
Sbjct  21   IDHDQVVPFAQPTPTSVSQIAAFNFKPQLHITNGCHPYPAVDTDGNTSGGLNPTGSSSAG  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY RSTWY  VWAIMY+WYFPK S  S   G GHRH+WE +VVW++NPA+
Sbjct  81   -CKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---GFGHRHDWEHIVVWLNNPAV  136

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             +  IL VS SA  GY+   PP S Y+DG S K+ Y YS++  N +  +T D+GETQDLI
Sbjct  137  TSPEILAVSTSAHSGYTVYYPPSSDYLDGNSAKIDY-YSVLLINHSFRMTSDSGETQDLI  195

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL    DT   + G+A +P KD  F  KL  +W
Sbjct  196  MWDQLTDAARTALE---DT---DFGDANVPFKDANFETKLANAW  233

>PHYCA_11951
Length=234

 Score = 235 bits (599),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 145/223 (65%), Gaps = 13/223 (6%)

Query  29   HDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDC  88
            HDQV PFAQP   ++SQ  AV FKPQL   +GC+PYPAV ADG+TSGGL        G C
Sbjct  22   HDQVVPFAQPTPTSISQTTAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPAGSSSAG-C  80

Query  89   TDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDN  148
                 GSQIY RS WY  VWAIMY+WYFPK S +S   G GHRH+WE +VVW+DNPA+ +
Sbjct  81   KGSGYGSQIYGRSAWYNGVWAIMYSWYFPKDSPSS---GFGHRHDWEHIVVWLDNPAVAS  137

Query  149  STILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMW  208
              IL VS SA  GY+   PP S Y++G S K+ Y YSI+  N A  +T DAGETQ+LIMW
Sbjct  138  PKILAVSTSAHSGYTVYYPPNSNYLNGKSAKIDY-YSILLINHAFRMTSDAGETQNLIMW  196

Query  209  DQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            DQ+ D AR AL NTD        G+A +P KD  F  KL  +W
Sbjct  197  DQMTDAARTALQNTD-------FGDANVPFKDGNFESKLANAW  232

>PITG_04267
Length=279

 Score = 236 bits (603),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 157/229 (69%), Gaps = 4/229 (2%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQVQPF Q    T S+K+A+K+KPQL   DGC+PYPAVQ++GS SGGL+W+     
Sbjct  53   TINHDQVQPFEQIKPATDSEKSAIKYKPQLHISDGCHPYPAVQSNGSISGGLKWSGKAN-  111

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            GDC +P LGSQ+Y+RS W++  WAIMY WYFPKG +       GHRH W + ++W D+P 
Sbjct  112  GDCKEPGLGSQVYSRSAWFKGKWAIMYAWYFPKGPQFVLRFDTGHRHFWSYAILWTDDPN  171

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYI-DGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
             DNSTILGVSMS S GY K + PK+KYI  GT+VK+  + S   G  AL+LT+  GETQD
Sbjct  172  HDNSTILGVSMSGSRGYVKESSPKAKYIVKGTTVKLDSYASFWMGVQALQLTKKLGETQD  231

Query  205  LIMWDQLPDVARDALNTDWD-TTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LI W+QL D A DAL T++D  +  +     MPL DD FT  LK S+PF
Sbjct  232  LITWEQLTDEACDAL-TEFDFESDPSRAMVVMPLGDDNFTPILKDSYPF  279

>PHYRA_71308
Length=236

 Score = 234 bits (597),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 145/224 (65%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PFAQP   +VSQ AAV FKPQL   +GC+PYPAV ADG+TSGGL  T     G
Sbjct  22   IDHDTVVPFAQPTPTSVSQIAAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSSSAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY RSTWY  VWAIMY+WYFPK S  S   G GHRH+WE +VVW++NPA+
Sbjct  82   -CKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---GFGHRHDWEHIVVWLNNPAV  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             +  IL VS SA  GY+   PP   Y+DG S K+ Y YS++  N A  +T D GETQDLI
Sbjct  138  SSPEILAVSTSAHSGYTFYYPPDLDYLDGNSAKIDY-YSVLLINHAFRMTSDTGETQDLI  196

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL    DT   + G+A +P KD  F  KL  +W
Sbjct  197  MWDQLTDAARTALE---DT---DFGDANVPFKDTNFETKLANAW  234

>PHYRA_52440
Length=243

 Score = 234 bits (597),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 155/225 (69%), Gaps = 6/225 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            + HD VQPFAQP  +T SQK+AVK+KPQL    GC+PYPAV+A+G  SGGL W+     G
Sbjct  24   VNHDLVQPFAQPTPVTDSQKSAVKYKPQLYISYGCHPYPAVEANGYASGGLEWSGPND-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+Y+RS WY + WAIMY WYFPKG     G+  GHR+ WE+ +VW D+ + 
Sbjct  83   DCKGSSLGSQVYSRSDWYHEKWAIMYAWYFPKGRY---GV-TGHRNYWEYAIVWTDSTSP  138

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            DNST+LGVSMSA +G+ K  PP  KY++G+SVK++  +S++    ALELT+  GE QDLI
Sbjct  139  DNSTLLGVSMSAGVGHDKTTPPMLKYMNGSSVKLNSHFSLLGSKAALELTKKEGEFQDLI  198

Query  207  MWDQLPDVARDALNTD-WDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
             WDQL   AR+ LN+D  D  +W     ++P KDD+F  +L+ ++
Sbjct  199  TWDQLTVAARETLNSDALDGNVWLSNKDEVPFKDDIFVDRLEDAY  243

>PHYRA_76249
Length=326

 Score = 234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 149/226 (66%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV+PFAQP  IT+S+KA VKFKPQ+   +GC+PYPAV   G T GGL+ T      
Sbjct  112  IDHDQVKPFAQPEPITISEKAGVKFKPQIHVTNGCHPYPAVNEAGETGGGLK-TKGAPSA  170

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RS WY+DVWAIMY+WYFPK S ++G   LGHRH+WE V+VWIDNP +
Sbjct  171  GCKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPDV  227

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +N  IL V+ SA  GYSK+ PP +  +DGTSVKV Y       N ALE T   G+ QDLI
Sbjct  228  ENPKILAVTPSAHSGYSKQVPPNADSVDGTSVKVEYKSKWPI-NHALESTSQGGDFQDLI  286

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MWDQL + AR ALN    +  W  G+A  P+ D  F  KL K+WPF
Sbjct  287  MWDQLSENARRALN----SVPW--GDANTPMNDGNFQNKLGKAWPF  326

>PHYKE_4946
Length=263

 Score = 232 bits (591),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 150/228 (66%), Gaps = 11/228 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
             +IPH  V+PF QP  IT+S+KAAVKFKPQL  L GC  YPAV   G TSGGL+ +    
Sbjct  47   KTIPHKDVKPFIQPEPITISEKAAVKFKPQLAILSGCVSYPAVNDIGETSGGLQES-GSP  105

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
            +G C     GSQ+Y RS WY DVWAIMY+WYFPK S +S    LGHRH+WE VVVWIDNP
Sbjct  106  KGGCRGSGHGSQVYGRSVWYSDVWAIMYSWYFPKDSPSS---RLGHRHDWEHVVVWIDNP  162

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
             +    IL VS S   G+ K APP +  IDGTSVKV Y +S    N AL++T+ AG+ QD
Sbjct  163  EVLEPKILAVSPSYHSGHKKYAPPSADVIDGTSVKVKYEHSWPL-NHALDVTDKAGDFQD  221

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LIMWDQ+ D+AR ALN          G A +P+ D  F +KL+++WPF
Sbjct  222  LIMWDQMTDLARVALNET------KFGKANVPMNDHNFLRKLEQAWPF  263

>PPTG_17409
Length=235

 Score = 231 bits (588),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 150/226 (66%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQPFAQP  +T+S+KAAVKFKPQL   +GC+PYPAV A G T GGL+ T     G
Sbjct  21   IDHDQVQPFAQPEPVTISEKAAVKFKPQLHITNGCHPYPAVNAAGDTGGGLKPTGA-PSG  79

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW+  VWAIMY+WYFPK S +S    LGHRH+WE VV+WI+NP +
Sbjct  80   SCKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSS---SLGHRHDWENVVIWINNPDV  136

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             N  IL +  SA  GYS+ APP +  IDGTS KV+Y       N A + T + G+ QDLI
Sbjct  137  PNPVILAICPSAHGGYSRYAPPDADTIDGTSAKVNYESHWPI-NHATDTTSEGGDFQDLI  195

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MWDQL D AR AL    DT   + G+A +P+K+  F   L+K+WPF
Sbjct  196  MWDQLTDAARTALQ---DT---DFGDANVPMKEGSFLSNLEKAWPF  235

>PHYCA_107869
Length=342

 Score = 234 bits (596),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 150/227 (66%), Gaps = 13/227 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV+PFAQP  +T+S+KAAVK+KPQ+  ++GC+PYPAV   G TSGGL+ T      
Sbjct  128  IDHDQVKPFAQPEPVTISEKAAVKYKPQIHIVNGCHPYPAVNEAGETSGGLK-TKGAPSA  186

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW R VWAIMY+WYFPK S +SG   LGHRH+WE V+VWIDNP +
Sbjct  187  GCKGSGWGSQVYGRSTWVRGVWAIMYSWYFPKDSPSSG---LGHRHDWEHVIVWIDNPDI  243

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +N  IL V+ SA  GYSK+ PPK+  +DGTSVKV Y       N AL+ T + G+ QDLI
Sbjct  244  ENPKILAVTPSAHSGYSKQVPPKADCVDGTSVKVKYESKWPV-NHALDSTSEGGDFQDLI  302

Query  207  MWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MWDQL + AR A+N   W       G A  P  D  F  KL K+WPF
Sbjct  303  MWDQLSENARRAMNGVGW-------GKANTPFNDGNFLPKLDKAWPF  342

>PHYSO_526071
Length=249

 Score = 231 bits (588),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 145/228 (64%), Gaps = 4/228 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD VQP AQP   T S+K AVK+KPQL    GC+PYPAVQADGS S GL+W+     G
Sbjct  24   INHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWAN-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C    LGSQ+Y+RS WY+  WAIMY WYFPKG +       GHRH W + +VW D+   
Sbjct  83   KCKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGRQYVSKYRKGHRHFWSYAIVWTDSDKP  142

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            DNSTI GVSMSA +G+ K  PPKSKY IDG +VK   ++S       +  T   GE+QDL
Sbjct  143  DNSTIQGVSMSAGVGFRKATPPKSKYVIDGVTVKFDSYFSFWGSKVGIRTTTKTGESQDL  202

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            I W+QL D AR  L N D+D   W+     MPL D+ FT KLKK++PF
Sbjct  203  ITWEQLTDEARTGLTNADFDVD-WSYRKVVMPLSDEDFTDKLKKAYPF  249

>PPTG_17245
Length=257

 Score = 231 bits (588),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 154/235 (66%), Gaps = 9/235 (4%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQVQPF +    T S+K+A+K+KPQL    GCYPYPAVQA+G+ SGGL+W+     
Sbjct  23   TINHDQVQPFEEMEPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWAN-  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
             DC  P  GSQIY+RS WY+  WAIMY WYFPKG+  +     GHRH W   +VW DN  
Sbjct  82   SDCEKPVQGSQIYSRSDWYKGKWAIMYAWYFPKGAFRASKYNRGHRHFWSSAIVWTDNTN  141

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYID-GTSVKVSYFYSIVFGNTALELTEDAGETQD  204
             DNSTILGVSMS S GY K+  PK+KYI+ GT++K+  +      N AL LT+ +G TQD
Sbjct  142  PDNSTILGVSMSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQD  201

Query  205  LIMWDQLPDVARDALNT---DWDTT----LWNLGNAQMPLKDDVFTKKLKKSWPF  252
            L+ W+QL D ARDAL+    D DT+      +     MPL+D VFT  L++S+PF
Sbjct  202  LVTWEQLTDEARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  256

>PHYCA_108039
Length=215

 Score = 229 bits (583),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 149/224 (67%), Gaps = 11/224 (5%)

Query  29   HDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDC  88
            HDQVQPF QP+ +TVS+KAAVKFKPQ+   +GC+PYPAV   G TSGGL+ T       C
Sbjct  3    HDQVQPFKQPDPVTVSEKAAVKFKPQIHITNGCHPYPAVTWWGETSGGLK-TKGAPSAGC  61

Query  89   TDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDN  148
                 GSQ+Y RSTW + VWAIMY+WYFPK S ++G   LGHRH+WE V+VWIDNP ++N
Sbjct  62   KGSGWGSQVYGRSTWVKGVWAIMYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPDIEN  118

Query  149  STILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMW  208
              IL V+ SA  GYSK+ PP +  +DGTSVKV Y       N ALE T + GETQDLIMW
Sbjct  119  PKILAVTPSAHSGYSKQVPPSADCVDGTSVKVKYESKWPI-NHALESTTEGGETQDLIMW  177

Query  209  DQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            +QL + A  A+N    +  W  G+A  P  D  F  KL K+WPF
Sbjct  178  NQLSENALRAMN----SVTW--GDANCPFCDGNFQAKLDKAWPF  215

>PHYRA_74356
Length=244

 Score = 229 bits (585),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 150/227 (66%), Gaps = 7/227 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQPFA+P   T S+KAAVKFKPQL    GCYPYPAVQADGS S GL+ +     G
Sbjct  24   IDHDQVQPFAEPEPTTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLKGSGPAD-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +CT   LGSQ+Y+RS WY D WAIMY WY PKG+          RH WE  VVWID+PAL
Sbjct  83   ECTGSSLGSQVYSRSDWYEDKWAIMYAWYLPKGN-----YKYQRRHYWETAVVWIDDPAL  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             NSTILGVSM+         P +++++DG+SVK+  +    +    L+ T++ GE QDLI
Sbjct  138  SNSTILGVSMNYGRRSEFETPVQARFLDGSSVKLDSYRGYGYPKPRLQFTQEEGEFQDLI  197

Query  207  MWDQLPDVARDALNT-DWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             W+QL + ARDAL+T D+D  L+     +MPLKD +F  +LK +WPF
Sbjct  198  TWEQLTEEARDALSTADFDGPLFKKKKRKMPLKDGIFEFRLKDAWPF  244

>PHYRA_71404
Length=245

 Score = 229 bits (585),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 153/229 (67%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HDQV+PF QP+ +T+S+KA VKFKPQL   +GC+ YPAV   G TSGGL+ T   
Sbjct  28   TVTIDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAP  87

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
              G C     GSQ+Y RS WY+DVWAIMY+WYFPK   ++G   +GHRH+WE V+VWIDN
Sbjct  88   SAG-CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPSTG---IGHRHDWEHVIVWIDN  143

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P ++N  IL V+ SA  GY K APP +  IDGT+ KV+Y       + AL+ + +AG+ Q
Sbjct  144  PDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVAYESHWPM-DHALDSSSEAGDFQ  202

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQL + AR ALN+       N GNA +P+ D  F  KL ++WPF
Sbjct  203  DLIMWDQLSENARRALNSV------NFGNANVPMNDGNFQAKLGRAWPF  245

>PHYRA_72433
Length=245

 Score = 229 bits (584),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 153/229 (67%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HDQV+PF QP+ +T+S+KA VKFKPQL   +GC+ YPAV   G TSGGL+ T   
Sbjct  28   TVTIDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAP  87

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
              G C     GSQ+Y RS WY+DVWAIMY+WYFPK   ++G   +GHRH+WE V+VWIDN
Sbjct  88   SAG-CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPSTG---IGHRHDWEHVIVWIDN  143

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P ++N  IL V+ SA  GY K APP +  IDGT+ KV+Y       + AL+ + +AG+ Q
Sbjct  144  PDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVAYESHWPM-DHALDSSSEAGDFQ  202

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQL + AR ALN+       N GNA +P+ D  F  KL ++WPF
Sbjct  203  DLIMWDQLSENARRALNSV------NFGNANVPMNDGNFQAKLGRAWPF  245

>PHYRA_71931
Length=239

 Score = 229 bits (583),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 151/227 (67%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            ++ HDQVQPFAQP   T+S+KA VKFKPQ+   +GC+PYPAV  +G T GGL+ T     
Sbjct  22   AMDHDQVQPFAQPEPATISEKAGVKFKPQIHITNGCHPYPAVNWNGDTGGGLKPTGA-PS  80

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C     GSQ+Y RSTWY  VWAIMY+WYFPK S ++   GLGHRH+WE VVVWI NP 
Sbjct  81   SSCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPST---GLGHRHDWEHVVVWITNPD  137

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            ++N  IL VS SA  GYS    P +  IDGT+VKV+Y       N AL++T + G+TQDL
Sbjct  138  VENPVILAVSPSAHSGYSYYVSPSADTIDGTAVKVNYESHWPI-NHALDITTEGGDTQDL  196

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMWDQ+ D AR++LNT       + G+A +P+ D  F  KL K+WP+
Sbjct  197  IMWDQMTDAARNSLNTV------SFGDANVPMNDGNFQNKLGKAWPW  237

>PHYRA_42876
Length=213

 Score = 227 bits (579),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 146/224 (65%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQPFAQP  IT+S+K+ VKFKPQ+   +GC+PYPAV   G T GGL+ T      
Sbjct  1    IDHDQVQPFAQPEPITISEKSGVKFKPQIHVTNGCHPYPAVNYKGETGGGLK-TKGAPSA  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y R+ W+RDVWAIMY+WYFPK S ++G   LGHRH+WE V+VWIDNP +
Sbjct  60   GCKGSGWGSQVYGRAAWHRDVWAIMYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPDV  116

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +N  IL V+ SA  GYSK+ PP +  +DGTS KV Y       N ALE T   G+ QDLI
Sbjct  117  ENPKILAVTPSAHSGYSKQVPPNADSVDGTSAKVEYKSKWPI-NHALESTSQGGDFQDLI  175

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL + AR ALN    +  W  G+A  P+ D  F  KL K+W
Sbjct  176  MWDQLSENARRALN----SVPW--GDANTPMNDGNFLPKLDKAW  213

>PYIR_13251
Length=236

 Score = 228 bits (580),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 148/225 (66%), Gaps = 11/225 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD V PFAQP  +T+ QK A+KFKPQ+   +GC+PYPAV A G+TSGGL+ +   Q 
Sbjct  21   SIAHDAVVPFAQPTPVTLEQKVALKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSG-SQS  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C     G+Q+Y R+  Y+DV+A+MY+WYFPK S  +G   LGHRH+WE VVVWIDNPA
Sbjct  80   AGCKGSGWGTQVYGRAAAYKDVYALMYSWYFPKDSPFTG---LGHRHDWEHVVVWIDNPA  136

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            + N TIL V+ SA  GY K APPK+  +DGTS KV Y   +V  N AL+ T DAGE Q L
Sbjct  137  VANPTILAVTPSAHSGYEKYAPPKAGTVDGTSAKVDYTSKVVI-NHALDSTTDAGEKQPL  195

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            IMWDQL   AR AL         N G+A +P+KD  F  KL  ++
Sbjct  196  IMWDQLTAAARSALENT------NFGDANVPMKDGNFMTKLGNAY  234

>PPTG_19331
Length=368

 Score = 231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 148/227 (65%), Gaps = 13/227 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV+PF QP  +T+S+KAAVKFKPQ+   +GC+PYPAV   G TSGGL+ T      
Sbjct  152  IDHDQVKPFPQPEPVTISEKAAVKFKPQIHITNGCHPYPAVNEAGETSGGLK-TKGAPSA  210

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW + +WAIMY+WYFPK S +SG   LGHRH+WE V+VWIDNP +
Sbjct  211  KCKGSGWGSQVYGRSTWVQGIWAIMYSWYFPKDSPSSG---LGHRHDWEHVIVWIDNPDV  267

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +N  IL V+ SA  GYSK+ PP +  +DGTSVKV Y       N ALE T + G+ QDLI
Sbjct  268  ENPKILAVTPSAHDGYSKQVPPNADCVDGTSVKVKYESHWPI-NHALESTSEGGDFQDLI  326

Query  207  MWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MWDQL + AR A+N   W       G A  P  D  F  KL+K+WPF
Sbjct  327  MWDQLSEDARRAMNGVGW-------GKANTPFNDGNFKPKLEKAWPF  366

>PYU1_G011231
Length=238

 Score = 226 bits (576),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 146/225 (65%), Gaps = 11/225 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HDQV PFA+P   ++S+KAA+KFKPQ+   +GC+PYPAV A G+TSGGL+ +   Q 
Sbjct  23   SISHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSG-SQS  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C     G+Q+Y RS WY   WAIMY+WYFPK S  +G   LGHRH+WE VVVWIDNPA
Sbjct  82   AGCKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFTG---LGHRHDWEHVVVWIDNPA  138

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
              N TIL VS SA  GY K APPK+  +DGTS KV Y   IV  N AL+ T  AGE Q L
Sbjct  139  NANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVDYTSKIVI-NHALDSTTAAGEKQPL  197

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            IMW+Q+   AR AL           G+A +P+KD  F  KL K++
Sbjct  198  IMWEQMTQAARTALENT------GFGDANVPMKDGNFMDKLAKAY  236

>PYU1_G011237
Length=235

 Score = 225 bits (574),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 148/225 (66%), Gaps = 13/225 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFA+P   ++S+KAA+KFKPQ+   +GC+PYPAV A G+TSGGL+ +   Q  
Sbjct  21   IDHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSG-SQSA  79

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     G+Q+Y RS WY   WAIMY+WYFPK S  +G   LGHRH+WE VVVWIDNPA 
Sbjct  80   GCKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFTG---LGHRHDWEHVVVWIDNPAN  136

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             N TIL VS SA  GY K APPK+  +DGTS KV Y  +IV  N AL+ T  AGE Q LI
Sbjct  137  ANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVDYSSTIVI-NHALDSTTTAGEKQPLI  195

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MW+Q+   AR AL NTD        G+A +P+KD  F  KL  ++
Sbjct  196  MWEQMTQAARTALENTD-------FGDANVPMKDGNFMTKLANAY  233

>PPTG_07671
Length=246

 Score = 224 bits (572),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 145/230 (63%), Gaps = 6/230 (3%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
             N I HD+V+PFAQP   T S+KAAVK+KPQ     GC+PYPAVQADGS S GL+ +   
Sbjct  21   VNYINHDEVEPFAQPKPTTDSEKAAVKYKPQFHVSYGCHPYPAVQADGSVSAGLKGSGP-  79

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
              G+C   PLGSQ+Y+RS WY D+WAIMY WY PKG  T        RH WE  VVWID+
Sbjct  80   MDGECEGSPLGSQVYSRSGWYEDMWAIMYAWYLPKGRSTK----YQRRHYWEVAVVWIDD  135

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            PAL NSTILGVS++    ++ + P + +Y+ G+ VK+  F         L  T+  GETQ
Sbjct  136  PALANSTILGVSLNYGRRHNSQVPVEEQYLHGSRVKLESFKGFGVPRPRLRFTDLEGETQ  195

Query  204  DLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLI W+QL + ARDAL N  +   L       MPLKD VF K+L+ ++PF
Sbjct  196  DLITWEQLTEEARDALSNAKFQRGLIKRLRGDMPLKDGVFEKRLEDAYPF  245

>PHYRA_71477
Length=238

 Score = 224 bits (571),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 148/229 (65%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
             + I HD+V PF QP  +T+S+KAAV+FKP++   +GC+PYPAV   G TSGGL+ T  G
Sbjct  21   ADKIGHDEVVPFPQPEPVTISEKAAVRFKPEIHITNGCHPYPAVSEAGMTSGGLQATG-G  79

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
                C     GSQ+Y RSTWY  VWAIMYTWYFPK S ++    LGHRH+WE VVVWIDN
Sbjct  80   PSSKCKGSGWGSQMYGRSTWYSGVWAIMYTWYFPKDSPSTR---LGHRHDWEHVVVWIDN  136

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P + N  +L VS SA  GYSK  PP +  +DGTSVK++Y  S    N AL+ T  +GE Q
Sbjct  137  PDVSNPILLAVSPSAHSGYSKYVPPSADSVDGTSVKINY-ESHWPVNHALDTTSKSGEFQ  195

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMW Q+ D AR ALNT       + G A MP+ D  F  KL  +WP+
Sbjct  196  DLIMWHQMSDAARLALNTT------DFGKAIMPMNDGSFLGKLAGAWPW  238

>PHYSO_397673
Length=224

 Score = 223 bits (569),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 143/226 (63%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            IPHD+VQPFAQP  +T+S+KA VKFKPQ++ ++GC+PYPAV   G TSGGL+ T  G   
Sbjct  10   IPHDKVQPFAQPEPVTISEKAGVKFKPQIRIINGCHPYPAVNEAGETSGGLK-TTGGHNS  68

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
                    SQ+Y RSTW+R VWAIMY+WYFPK S +    GLGHRH+WE V+VWIDNP  
Sbjct  69   KSKRSGWNSQVYGRSTWFRGVWAIMYSWYFPKDSPSH---GLGHRHDWEHVIVWIDNPDA  125

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL V+ SA   Y K APP +  +DGTS KV Y       N  L +T D+GE QDLI
Sbjct  126  SEPKILAVTPSAHGDYQKYAPPNANTVDGTSAKVVYESHWPM-NHELSVTSDSGEFQDLI  184

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW Q+ + AR A N+       + G A  P+ D  F  +L K+WPF
Sbjct  185  MWSQMSENARRAFNSV------SFGKANTPMNDWGFEDRLGKAWPF  224

>PHYSO_526832
Length=249

 Score = 224 bits (571),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 146/230 (63%), Gaps = 2/230 (1%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
             N I HDQV PFAQ   +  S KAA+KFKP+L+   GC+PYPAVQADG+ S GL+W    
Sbjct  21   VNWINHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWAGKA  80

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
              G C    LGSQ+Y+RS W+   +AIMY WYFPKG E  G I   HRH W ++V+WIDN
Sbjct  81   D-GKCKGSGLGSQVYSRSAWFEGKFAIMYAWYFPKGFEQRGKINYSHRHLWLYLVLWIDN  139

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P  +N  ILGV +  + G  +R PP +K++DG+S+KV Y+ S   G T ++LTE+ GE Q
Sbjct  140  PENENPAILGVWLRTAGGNERRTPPDAKFLDGSSLKVDYYKSSWHGKTGIQLTENPGEFQ  199

Query  204  DLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLI W+Q+ + AR AL   D+D       +  +P  D  FT  LKK+W F
Sbjct  200  DLITWEQMTEEARIALTEADFDGHWQERKDLDVPFIDGEFTVNLKKAWVF  249

>PITG_04248
Length=245

 Score = 224 bits (571),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 147/227 (65%), Gaps = 6/227 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+V+PFAQP   T S+ AAVK+KPQL    GC PYPAVQADGS S GL+ +     G
Sbjct  24   INHDEVKPFAQPKPTTDSEVAAVKYKPQLYVSYGCRPYPAVQADGSVSAGLKGSG-PMDG  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C   PLGSQ+Y+RSTWY D WAIMY WY PKG  T        RH WE  VVWID+PAL
Sbjct  83   ECEGSPLGSQVYSRSTWYEDKWAIMYAWYLPKGRNTK----YQRRHFWEAAVVWIDDPAL  138

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             NSTILGVS++    +  +AP + +Y++G++VK+  +         L  T+  GETQ LI
Sbjct  139  ANSTILGVSLNYGRRHKSKAPLERRYLEGSNVKLESYKGYGKPRPRLRFTQLKGETQHLI  198

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             W+QL   ARDAL N  ++T L+     +MPLKD VF K+LK ++PF
Sbjct  199  TWEQLTKEARDALSNAKFNTGLFKRTKREMPLKDGVFEKRLKDAYPF  245

>PHYSO_468315
Length=255

 Score = 224 bits (571),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 150/229 (66%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HDQV+PFAQP S+T+S+KAAVKFKPQL   +GC+ YPAV   G TSGGL+ T   
Sbjct  36   TITIDHDQVKPFAQPESVTISEKAAVKFKPQLHITNGCHAYPAVDEAGQTSGGLK-TKGA  94

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
                C     GSQ+Y RS WY+DVWAIMY WYFPK   +S   G+GHRH+WE VVVWIDN
Sbjct  95   PSAGCKGSGWGSQVYGRSGWYQDVWAIMYCWYFPKDEPSS---GIGHRHDWEHVVVWIDN  151

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P ++N  IL  + SA  GY K APP +  +DG + KV+ F S    + AL+ T + G+ Q
Sbjct  152  PDVENPKILAGTPSAHSGYHKYAPPNAGTVDGVTTKVA-FESHWPMDHALDSTTEGGDFQ  210

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQL D AR ALN+       + G+A  P+ D  F  +L ++WPF
Sbjct  211  DLIMWDQLTDNARRALNSV------SFGSADTPMNDGNFQAELGRAWPF  253

>PHYCA_123779
Length=277

 Score = 224 bits (571),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 146/227 (64%), Gaps = 13/227 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PF QP  +T+S KAA+KFKPQL   +GC+PYPAV A G TSGGL+ +     G
Sbjct  59   IDHDAVVPFKQPEPVTISDKAAIKFKPQLHITNGCHPYPAVNAIGQTSGGLKTSGAPSAG  118

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW+  VWAIMY+WYFPK S ++G   LGHRH+WE V+VWIDNP +
Sbjct  119  -CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPEV  174

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                ILGV+ SA  GYS + PP +  +DG+SVKV Y       N ALE T + G+ QDLI
Sbjct  175  PEPKILGVTPSAHSGYSSQVPPDADKVDGSSVKVKYLSKWPI-NHALESTGEGGDFQDLI  233

Query  207  MWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW Q+ D AR+ L+ T W       G A +P+ D  F  KL K+WPF
Sbjct  234  MWTQMTDAAREGLSKTGW-------GKANVPMVDGNFEAKLGKAWPF  273

>PHYKE_4438
Length=339

 Score = 226 bits (576),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 150/231 (65%), Gaps = 15/231 (6%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T SI H +VQPF QP  IT+S++AAVKFKPQL   +GC+ YPAV   G TSGGL+ T   
Sbjct  121  TVSISHSEVQPFPQPEPITISERAAVKFKPQLHISNGCHAYPAVNGAGETSGGLK-TTGA  179

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
              G C     GSQ+Y RS W++DVWAIMY+WYFPK S ++   GLGHRH+WE V++WI+N
Sbjct  180  PSGKCKGSGYGSQVYGRSGWHKDVWAIMYSWYFPKDSPST---GLGHRHDWEHVIIWINN  236

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSY--FYSIVFGNTALELTEDAGE  201
            P + +  IL V+ SA  GYS  APP +  +DG + KV+Y  F+ +   N AL +T   G+
Sbjct  237  PEVADPKILAVTPSAHSGYSTYAPPPADSMDGVAAKVNYESFWPV---NHALGMTTKGGD  293

Query  202  TQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             QDLIMWDQL D AR ALN        N G A +P+ D  F  KL K+WPF
Sbjct  294  FQDLIMWDQLTDNARRALNE------VNWGAANVPMNDGNFGGKLDKAWPF  338

>PHYKE_7566
Length=260

 Score = 224 bits (570),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 147/225 (65%), Gaps = 12/225 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP + T  Q A +KFKPQ+   +GC+PYPAV  DG+TSGGL+ T     G
Sbjct  45   ISHDQVVPFAQPTATTTLQAAGIKFKPQIHISNGCHPYPAVNKDGNTSGGLKPTGSASAG  104

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY R T Y+ V+AIMY+WYFPK S  +G   LGHRH+WE V+VW+D+  L
Sbjct  105  -CKGSGYGSQIYGRITTYQGVYAIMYSWYFPKDSPITG---LGHRHDWEHVIVWVDDITL  160

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             N +I+ VS SA  GY+   PPKS  IDG S KV Y  S +  N AL+ T DAGETQDLI
Sbjct  161  TNPSIVAVSPSAHSGYNIYYPPKSGTIDGYSAKVDYSSSYLVVNHALDSTSDAGETQDLI  220

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL NTD+       G+A +P+KD  F  KL  ++
Sbjct  221  MWDQLTDAARTALENTDF-------GDANVPMKDANFQAKLGNAY  258

>PHYKE_2376
Length=322

 Score = 225 bits (573),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 148/229 (65%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HDQV+PF QP  +T+S+KA VKFKPQ+   +GC+PYPAV   G TSGGL+ T   
Sbjct  105  TVTIDHDQVKPFGQPEPVTISEKAGVKFKPQIHITNGCHPYPAVNEAGETSGGLK-TKGA  163

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
                C     GSQ+Y RS W  DVWAIMY+WYFPK S ++   GLGHRH+WE V++WIDN
Sbjct  164  PSAGCKGSGWGSQVYGRSGWKNDVWAIMYSWYFPKDSPST---GLGHRHDWEHVIIWIDN  220

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P ++N  IL V+ SA  GYS   PP +  +DGTS KV+Y       N AL+ T + G+ Q
Sbjct  221  PDVENPRILAVTPSAHSGYSTYRPPNADTLDGTSAKVNYESHWPV-NHALDSTSEGGDFQ  279

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQ+ D AR ALN       W  G+A +P+ D  F  KL K+WPF
Sbjct  280  DLIMWDQMTDNARRALN----EVSW--GDANVPMNDGNFGPKLDKAWPF  322

>PPTG_13736
Length=236

 Score = 221 bits (564),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 151/227 (67%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            ++ HDQV+PF QP+ ++VS+KAAVKFKPQL   +GC+PYPAV A G TSGGL  +     
Sbjct  21   ALSHDQVRPFGQPSPVSVSEKAAVKFKPQLHITNGCHPYPAVNAAGETSGGLAKSGAPSA  80

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQ+Y RSTW++  WAIMY+WYFPK S ++   GLGHRH+WE V+VWIDNP 
Sbjct  81   G-CKGSGWGSQVYGRSTWHKGRWAIMYSWYFPKDSPST---GLGHRHDWEHVIVWIDNPD  136

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            + N  IL V+ SA  GYSK APPK+  + G + K++Y       N AL+ T+  GETQ L
Sbjct  137  VANPKILAVTPSAHSGYSKYAPPKAGTVSGNTAKINYESHWPV-NHALDSTDKGGETQPL  195

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMWDQ+ D AR +LNT       + G+A +P+ D  F +K+  + P+
Sbjct  196  IMWDQMTDAARRSLNTV------SFGDANVPMNDGNFLRKIGNASPW  236

>PHYKE_7564
Length=473

 Score = 228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 148/226 (65%), Gaps = 10/226 (4%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQVQPF Q  + +++  AA+K+KPQ+   +GC+PYPAV A+G TSGGL+    G  
Sbjct  256  TIDHDQVQPFPQSAATSLTNTAALKYKPQIFINNGCHPYPAVNANGDTSGGLKTHGSGSA  315

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQ+Y RSTWY  VWAIMY+WYFPK S  SG   +GHRH+WE V+VWIDNP 
Sbjct  316  G-CRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDSPVSG---MGHRHDWEHVIVWIDNPE  371

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
              N TIL ++ SA  GYS  APP +  +DG SVKV Y  + +  N  LE T  AGE QDL
Sbjct  372  NVNGTILAMTPSAHSGYSTYAPPPADMVDGASVKVEYTSTYLVINHHLEGTSTAGEMQDL  431

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            IMW  + D AR ALNT       + GNA +P+KD  F  KL+K++P
Sbjct  432  IMWGDMTDAARYALNTT------DFGNANVPMKDGNFLPKLEKAYP  471

 Score = 205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 128/195 (66%), Gaps = 4/195 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQPF Q  +I+++  AA+KFKPQ+   +GC+PYPAV A+G TSGGL+ T      
Sbjct  22   INHDQVQPFPQSTAISLTNTAALKFKPQIWINNGCHPYPAVNANGDTSGGLK-THGSSSA  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTWY  VWAIMY+WYFPK          GHRH+WE VVVWIDNP  
Sbjct  81   GCRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDEPQDF---TGHRHDWEHVVVWIDNPQN  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             N  IL ++ SA  GYS  APP +  IDGTSVKV Y  S +F +  LE T  AGE QDLI
Sbjct  138  VNPRILAMTPSAHSGYSTYAPPDADMIDGTSVKVEYTSSWLFIDHHLEGTSTAGEMQDLI  197

Query  207  MWDQLPDVARDALNT  221
            MW  + D AR++LNT
Sbjct  198  MWSDMTDAARNSLNT  212

>PHYKE_5753
Length=238

 Score = 221 bits (562),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 144/225 (64%), Gaps = 10/225 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQ  + +++   A+KFKPQ+   +GC+PYPAV  +G TSGGL+ +     G
Sbjct  22   ISHDQVIPFAQSAATSITNTVALKFKPQIFINNGCHPYPAVNGNGDTSGGLKPSGSESAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTWY +VWAIMY+WYFPK +  +G   +GHRH+WE VVVWIDNPA+
Sbjct  82   -CKGSGYGSQVYGRSTWYNNVWAIMYSWYFPKDNPVTG---MGHRHDWEHVVVWIDNPAM  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +N TIL V+ SA  GYS  APP    +DG S KV Y  S +  N  L+ T  AGE QDLI
Sbjct  138  ENPTILAVTPSAHSGYSTYAPPDPSTVDGASAKVQYTSSWIVINHHLDTTSTAGEFQDLI  197

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            MW  L D AR+ALNT       +   A +P+KD  F  KL  ++P
Sbjct  198  MWGDLTDAARNALNTA------DFEAANVPMKDGNFESKLGNAYP  236

>PYIR_13252
Length=236

 Score = 220 bits (561),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 143/225 (64%), Gaps = 11/225 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD V+PFA+PN  T + + A+KFKPQ+   +GC PYPAV + G+TSGGL+ +   Q 
Sbjct  21   SIAHDAVKPFAEPNPTTTTHRVALKFKPQINISNGCSPYPAVDSAGNTSGGLKPSG-SQS  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C     G+Q+Y R+  Y+D + IMY+WYFPK S  +G   LGHRH+WE VVVWIDNP 
Sbjct  80   AGCKGSGWGTQVYGRAAQYKDAYGIMYSWYFPKDSPLTG---LGHRHDWEHVVVWIDNPN  136

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
              N  IL VS SA  GYSK APPK+  +DGTS KV Y   +V  N AL+ T DAGE Q L
Sbjct  137  AANPKILAVSPSAHSGYSKYAPPKAGTVDGTSAKVDYTSKVVI-NHALDSTTDAGEQQPL  195

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            IMWDQL   AR AL         N G+A +P+KD  F  KL  ++
Sbjct  196  IMWDQLTAAARSALENT------NFGDANVPMKDGNFMNKLANAY  234

>PPTG_15231
Length=258

 Score = 221 bits (563),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 147/225 (65%), Gaps = 12/225 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PFAQP + T  QKA VKFKPQ+   +GC+PYPAV A+G+TSGGL+ T     G
Sbjct  43   ISHDAVVPFAQPTATTTEQKAGVKFKPQIHISNGCHPYPAVDANGNTSGGLKPTGSSSAG  102

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y R   Y  V+AIMY+WYFPK S  +G   LGHRH+WE VVVW+D+  L
Sbjct  103  -CKGSGYGSQVYGRVATYNGVYAIMYSWYFPKDSPVTG---LGHRHDWEHVVVWVDDIKL  158

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            D+ +I+ VS SA  GY+   PP+S  IDG S KV Y  S V  N AL+ T DAGETQDLI
Sbjct  159  DSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVINHALDSTTDAGETQDLI  218

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL NTD+       G+A +P+KD  F  K+  ++
Sbjct  219  MWDQLTDAARTALENTDF-------GDANVPMKDGNFLTKVGNAY  256

>PPTG_07089
Length=255

 Score = 221 bits (562),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 152/228 (67%), Gaps = 11/228 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
             +I H +V+PFA+P  +T+S+KA VKFKPQ+    GC PYPAV  DG TSGGL+ T    
Sbjct  37   KTISHKEVKPFAEPKPVTISEKAGVKFKPQIAVKTGCVPYPAVNEDGETSGGLQ-TSGSP  95

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
            +G C     GSQ+Y RSTW+  +WAIMY+WYFPK + +S    +GHRH+WE +VV+IDNP
Sbjct  96   QGGCRGSGHGSQVYGRSTWFNGLWAIMYSWYFPKDAPSS---RMGHRHDWEHIVVFIDNP  152

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
             +    ILG S S   GY+K AP  +  IDG+SVKV Y +S    N AL++T++AG+ QD
Sbjct  153  EVPEPKILGCSPSWHSGYNKYAPCPADVIDGSSVKVKYEHSWPL-NHALDITKEAGDFQD  211

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LIMWDQ+ D+AR ALN   DT     G A  P+ D  F  K++KSWPF
Sbjct  212  LIMWDQMSDLARRALN---DT---KFGKANTPMNDWNFLGKVEKSWPF  253

>PYU1_G011235
Length=238

 Score = 220 bits (561),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 146/226 (65%), Gaps = 13/226 (6%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQV PFA+P   + S+K AVKFKPQ+   +GC+PYPAV A G+TSGGL+ +   Q 
Sbjct  23   TINHDQVVPFAEPTPSSASEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSG-SQS  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C     G+Q+Y R   Y+D WAIMY+WYFPK S  +G   LGHRH+WE VVVWIDNP 
Sbjct  82   AGCKGSGWGTQVYGRVASYKDKWAIMYSWYFPKDSPITG---LGHRHDWEHVVVWIDNPK  138

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
              N  IL +S SA  GY K APPK+  +DGTS KV Y   IV  N AL+ T  AGE Q L
Sbjct  139  AANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVDYTSKIVI-NHALDSTTAAGEKQPL  197

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            IMW+Q+ D AR AL NTD+       G A +P+KD  F  KL K++
Sbjct  198  IMWEQMTDAARSALENTDF-------GKANVPMKDGNFMNKLAKAY  236

>PPTG_07660
Length=216

 Score = 219 bits (557),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 147/213 (69%), Gaps = 4/213 (2%)

Query  42   TVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPLGSQIYARS  101
            T S+K+A+K+KPQL    GC+PYPAVQA+GS SGGL+W+     GDC  P LGSQ+Y+RS
Sbjct  5    TDSEKSAIKYKPQLHISYGCHPYPAVQANGSISGGLKWSG-KTNGDCEQPNLGSQVYSRS  63

Query  102  TWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIG  161
             WY+  WAIMY WY PK ++       GHRH W + +VW D+P  DNSTILGVSMS S G
Sbjct  64   DWYKGKWAIMYAWYLPKAAQFMLKFDTGHRHFWLYSMVWTDSPNPDNSTILGVSMSGSRG  123

Query  162  YSKRAPPKSKYID-GTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALN  220
            Y K+  PK+KYI+ GT++K+  +     G  AL LT+ +GETQDL+ W+QL D ARDAL+
Sbjct  124  YVKKPSPKTKYIEKGTTIKLESYVGFWMGVQALRLTKKSGETQDLVTWEQLTDEARDALS  183

Query  221  T-DWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
              D+++   ++    MPLKDDVF   LK S+PF
Sbjct  184  EFDFESDP-SISMVVMPLKDDVFRSILKDSYPF  215

>PHYSO_406265
Length=232

 Score = 218 bits (556),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 143/227 (63%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HD+V PF QP  +T+S++AAVKFKPQL   +GC+ YPAV   G TSGGL+ T     
Sbjct  17   TIGHDEVVPFKQPEPVTISERAAVKFKPQLHISNGCHAYPAVNELGETSGGLKKTGA-PS  75

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C     GSQ+Y RSTWY  VWAIMY+WYFPK S +SG   LGHRH+WE V+VWIDNP 
Sbjct  76   SKCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSSG---LGHRHDWEHVIVWIDNPD  132

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            +    IL V+ SA  GYS + PP +  +DG SVKV+Y       N ALE T   G+ QDL
Sbjct  133  MPEPKILAVTPSAHSGYSAQVPPDADKVDGPSVKVNYESKWPI-NHALESTTKGGDYQDL  191

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMW Q+ D AR AL+        N G+A +P+    F  KL K+WPF
Sbjct  192  IMWTQMTDAARQALDNT------NFGSANVPMNSGNFLGKLGKAWPF  232

>PPTG_08017
Length=616

 Score = 229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 144/226 (64%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+V PF QP  +T+++KAA+KFKPQL   +GC+ YPAV   G TSGGL+ T     G
Sbjct  400  IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHITNGCHAYPAVNVGGQTSGGLKTTGAPSAG  459

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW+  VWAIMY+WYFPK S ++G   LGHRH+WE V+VWIDNP +
Sbjct  460  -CKGSGWGSQVYGRSTWHNGVWAIMYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPEI  515

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL V+ SA  GYS + PP +  +DG SVKV Y       N ALE T +AG+ QDLI
Sbjct  516  AEPKILAVTPSAHSGYSAQVPPDANKVDGNSVKVKYLSKWPI-NHALESTGEAGDYQDLI  574

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW+QL D AR AL           G A +P+KD  F  KL K+WPF
Sbjct  575  MWEQLTDAARLALQNT------GFGKANVPMKDGNFVSKLDKAWPF  614

>PHYCA_118551
Length=245

 Score = 218 bits (555),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 145/227 (64%), Gaps = 6/227 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V+PF QP   T S+KAAVK+KPQL    GC+PYPAVQADGS S GL+ T     G
Sbjct  24   IDHDTVKPFPQPKPKTDSEKAAVKYKPQLLVSYGCHPYPAVQADGSVSAGLKGTGPAA-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C    LGSQ+Y+RS WY+D WAIMY+WY PKG           RH WE  VVWID+P+L
Sbjct  83   ECGGSALGSQVYSRSDWYKDKWAIMYSWYLPKGRPAK----YQRRHLWETAVVWIDDPSL  138

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             NSTILGVS++    +   AP +S+++D + VK+  +    +    L  T   GETQDLI
Sbjct  139  ANSTILGVSLNYGWRHKTMAPIESEFLDDSRVKLESYRGFSYPRPKLRFTTHVGETQDLI  198

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             W+QL   AR+AL N ++D+ L      +MPLKD VF K+LK +WPF
Sbjct  199  TWEQLTVEAREALSNAEFDSGLIKTTRREMPLKDGVFEKRLKDAWPF  245

>PITG_22668
Length=519

 Score = 226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 142/226 (63%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PF Q   +T+S+KAAVKFKPQL    GC+PYPAV A G TSGGL+ +     G
Sbjct  304  IDHDAVVPFKQTEPVTISEKAAVKFKPQLHITGGCHPYPAVNAIGQTSGGLKTSGAPSAG  363

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTWY  VWAIMY+WYFPK S ++G   LGHRH+WE V+VWIDNP L
Sbjct  364  -CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPEL  419

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL VS SA  GYS + PP +  ++GTSVKV Y       N ALE T + G+ QDLI
Sbjct  420  AEPKILAVSPSAHGGYSAQVPPDANKVEGTSVKVKYLSKWPI-NHALESTGEGGDYQDLI  478

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW Q+ D AR+ L+          G A +P+ D  F  KL ++WPF
Sbjct  479  MWGQMTDAAREGLSRT------GFGKANVPMNDGNFESKLGRAWPF  518

>PPTG_08005
Length=759

 Score = 230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 146/226 (65%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PF QP  +T+S+KAA+KFKPQL   +GC+ YPAV A G TSGGL+ +     G
Sbjct  544  IDHDAVVPFKQPEPVTISEKAAIKFKPQLHITNGCHAYPAVNAIGETSGGLKTSGAPSAG  603

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTWY  VWAIMY+WYFPK S ++G   LGHRH+WE V+VWIDNP +
Sbjct  604  -CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPEI  659

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL V+ SA  GYS + PP +  +DGTSVKV Y       N ALE T + G+ QDLI
Sbjct  660  AEPKILAVTPSAHSGYSAQVPPDANKVDGTSVKVKYLSKWPI-NHALESTGEGGDYQDLI  718

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW Q+ D AR+AL      +  + G+A +P+ D  F  KL K+WPF
Sbjct  719  MWGQMTDAAREAL------SRTSFGDANVPMNDGNFEPKLGKAWPF  758

>PHYSO_510888
Length=255

 Score = 216 bits (551),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 147/227 (65%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HD+V+PF QP+ +T+S+KAAVKFKPQ+  + GC PYPAV   G TSGGL+ T    R
Sbjct  39   TIGHDEVKPFPQPDPVTISEKAAVKFKPQIDIVTGCVPYPAVNDAGETSGGLQ-TSGSPR  97

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQ+Y RSTW   VWAIMY+WYFPK + +S    +GHRH+WE VVV+IDNP 
Sbjct  98   GGCRGSGHGSQVYGRSTWINGVWAIMYSWYFPKDAPSS---KMGHRHDWEHVVVFIDNPD  154

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            +    ILG S S   GY+K AP  +  IDGTSVKV Y +S    N ALE T   G  QDL
Sbjct  155  VPEPKILGCSPSWHNGYNKYAPCPANVIDGTSVKVKYEHSWPL-NHALETTTKPGAFQDL  213

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMW+Q+ D AR ALN   DT     G A  P+ D  F  K++K+WPF
Sbjct  214  IMWNQMTDFARRALN---DT---KFGKANTPMNDWNFLPKVEKAWPF  254

>PPTG_19330
Length=316

 Score = 217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 143/229 (62%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HDQV+PF QP  +T+S+KAAVKFKPQL   +GC+ YPAV   G TSGGL+ T   
Sbjct  99   TITIDHDQVKPFPQPQPVTISEKAAVKFKPQLHITNGCHSYPAVDEAGQTSGGLK-TKGA  157

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
                C     GSQ+Y RS+WY+ VWAIMY WYFPK   ++   G+GHRH+WE V+VWIDN
Sbjct  158  PSAGCKGSGWGSQVYGRSSWYQGVWAIMYCWYFPKDEPST---GIGHRHDWEHVIVWIDN  214

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P + N  IL V+ SA  GY K APP    IDG + KV+Y       + AL  T +AG+ Q
Sbjct  215  PEIANPKILAVTPSAHSGYHKYAPPNPDTIDGATTKVAYESHWPM-DHALGSTSEAGDFQ  273

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMW QL + A  ALN       W  GNA  P+ D  F  KL K+WPF
Sbjct  274  DLIMWGQLSENASRALN----AVYW--GNANTPMNDGNFLPKLAKAWPF  316

>PHYSO_414520
Length=213

 Score = 213 bits (542),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 145/224 (65%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V+PF QP  +T+S+KAA+KFKPQ++   GC PYPAV   G TSGGL+ T    +G
Sbjct  1    INHDAVKPFPQPEPVTISEKAAIKFKPQIRIATGCVPYPAVNDVGETSGGLQ-TSGSPKG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y R+ W+ DVWAIMY+WYFPK S +S    +GHRH+WE VVVWI+NP +
Sbjct  60   GCRGSGHGSQVYGRAGWFNDVWAIMYSWYFPKDSPSS---RMGHRHDWEHVVVWINNPDV  116

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                ILG+S SA  GY K + P  + +DG SVKV+Y ++    N AL+ T+ AG  QDLI
Sbjct  117  PEPKILGISASAHSGYKKYSSPPPENLDGNSVKVNYEHAWPI-NHALDTTDKAGTFQDLI  175

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MW+Q+ + AR ALN        + G A  P+ D  F  KL+++W
Sbjct  176  MWEQMTEDARRALNAV------HFGKANTPMNDGNFRHKLERAW  213

>PPTG_07661
Length=223

 Score = 213 bits (543),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 144/219 (66%), Gaps = 9/219 (4%)

Query  42   TVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPLGSQIYARS  101
            T S+K+A+K+KPQL    GCYPYPAVQA+G+ SGGL+W+      DC  P  GSQIY+RS
Sbjct  5    TDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWAN-SDCEKPVQGSQIYSRS  63

Query  102  TWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIG  161
             WY+  WAIMY WYFPKG+  +     GHRH W   +VW DN   DNSTILGVSMS S G
Sbjct  64   DWYKGKWAIMYAWYFPKGAFRASKYNRGHRHFWSSAIVWTDNTNPDNSTILGVSMSGSKG  123

Query  162  YSKRAPPKSKYID-GTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALN  220
            Y K+  PK+KYI+ GT++K+  +      N AL LT+ +G TQDL+ W+QL D ARDAL+
Sbjct  124  YVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDEARDALS  183

Query  221  T---DWDTT----LWNLGNAQMPLKDDVFTKKLKKSWPF  252
                D DT+      +     MPL+D VFT  L++S+PF
Sbjct  184  KFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  222

>PHYCA_9358
Length=252

 Score = 214 bits (544),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 146/233 (63%), Gaps = 19/233 (8%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+V PF QP  +T+++KAA+KFKPQL   +GC+ YPAV   G TSGGL+ T     G
Sbjct  31   IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHISNGCHAYPAVNIGGQTSGGLKTTGAPSAG  90

Query  87   DCTDPPLGSQIYARSTWYR------DVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVW  140
             C     GSQ+Y RSTW+        +WAIMY+WYFPK S ++G   LGHRH+WE V+VW
Sbjct  91   -CKGSGWGSQVYGRSTWHNVPSPHNGIWAIMYSWYFPKDSPSTG---LGHRHDWEHVIVW  146

Query  141  IDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAG  200
            IDNP +    IL V+ SA  GYS + PP +  ++GTSVKV+Y       N AL  T   G
Sbjct  147  IDNPEIAEPKILAVTPSAHSGYSAQVPPDADKVEGTSVKVNYESKWPI-NHALGSTTKGG  205

Query  201  ETQDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            + QDLIMW+QL D AR AL NTD        G A +P+KD  F  KL K+WPF
Sbjct  206  DYQDLIMWEQLTDAARLALENTD-------FGKANVPMKDGNFVGKLNKAWPF  251

>PPTG_19506
Length=223

 Score = 212 bits (539),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 144/219 (66%), Gaps = 9/219 (4%)

Query  42   TVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPLGSQIYARS  101
            T S+K+A+K+KPQL    GCYPYPAVQA+G+ SGGL+W+      DC  P  GSQIY+RS
Sbjct  5    TDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWAN-SDCEKPVQGSQIYSRS  63

Query  102  TWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIG  161
             WY+  WAIMY WYFPKG+  +     GHRH W   +VW DN   DNSTILGVSMS S G
Sbjct  64   DWYKGKWAIMYAWYFPKGAFRASKYNRGHRHFWSSAIVWTDNTNPDNSTILGVSMSGSKG  123

Query  162  YSKRAPPKSKYID-GTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALN  220
            Y K+  PK+KYI+ GT++K+  +      N AL LT+ +G TQDL+ W+QL D ARDAL+
Sbjct  124  YVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDEARDALS  183

Query  221  T---DWDTT----LWNLGNAQMPLKDDVFTKKLKKSWPF  252
                D DT+      +     +PL+D VFT  L++S+PF
Sbjct  184  KFDFDADTSDAIFFSSGATVVIPLEDGVFTSILEESYPF  222

>PHYRA_54327
Length=219

 Score = 211 bits (538),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 139/225 (62%), Gaps = 11/225 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I H  V+PF QP  IT+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T    R
Sbjct  6    TISHKDVKPFPQPEPITISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQ-TSGSPR  64

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQ+Y RSTWY  VWAIMY+WYFPK S  S   G+GHRH+WE VVV+IDNP 
Sbjct  65   GGCRGSGHGSQVYGRSTWYNQVWAIMYSWYFPKDSPAS---GMGHRHDWEHVVVFIDNPD  121

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            L    ILG S+S+  GY K  P     IDGTSVKV Y +S    N  L+ T D G  QDL
Sbjct  122  LPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSVKVRYKHSWPL-NHDLDTTGDGGTFQDL  180

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            IMW+Q+ D AR ALN          G A  P+ D  F  K++KSW
Sbjct  181  IMWNQMTDNARRALNET------KFGKANTPMNDWNFHSKVEKSW  219

>PHYCA_119748
Length=261

 Score = 213 bits (541),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 144/226 (64%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV+PF QP  +T+S+KA VKFKPQ++   GC PYPAV   G T GGL+ T    RG
Sbjct  47   IGHDQVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETGGGLK-TTGKSRG  105

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C     GSQ+Y RSTWY+ VWAIMY+WYFPK S +     +GHRH+WE  +V+IDNP +
Sbjct  106  NCGGSGYGSQVYGRSTWYQGVWAIMYSWYFPKDSPSP---KMGHRHDWEHAIVFIDNPEV  162

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL  S+S+  GY+K  P     IDGTS+KV Y ++  + N  L+ T D G+ QDLI
Sbjct  163  SEPKILACSVSSHSGYTKYNPCPPWVIDGTSLKVRYKHAWPY-NHDLDATGDGGKFQDLI  221

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW+QL + AR ALN+       + G A  P  DD F  K++ +WPF
Sbjct  222  MWNQLTEDARRALNSV------SFGKANTPFSDDKFMPKIENAWPF  261

>PYIW_25259
Length=246

 Score = 212 bits (539),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 145/236 (61%), Gaps = 22/236 (9%)

Query  25   NSIPHDQVQPFAQPNSITVSQK---------AAVKFKPQLKTLDGCYPYPAVQADGSTSG  75
            +SI HD V PFAQP  +T+ Q          AA+KFKPQ+   +GC+PYPAV A G+T G
Sbjct  21   SSIAHDAVVPFAQPAPVTLEQTPAPTSLSHTAALKFKPQIHISNGCHPYPAVDAAGNTGG  80

Query  76   GLRWTVVGQRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWE  135
            GL+ +   Q   C     G+Q+Y RSTW+   WAIMY+WYFPK S  +G   LGHRH+WE
Sbjct  81   GLKPSG-SQSAGCKGSGWGTQVYGRSTWFNGKWAIMYSWYFPKDSPFTG---LGHRHDWE  136

Query  136  FVVVWIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALEL  195
             VVVWIDNPA  N  IL V+ SA  GY K APPKS  +DG S KV Y   IV  N AL+ 
Sbjct  137  HVVVWIDNPANANPAILAVTPSAHSGYKKYAPPKSGTVDGNSAKVEYKAIIVI-NHALDS  195

Query  196  TEDAGETQDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            T   GE Q LIMWDQL D AR  L NTD+       G+A +P+KD  F  K+  ++
Sbjct  196  TTTGGEQQPLIMWDQLTDAARSGLENTDF-------GSANVPMKDGNFMTKVANAY  244

>PYIR_13275
Length=237

 Score = 211 bits (536),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 140/225 (62%), Gaps = 13/225 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PF QP ++T  QK  VKFKPQ+   +GC+PYPAV A G+TSGGL  T     G
Sbjct  23   IAHDAVVPFVQPTAVTTEQKLGVKFKPQIHISNGCHPYPAVDAAGNTSGGLNPTGSSDAG  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     G+Q+Y R   Y  V+A+MY+WYFPK S  +G   LGHRH+WE VVVWIDNP  
Sbjct  83   -CKGSGYGTQVYGRGVAYNGVYALMYSWYFPKDSPFTG---LGHRHDWEHVVVWIDNPDA  138

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             +  IL +S SA  GY K APPK+  +DG S KV Y  SIV  N AL+ T  AGE Q LI
Sbjct  139  ASPVILAISPSAHSGYEKYAPPKTDTVDGNSAKVDY-KSIVVINHALDSTTTAGEQQPLI  197

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL   AR AL NTD+       G+A +P+KD  F  K+  ++
Sbjct  198  MWDQLTAAARTALENTDF-------GDANVPMKDGNFMTKIANAY  235

>PYU1_G011230
Length=238

 Score = 210 bits (535),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 139/225 (62%), Gaps = 11/225 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HDQV PFA+P   +  +K AVKFKPQ+   +GC+PYPAV A G+TSGGL+ +   Q 
Sbjct  23   SISHDQVVPFAEPTPSSAYEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSG-SQS  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C     G+Q+Y R   Y  V+ +MY+WYFPK S  +G   LGHRH+WE VVVWIDNP 
Sbjct  82   AGCKGSGWGTQVYGRGAAYNGVYGLMYSWYFPKDSPITG---LGHRHDWEHVVVWIDNPK  138

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
              N  IL +S SA  GY K APPK+  +DGTS KV Y   IV  N AL+ T  AGE Q L
Sbjct  139  AANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVDYTSKIVI-NHALDSTTAAGEKQPL  197

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            IMW+Q+   AR AL           G+A +P+KD  F  KL K++
Sbjct  198  IMWEQMTQAARTALENT------GFGDANVPMKDGNFMDKLAKAY  236

>PHYRA_46230
Length=212

 Score = 209 bits (531),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 142/223 (64%), Gaps = 11/223 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I H +V+PFAQP   T+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T    +G
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLK-TSGAXKG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RS W  DVWAIMY+WYFPK S +S   G+GHRH+WE VVV+IDNP +
Sbjct  60   GCRGSGHGSQVYGRSAWLNDVWAIMYSWYFPKDSPSS---GMGHRHDWEHVVVFIDNPDV  116

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                I+G S S+  GY K AP     IDGTSVKV Y +S    N  L++T DAG  QDLI
Sbjct  117  AEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQDLI  175

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
            MWDQ+ + AR ALN        + G+A  P+ D  F  KL+K+
Sbjct  176  MWDQMTEDARRALNG------VHFGDANTPMNDGNFIPKLEKA  212

>PPTG_12853
Length=342

 Score = 213 bits (541),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 144/229 (63%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HD+V+PF QP  +T+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T   
Sbjct  123  TKTIGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQ-TSGS  181

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
             RG C     GSQ+Y RSTW   VWAIMY+WYFPK S +S    +GHRH+WE  +V+IDN
Sbjct  182  PRGGCRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSS---RMGHRHDWEHAIVFIDN  238

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P +    IL  S+S+  GY K +P     IDGTS+KV Y ++    N  L+ T DAG  Q
Sbjct  239  PEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  297

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQ+ + AR ALN+       + G A  P  D  F  KL+K+WPF
Sbjct  298  DLIMWDQMSNDARRALNS------VHFGKANTPFNDGNFRPKLEKAWPF  340

>PPTG_12847
Length=331

 Score = 212 bits (540),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 144/229 (63%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HD+V+PF QP  +T+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T   
Sbjct  112  TKTIGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQ-TSGS  170

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
             RG C     GSQ+Y RSTW   VWAIMY+WYFPK S +S    +GHRH+WE  +V+IDN
Sbjct  171  PRGGCRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSS---RMGHRHDWEHAIVFIDN  227

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P +    IL  S+S+  GY K +P     IDGTS+KV Y ++    N  L+ T DAG  Q
Sbjct  228  PEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  286

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQ+ + AR ALN+       + G A  P  D  F  KL+K+WPF
Sbjct  287  DLIMWDQMSNDARRALNS------VHFGKANTPFNDGNFRPKLEKAWPF  329

>PHYSO_249751
Length=238

 Score = 209 bits (532),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 145/225 (64%), Gaps = 10/225 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PF Q  + + +  AA+KFK Q+   +GC+PYPAV A G TSGGL+ +     G
Sbjct  22   IGHDQVVPFPQSAATSAANIAALKFKLQIFINNGCHPYPAVNAAGDTSGGLKPSGSVNAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RST Y +  AIMY+WYFPK +  +G   LGHRH+WE V+VWIDNPA 
Sbjct  82   -CKGSGYGSQVYGRSTLYNNKHAIMYSWYFPKDNPVTG---LGHRHDWEHVIVWIDNPAS  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             N+TIL ++ SA  GYS  APP +  +DGTSVKV Y  S V  N  LE T  AGETQ+LI
Sbjct  138  SNATILAMTPSAHSGYSTYAPPPATMVDGTSVKVEYTSSKVVINHHLEGTSTAGETQNLI  197

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            MW+ + D AR ALNT       + G+A +P+KD  F  KL K++P
Sbjct  198  MWEDMTDAARYALNTT------DFGSANVPMKDGNFISKLGKAYP  236

>PPTG_22174
Length=771

 Score = 222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 148/229 (65%), Gaps = 4/229 (2%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ-  84
            +I HD+VQPF +    T S+K+A+K+KPQL   DGC+PYP VQADGS S GL+W+  G+ 
Sbjct  544  TIDHDEVQPFEEMEPTTDSEKSAIKYKPQLHISDGCHPYPVVQADGSVSAGLKWS--GRY  601

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
            R  C    LGSQ+Y+RS WY+  WAIMY WYFPKG+      G GHRH W   +VW D+P
Sbjct  602  RSGCKGSDLGSQVYSRSAWYKGKWAIMYAWYFPKGANPVSVFGSGHRHYWLHAIVWTDSP  661

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYI-DGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
              DNSTILG SM+ +    K +  KSKY+ +GTS+K+  F  +  G  AL LT+ +GETQ
Sbjct  662  NPDNSTILGASMAGTTNNEKTSTVKSKYLANGTSLKLDSFVGLWTGIQALRLTKKSGETQ  721

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLI W+QL D ARDAL+     +  +     MPL+D  F   LK S+PF
Sbjct  722  DLITWEQLTDEARDALSDFSFESSESREWVVMPLRDSAFKVLLKNSYPF  770

>PPTG_12852
Length=331

 Score = 211 bits (536),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 144/229 (63%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HD V+PF QP  +T+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T   
Sbjct  114  TKTIGHDDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETSGGLK-TSGK  172

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
             RG+C     GSQ+Y RSTW   VWAIMY+WYFPK S +    G+GHRH+WE+VVV+I+N
Sbjct  173  SRGNCGGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSP---GMGHRHDWEYVVVFINN  229

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P +    IL  S+++  GY K  P     IDGTS+KV Y ++    N  L+ T D G  Q
Sbjct  230  PEVQEPKILACSVASHGGYKKFNPCPPWVIDGTSLKVRYKHAWPM-NHDLDTTGDGGSFQ  288

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQ+ + AR ALN+       + G A  P  D  F KKL+ +WPF
Sbjct  289  DLIMWDQMTNDARRALNS------VSFGKANTPFIDGRFRKKLEDAWPF  331

>PHYCA_108409
Length=282

 Score = 209 bits (532),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 143/229 (62%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HD+V+PF +P  +TVS+KA VKFKPQ++   GC PYPAV   G TSGGL+ T   
Sbjct  65   TKTIGHDEVKPFPEPKPVTVSEKAGVKFKPQIQIRTGCVPYPAVDETGQTSGGLKPT-GN  123

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
             +G C     GSQ+Y R TW + VW IMY+WYFPK S ++   G+GHRH+WE  +V+IDN
Sbjct  124  SKGGCRGSGHGSQVYGRGTWIQGVWGIMYSWYFPKDSPST---GMGHRHDWEHAIVFIDN  180

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P +    IL  S+S+  GY K  P     IDGTS+KV Y +     N  L+ T DAG  Q
Sbjct  181  PDVPEPKILACSVSSHAGYKKYNPCPPWVIDGTSLKVRYKHGWPL-NHDLDTTGDAGTFQ  239

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQ+ + AR ALN+       + G+A  P  D  F  KL+K+WPF
Sbjct  240  DLIMWDQMTEDARRALNS------VHFGSANTPFNDGNFKPKLEKAWPF  282

>PHYSO_334487
Length=258

 Score = 208 bits (530),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 137/226 (61%), Gaps = 10/226 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PF Q    T+S KAA+KFKPQL   +GC+PYP V A G T GGL+ T      
Sbjct  22   IGHDQVVPFPQSQPTTISNKAALKFKPQLWINNGCHPYPVVNAAGDTGGGLK-THGSSAA  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTWY  VWAIMY WYFPK     G    GHRH+WE V+VWIDNP +
Sbjct  81   GCRCSGYGSQVYGRSTWYNGVWAIMYCWYFPKDEPQDG---TGHRHDWEHVIVWIDNPDV  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +N  I+ ++ SA  GYS  A P +  +DGTS KV Y  S +F +  LE T  AGE QDLI
Sbjct  138  ENPKIMAMTPSAHSGYSTYALPPADMVDGTSCKVEYTSSWLFIDHHLEGTSTAGEFQDLI  197

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW  L D AR ALNT       + G A  P+ D  F  K++K++P+
Sbjct  198  MWSDLTDGARLALNTT------SFGKANTPMNDGNFLPKIQKAYPW  237

>PHYRA_74617
Length=337

 Score = 211 bits (536),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 140/226 (62%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+V+PF QP  +T+S KA VKFKPQ++   GC PYPAV   G   GGL+ T    RG
Sbjct  123  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLK-TSGKSRG  181

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C     GSQ+Y RSTW+  VWAIMY+WYFPK S +    G+GHRH+WE  VV+IDNP +
Sbjct  182  NCAGSGHGSQVYGRSTWHNQVWAIMYSWYFPKDSPSP---GMGHRHDWEHAVVFIDNPDV  238

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                ILG S+S+  GY K  P     IDGTS+KV Y +S    N  L+ T D G  QDLI
Sbjct  239  PEPKILGCSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGIFQDLI  297

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW Q+ D AR ALN        N G+A  P+ D  F  K++KSWPF
Sbjct  298  MWGQMTDNARRALNEA------NFGSANTPMNDGNFYSKVEKSWPF  337

>PITG_16866
Length=238

 Score = 207 bits (527),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 146/226 (65%), Gaps = 13/226 (6%)

Query  27   IPHDQVQPFAQPNSITV-SQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            I HD V PFAQP + T   QKA +KFKPQ+   +GC+PYPAV ADG+TSGGL  T     
Sbjct  22   ISHDAVIPFAQPTTTTTTEQKAGIKFKPQIHISNGCHPYPAVDADGNTSGGLNPTGSSSA  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQIY R   Y  V+AIMY+WYFPK S  +G   LGHRH+WE VVVW+D+  
Sbjct  82   G-CKGSGYGSQIYGRVATYNGVFAIMYSWYFPKDSPLTG---LGHRHDWEHVVVWVDDIK  137

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            L++ +++ VS SA  GY+   PP+S  IDG S KV Y  S +  N AL+ T DAGETQ+L
Sbjct  138  LNSPSVIAVSPSAHSGYNIYHPPESNTIDGYSTKVDYSSSWLVINHALDSTTDAGETQNL  197

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            IMWDQL D AR AL NTD+       G+A +P+KD  F  K+  ++
Sbjct  198  IMWDQLTDAARTALENTDF-------GDANVPMKDGNFLTKVGNAY  236

>PYU1_G011233
Length=239

 Score = 207 bits (526),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 142/224 (63%), Gaps = 10/224 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV+PFA+P   T+++K A+KFKPQ+   +GC+PYPAV A G+  GGL+     Q  
Sbjct  24   IDHDQVKPFAEPAPTTLAEKLAIKFKPQIFINNGCHPYPAVDAAGNVGGGLK-PDGSQSA  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     G+Q+Y R+  Y DV+AIMY+WY PK +   G   +GHRH+WE VVVWIDNP  
Sbjct  83   GCKGSGWGTQVYGRAAPYNDVYAIMYSWYMPKDTPIPG---IGHRHDWENVVVWIDNPNA  139

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             N  IL VS SA  GY K APPK+  +DGTS KV Y  + +  + +L+ T  AGE Q LI
Sbjct  140  ANPKILAVSPSAHSGYEKYAPPKAGTVDGTSAKVIYSTTNLVMDHSLDSTTHAGEQQPLI  199

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MW+QL D AR  L  D+D      GNA +P+KD  F  KL KS+
Sbjct  200  MWEQLTDAARSTLQ-DYD-----FGNANVPMKDGNFMDKLGKSY  237

>PHYRA_72345
Length=240

 Score = 207 bits (526),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 135/226 (60%), Gaps = 10/226 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PF Q    +++  AA+ FKPQ+   +GC+PYP V A+G T GGL+ T     G
Sbjct  22   IGHDQVVPFPQSQPTSITNTAALLFKPQIWINNGCHPYPVVNANGDTGGGLKTTGSSAAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RS WY  VWAIMY+WYFPK          GHRH+WE VVVWIDNP  
Sbjct  82   -CRGSGYGSQVYGRSAWYNGVWAIMYSWYFPKDEPQDF---TGHRHDWEHVVVWIDNPQN  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             N  IL ++ SA  GYS  APP +  +DGTS KV Y  S +F +  LE T  AGETQDLI
Sbjct  138  TNPKILAMTPSAHSGYSTYAPPDADMVDGTSCKVEYTSSWLFIDHHLEGTSTAGETQDLI  197

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW  + D AR ALNT       N G A  P+ D  F  KL K++P+
Sbjct  198  MWGDMTDAARYALNTT------NFGKANTPMNDGNFLPKLGKAYPW  237

>PHYKE_8391
Length=778

 Score = 219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 1/140 (1%)

Query  111  MYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSKRAPPKS  170
            MY WYFPKG + +GG GLGHRHNWE+ +VWIDNPALDNSTILGVSMSAS GYSK +PPK+
Sbjct  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60

Query  171  KYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDAL-NTDWDTTLWN  229
            K++DG+SVK+ Y+YS++ GNTAL  TED GETQDLI WDQLP VA+DAL NTDWDTTLWN
Sbjct  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120

Query  230  LGNAQMPLKDDVFTKKLKKS  249
            + + +MPLKD  FTK L ++
Sbjct  121  MCDVKMPLKDGEFTKNLAET  140

>PITG_04200
Length=247

 Score = 206 bits (525),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 145/228 (64%), Gaps = 7/228 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+V+PFAQP   T S+KAAVK+KP+L    GC+PYPAVQA+G  S GL+ +     G
Sbjct  24   INHDEVKPFAQPTPTTDSEKAAVKYKPKLYVSYGCHPYPAVQANGFVSAGLKGSGPID-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C    LGSQ+Y+RS WY D WAIMY WY PKG  +        RH WE  VVWID+PAL
Sbjct  83   ECEGSSLGSQVYSRSMWYEDKWAIMYAWYLPKGRSSK----YQRRHFWEAAVVWIDDPAL  138

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             NSTILGVS++         P + +++DG++VK+  +         L+ T+  GETQDLI
Sbjct  139  ANSTILGVSLNYGRRQKSEVPLELQFLDGSNVKLESYRGFGRPRPRLQFTQLEGETQDLI  198

Query  207  MWDQLPDVARDAL-NTDWDTTL-WNLGNAQMPLKDDVFTKKLKKSWPF  252
             W+QL D ARD L + +++T L +     +MPLKD VF K+L  ++PF
Sbjct  199  TWEQLTDEARDGLSDAEFNTGLFFKRTRREMPLKDGVFEKRLIDAYPF  246

>PHYCA_69477
Length=213

 Score = 205 bits (521),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 141/224 (63%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+V+PFAQP  +T+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T    +G
Sbjct  1    IGHDEVKPFAQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQ-TSGNPKG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW + VWAIMY+WYFPK S +S    +GHRH+WE  +V+IDNP +
Sbjct  60   GCRGSGHGSQVYGRSTWMQGVWAIMYSWYFPKDSPSS---RMGHRHDWEHAIVFIDNPDV  116

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL  S+S+  GY K  P     IDGTS+KV Y +S    N  L+ T DAG  QDLI
Sbjct  117  PEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDAGTFQDLI  175

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQ+ + AR ALN+       + G A  P  D  F  KL+K+W
Sbjct  176  MWDQMTEDARRALNSV------SFGKAMTPFNDGSFKPKLEKAW  213

>HYAP_09243
Length=266

 Score = 206 bits (525),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 144/224 (64%), Gaps = 11/224 (5%)

Query  29   HDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDC  88
            HD + PF++P  +T+S+KA VKFKP L    GC PY AV A+G TSGGL+ +   + G C
Sbjct  47   HDAIVPFSEPKPVTISEKAGVKFKPLLDVNTGCAPYAAVNAEGETSGGLQTSGDPESG-C  105

Query  89   TDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDN  148
                 GSQ+Y RSTWY DVWAIMY WYFPK S     + +GHRH+WE VVV+I++P    
Sbjct  106  RGSKYGSQVYGRSTWYNDVWAIMYAWYFPKDSPM---LLMGHRHDWENVVVFINDPDEVE  162

Query  149  STILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMW  208
             TILG S S   GY K AP  +  I+G+SV + Y +S    N AL +T+DAG  QDLIMW
Sbjct  163  PTILGCSTSWHSGYIKYAPCPTDSINGSSVMIKYEHSFPL-NHALNITKDAGAYQDLIMW  221

Query  209  DQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             Q+PD+AR ALN   DT   + G A  P+ D  F +K++ +WPF
Sbjct  222  HQMPDLARRALN---DT---DFGKAITPMNDLNFMEKIEAAWPF  259

>PHYRA_72475
Length=243

 Score = 205 bits (521),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 147/230 (64%), Gaps = 12/230 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD+VQPFAQP  +TVS+KAAV+FKP L+   GC+PYPAV A G TSGGL+ T +   
Sbjct  23   SIDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDTGCHPYPAVNAAGETSGGLKGTGM-PS  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            GDC    LGSQ+YAR+ WY D+WAIMY WYFPK   T      G RH+W  VVVW+DNPA
Sbjct  82   GDCKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDQPT---FSKGKRHDWANVVVWLDNPA  138

Query  146  LDNSTILGVSMSASI-GYSKRAPPKSKYIDGTSVKVSYFYSI-VFGNTALELT-EDAGET  202
            L+  TI+GVS S+ +  YSK  PP +  + GT+  ++Y       G  +++ T +  GE 
Sbjct  139  LERPTIIGVSPSSYVTTYSKYTPPPADGLSGTTSMINYLADANNHGFHSVDTTWKTGGEF  198

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            QDLIMW+QL D AR A N   DT      +A +P  D  F   L+K+WP+
Sbjct  199  QDLIMWEQLTDEARGAFN---DTDFGE--HAPVPFIDPNFKANLEKAWPY  243

>PHYRA_72385
Length=237

 Score = 204 bits (520),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 144/225 (64%), Gaps = 12/225 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PF QP   T  Q A +KFKPQ+   +GC+PYPAV   G+TSGGL+ T     G
Sbjct  22   ISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYPAVDEAGNTSGGLKPTGSSSAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY R T Y  V+A+MY+WYFPK S  +G   LGHRH+WE VVVW+D+  L
Sbjct  82   -CKGSGYGSQIYGRITTYEGVYALMYSWYFPKDSPVTG---LGHRHDWEHVVVWVDDITL  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            D+ +I+ VS SA  GY+   PP+S  IDG S KV Y  S V  N AL+ T D+GE+QDLI
Sbjct  138  DSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVVNHALDSTSDSGESQDLI  197

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL NTD+       G+A +P+KD  F  KL  ++
Sbjct  198  MWDQLTDAARTALENTDF-------GDANVPMKDGNFLTKLGNAY  235

>PHYRA_52423
Length=193

 Score = 202 bits (515),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 129/195 (66%), Gaps = 5/195 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+VQPFA+P   T S+KAAVKFKPQL    GCYPYPAVQADGS S GLR +     G
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPAD-G  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C    LGSQ+Y+RS WY D WAIMYTWY PKG  T        RH WE  VVWID+PAL
Sbjct  60   ECRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRPTK----YQRRHFWETAVVWIDDPAL  115

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             NSTILGVS++      +  P   +++DG+SVK++ +    F    L+ T+  GE QDLI
Sbjct  116  ANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSYRGYGFPKPRLQFTQIDGEFQDLI  175

Query  207  MWDQLPDVARDALNT  221
             W+QL + ARDAL+T
Sbjct  176  TWEQLTEEARDALST  190

>PPTG_13769
Length=349

 Score = 207 bits (528),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 140/226 (62%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I H  V+PF QP  +T+S+KA VKFKPQ++   GC PYPAV   G TSGGL  T    RG
Sbjct  134  IAHKDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEFGETSGGLH-TSGKSRG  192

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RS W + VW IMY+WYFPK S +    GLGHRH+WE  +V+IDNP +
Sbjct  193  KCGGSGHGSQVYGRSAWLKGVWVIMYSWYFPKDSPSH---GLGHRHDWEEAIVFIDNPDV  249

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                ILG S+S+  GY++ AP     IDGTS+KV Y +S    N  L +T D G+ QDLI
Sbjct  250  SEPKILGCSVSSHGGYARHAPCPPWVIDGTSLKVRYKHSWP-KNHDLAITGDGGKFQDLI  308

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW Q+ + AR ALN        + G+A  P KD  F  K++K+WPF
Sbjct  309  MWGQMTNDARRALNA------VSFGSANTPFKDGTFQDKIEKAWPF  348

>PPTG_18464
Length=247

 Score = 204 bits (519),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 148/233 (64%), Gaps = 12/233 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLR---WTV  81
             +I HDQVQPF+QP   T S+K+AVK+KPQL    GC+PY AVQADGS SGGL    W  
Sbjct  22   RTINHDQVQPFSQPEPTTDSEKSAVKYKPQLHISYGCHPYAAVQADGSVSGGLNRSGWA-  80

Query  82   VGQRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWI  141
                GD     LGSQ+Y+RS WYR  WAI+Y WY+PKG   +     G RH W ++VVW 
Sbjct  81   ---NGDRKGSDLGSQVYSRSDWYRGKWAIVYAWYYPKGPVFTETGPPGQRHFWSYIVVWT  137

Query  142  DNPALDNSTILGVSMSASIGYSKRAPPKSKYI-DGTSVKV-SYFYSIVFGNTALELTEDA  199
            D+P  ++STI GV++   +GY  + PPK  +I +  +VKV SY  S    N A++LT+++
Sbjct  138  DSPKPNHSTIQGVTIPTEVGYEMQVPPKEDFIFEQATVKVESYLNS---ENQAVQLTDES  194

Query  200  GETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            GE QDLI W+QL D AR  L+       W   +  MPLKDDVF+  L++++PF
Sbjct  195  GEIQDLITWEQLTDQARATLSEFDFNIKWAYVDMVMPLKDDVFSTILEEAFPF  247

>PHYSO_527352
Length=245

 Score = 204 bits (519),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 138/225 (61%), Gaps = 5/225 (2%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG-QR  85
            I HDQVQPFAQP   T S+K+AVK+KPQL    GC+PYPAVQADGS +GGL+WT      
Sbjct  24   IGHDQVQPFAQPEPTTESEKSAVKYKPQLHISYGCHPYPAVQADGSVNGGLKWTFWSWAD  83

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
             DC    LGSQ+Y+RS W+R  WAI+Y WYFPKG +       GHRH W + ++W D+P 
Sbjct  84   SDCKGSGLGSQVYSRSDWHRGKWAIVYAWYFPKGRDFEHSFKRGHRHYWLYAILWTDSPN  143

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
             D STILGVS+         AP     IDG ++K   + S   G   L LTE  G+TQDL
Sbjct  144  PDTSTILGVSVPNGFRDKSAAPDAQFVIDGKTIKFDSYRSFTTGRQDLGLTEKTGDTQDL  203

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
            I W+QL + AR AL N ++D     +    +P+KD  F ++L ++
Sbjct  204  ITWEQLTEEARTALSNMNFDGPRQKI---VVPMKDGDFAERLARA  245

>PHYSO_254112
Length=224

 Score = 203 bits (516),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 135/224 (60%), Gaps = 24/224 (11%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQPFAQP   T S+ AAVKFKP L+   GC PYPAV A+GS S  L+WT     G
Sbjct  24   INHDQVQPFAQPEPATDSETAAVKFKPFLEVSYGCEPYPAVSANGSVSASLKWTGKND-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+Y+RS WY+D WA+MY WYFPKG +  G   + HRH W   VVWIDNPAL
Sbjct  83   DCEGSALGSQVYSRSDWYKDKWAMMYAWYFPKGWQ--GASTVSHRHLWLHAVVWIDNPAL  140

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            DNSTIL VS                    T VK+            L+LT D GE+QDLI
Sbjct  141  DNSTILAVS--------------------TPVKLDASRGFWASKMLLKLTTDKGESQDLI  180

Query  207  MWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
             WDQ+ + AR AL+  ++D  L+   N ++P KD VFT KLKK+
Sbjct  181  TWDQMTEEARTALSEANFDKHLFKRKNTKVPFKDGVFTDKLKKA  224

>PHYRA_71618
Length=243

 Score = 203 bits (517),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 148/230 (64%), Gaps = 12/230 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD+VQPFAQP+ +TVS+KAAV+FKP L+   GC+PYPAV A G TS GL+ T     
Sbjct  23   SIDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSS-  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            GDC    LGSQ+YAR+ WY D+WAIMY WYFPK   T      G RH+W  VVVW+DNPA
Sbjct  82   GDCKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDKPT---FRKGERHDWANVVVWLDNPA  138

Query  146  LDNSTILGVSMSASI-GYSKRAPPKSKYIDGTSVKVSYFYSI-VFGNTALELT-EDAGET  202
            L+  T++GVS S+ +  YSK  PP +  ++GT+  ++Y       G  +++ T +  GE 
Sbjct  139  LERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNHGFHSVDTTWKTGGEF  198

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            QDLIMW+QL D AR ALN   DT      +A +P  D  F   L+K+WP+
Sbjct  199  QDLIMWEQLTDEARAALN---DTDFGE--HALVPFIDANFKANLEKAWPY  243

>PPTG_15224
Length=246

 Score = 204 bits (518),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 143/227 (63%), Gaps = 6/227 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQPF +    T S+KAAVK+KP++    GC+PYPAVQADGS S GL+ T     G
Sbjct  24   INHDQVQPFDELKPTTDSEKAAVKYKPKVYVSYGCHPYPAVQADGSVSAGLKGTGPID-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C    LGSQ+Y+RS+WY+  WAIMY WY PKG           RH WE  VVWID+P+ 
Sbjct  83   ECGGSDLGSQVYSRSSWYKGKWAIMYAWYLPKGWAYRS----PRRHFWETAVVWIDDPSP  138

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             NS+ILGV++++ +   K  P + +Y+DG+SV++            L  T  +GE+QDLI
Sbjct  139  TNSSILGVTLNSGLRRKKYVPVERQYVDGSSVQLESCKGRGRPRPMLRFTTISGESQDLI  198

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW+QL D AR AL N ++DT  +      MPLKDD F K L+ +WPF
Sbjct  199  MWEQLTDKARYALANAEFDTGFFKKKRRNMPLKDDRFEKGLEDAWPF  245

>PYU1_G011236
Length=237

 Score = 202 bits (515),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 138/224 (62%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PF +P   T +QK  +KFKPQL   +GC+PYPAV A G+TSGGL+ T     G
Sbjct  23   IAHDAVVPFVEPTPTTTAQKLGIKFKPQLHISNGCHPYPAVDAAGNTSGGLKPTGSSDAG  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     G+Q+Y R+  Y  V+A+MY+WYFPK S ++    LGHRH+WE VVVWIDNP  
Sbjct  83   -CKGSGYGTQVYGRAAAYNGVYALMYSWYFPKDSPST---LLGHRHDWEHVVVWIDNPDA  138

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             +  IL VS SA  GY+K  PP +  + G S K+ Y  SIV  N A ++T  AGETQ LI
Sbjct  139  ASPKILAVSASAHSGYNKYHPPATTTLAGNSAKIDY-KSIVVLNHAFDMTTAAGETQPLI  197

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQ+   AR AL T       + G+A +P+KD  F  KL  ++
Sbjct  198  MWDQMTVAARTALETT------DFGDANVPMKDGNFMTKLANAY  235

>PHYRA_71310
Length=237

 Score = 202 bits (515),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 143/225 (64%), Gaps = 12/225 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PF QP   T  Q A +KFKPQ+   +GC+PYPAV   G+TSGGL+ T     G
Sbjct  22   ISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYPAVDEAGNTSGGLKPTGSSSAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY R T Y  V+A+MY+WYFPK S  +G   LGHRH+WE VVVW+D+  L
Sbjct  82   -CKGSGYGSQIYGRITTYEGVYALMYSWYFPKDSPVTG---LGHRHDWEHVVVWVDDITL  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            D+ +I+ VS SA  GY+   PP+S  IDG S KV Y  S V  N AL+ T D+GE+QDLI
Sbjct  138  DSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVVNHALDSTSDSGESQDLI  197

Query  207  MWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MW QL D AR AL NTD+       G+A +P+KD  F  KL  ++
Sbjct  198  MWGQLTDAARTALGNTDF-------GDAHVPMKDGNFLTKLGNAY  235

>PHYRA_83592
Length=237

 Score = 202 bits (514),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 141/230 (61%), Gaps = 12/230 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
             +SI HD+VQPF QP  +T+S+KA VKFKP+L   +GC  YPAV A G  SGGL+ T  G
Sbjct  19   ADSIDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGT--G  76

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
                C  P LGSQ+Y R+ WY DVWAIMY WYFPKG           RH+W  VVVWIDN
Sbjct  77   DDSGCKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDKCPY---WRHDWSNVVVWIDN  133

Query  144  PALDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            P ++ S +LG+S+S S   Y  +  P     +GT+  + Y Y   FG+  L    D G+ 
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPML-YRYLPSFGSAGLNTYVDLGQF  192

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            QDLIMWDQL D AR ALN D D    N G  ++P+ DD F + L+K+WPF
Sbjct  193  QDLIMWDQLTDAARAALN-DQD----NFGRTEVPISDDHFPEHLEKAWPF  237

>PHYCA_6835
Length=210

 Score = 201 bits (511),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 132/208 (63%), Gaps = 11/208 (5%)

Query  45   QKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPLGSQIYARSTWY  104
            +++AVKFKPQL   +GC+ YPAV   G T GGL+ T       C     GSQ+Y RS WY
Sbjct  13   RRSAVKFKPQLHITNGCHSYPAVDEAGETGGGLK-TKGAPSAGCKGSGWGSQVYGRSGWY  71

Query  105  RDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSK  164
            +DVWAIMY WYFPK   +SG   +GHRH+WE V+VWIDNPA++N  IL V+ SA  GY K
Sbjct  72   QDVWAIMYCWYFPKDEPSSG---IGHRHDWEHVIVWIDNPAVENPKILAVTPSAHSGYHK  128

Query  165  RAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWD  224
             APP +  IDG + KV+Y       + AL+ T +AG+ QDLIMWDQL + AR ALN+   
Sbjct  129  YAPPNADTIDGVTTKVAYDSKWPM-DHALDSTSEAGDFQDLIMWDQLSENARRALNSV--  185

Query  225  TTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
                N G A  P+ D  F  KL K+WPF
Sbjct  186  ----NFGKANTPMNDGNFQPKLAKAWPF  209

>PHALS_06162
Length=488

 Score = 209 bits (532),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 147/227 (65%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            ++ HD+V PF QP  +TV++ AAVKFKPQ+  ++GC+PYPAV A G  SGGL+ +     
Sbjct  266  TMRHDKVVPFKQPKPVTVAEHAAVKFKPQINIVNGCHPYPAVNATGEISGGLKASGSSDA  325

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     GSQ+Y RSTW+R +WAIMY+WYFPK  +T+  + LGHRH+WE ++VWIDNP+
Sbjct  326  G-CKGSEYGSQVYGRSTWHRGLWAIMYSWYFPK--DTAFPL-LGHRHDWEHIIVWIDNPS  381

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            L    IL V+ SA   Y+ ++PP +  ++GTSVKV Y   I   N AL  T  +GE QDL
Sbjct  382  LYKPRILAVASSAHSWYTVQSPPHTDRVNGTSVKVKY-AGIWPLNHALTSTTKSGEYQDL  440

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMW+QL + AR +L         N G A +P++D  F  KL  +W F
Sbjct  441  IMWEQLTEAARQSLQQA------NFGMANVPMRDGNFLDKLDTAWSF  481

>PHYCA_69480
Length=213

 Score = 201 bits (510),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 140/224 (63%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+V+PF QP  +T+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T    +G
Sbjct  1    IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQ-TSGNPKG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW + VWAIMY+WYFPK S +S    +GHRH+WE  +V+IDNP +
Sbjct  60   GCRGSGHGSQVYGRSTWIQGVWAIMYSWYFPKDSPSS---RMGHRHDWEHAIVFIDNPDV  116

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL  S+S+  GY K  P     IDGTS+K+ Y +S    N  L+ T D+G  QDLI
Sbjct  117  PEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKLRYKHSWPI-NHDLDTTGDSGTFQDLI  175

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQ+ + AR ALN+       + G A  P  D  F  KL+K+W
Sbjct  176  MWDQMTEDARRALNSV------SFGKANTPFNDGSFKPKLEKAW  213

>PITG_08522
Length=382

 Score = 206 bits (524),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/229 (49%), Positives = 140/229 (61%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HD V+ F QP  +T+S+KA VKFKPQ++   GC PYP V   G TSGGL+ T   
Sbjct  123  TKTIGHDDVKLFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPVVNELGETSGGLQ-TSGN  181

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
             RG C     GSQ+Y RSTW   VWAIMY+WYFPK   +S    +GHRH+WE  +V+IDN
Sbjct  182  SRGGCRGSGHGSQVYGRSTWMEGVWAIMYSWYFPKDFPSS---RMGHRHDWEHAIVFIDN  238

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P +    IL  S+S+  GY K  P  S  IDGTS+KV Y ++    N  L+ T DAG  Q
Sbjct  239  PEVAEPKILACSVSSHDGYKKYNPCPSYVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  297

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQ+ + AR ALN+       + G A  P  D  F  KL+K+WPF
Sbjct  298  DLIMWDQMSNDARRALNS------VHFGKANTPFNDGNFRPKLEKAWPF  340

>PHYCA_69479
Length=213

 Score = 201 bits (510),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 137/224 (61%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I H  ++PF QP  +T+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T    RG
Sbjct  1    ISHHDIKPFPQPVPVTISEKAGVKFKPQIQIRTGCVPYPAVNEFGETSGGLKPT-GNPRG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW R VWAIMY+WYFPK S +    GLGHRH+WE  +V+IDNP +
Sbjct  60   GCRGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDSPSP---GLGHRHDWEHAIVFIDNPDV  116

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL  S+S+  GY K  P     IDGTS+KV Y ++    N  L+ T D G  QDLI
Sbjct  117  PEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHAWPM-NHDLDTTGDGGSFQDLI  175

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MW+Q+ + AR ALN+       N G+A  P  D  F  KL+ +W
Sbjct  176  MWNQMTEDARRALNSV------NFGSANTPFNDGRFMPKLENAW  213

>PHYRA_74630
Length=343

 Score = 204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 136/226 (60%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+V+PF QP  +T+S KA VKFKPQ++   GC PYPAV   G   GGL+ T    RG
Sbjct  129  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKPT-GKSRG  187

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW+  VW IMY+WYFPK S +    GLGHRH+WE  VV+IDNP +
Sbjct  188  KCAGSGHGSQVYGRSTWHNSVWVIMYSWYFPKDSPSP---GLGHRHDWEHAVVFIDNPDV  244

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL  S+S+  GY K  P     IDGTS+KV Y +S    N  L+ T D G  QDLI
Sbjct  245  PEPKILACSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGTFQDLI  303

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            MW Q+ D AR ALN        N G+A  P+ D  F  K++ +WPF
Sbjct  304  MWGQMTDNARRALNEA------NFGSANTPMNDGNFPNKVQAAWPF  343

>PPTG_07277
Length=298

 Score = 202 bits (514),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 140/229 (61%), Gaps = 11/229 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HD+++PF QP+ +T+S+KA VKFKPQ++   GC PYP V   G TSGGL+ T   
Sbjct  81   TKTIGHDEIKPFPQPDPVTISEKAGVKFKPQIQIRTGCVPYPVVNEFGETSGGLQ-TSGS  139

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
             RG C     GSQ+Y RS W    WAIMY+WYFPK S +S    +GHRH+WEF VV+IDN
Sbjct  140  PRGGCRGSVHGSQVYGRSAWINGFWAIMYSWYFPKDSPSS---RMGHRHDWEFAVVFIDN  196

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            P +    I+G S+S+  G  K  P  S  IDG S+KV Y ++    N  L++T DAG  Q
Sbjct  197  PGIPEPKIIGCSVSSHDGRKKYNPCPSWVIDGNSLKVRYKHAWPM-NHDLDVTGDAGTFQ  255

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQ+ D AR ALN+       + G A  P  D  F   L+ +W F
Sbjct  256  DLIMWDQMTDDARRALNS------VSFGKANTPFNDGKFLPTLESAWAF  298

>PHYSO_336498
Length=238

 Score = 200 bits (509),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 140/230 (61%), Gaps = 17/230 (7%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+V+PF QP+ +T+S+KAAVKFKPQL   DGC  +PAV A G TSGGL+    G  G
Sbjct  22   IDHDKVEPFPQPDPVTISEKAAVKFKPQLLIEDGCVSFPAVNAAGETSGGLK----GNSG  77

Query  87   D--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
            +  C   PLGSQ+Y R+ WY+DVWAIMY WYFPKG     G+    R +W   VVWIDNP
Sbjct  78   NSACDSAPLGSQVYGRAMWYKDVWAIMYAWYFPKGFFV--GVA-SRRFDWSSAVVWIDNP  134

Query  145  ALDNSTILGVSMSAS-IGYSKRAP-PKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
                  ILG+S S S   Y  + P P    +DGT+  +    S   G   L  +   G++
Sbjct  135  DFAAPKILGISTSTSDDDYETKTPAPDYAILDGTTTLLFRSTSREAGQPKLYYSSRTGDS  194

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            Q LIMW+QLP+ AR ALNT       + G A +P+ DD F KKLKK+WPF
Sbjct  195  QPLIMWEQLPEAARLALNTT------DFGLAYVPINDDTFEKKLKKAWPF  238

>PHYRA_72390
Length=237

 Score = 200 bits (508),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 140/230 (61%), Gaps = 12/230 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
             +SI HD+VQPF QP  +T+S+KA VKFKP+L   +GC  YPAV A G  SGGL+ T  G
Sbjct  19   ADSIDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGT--G  76

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
                C  P LGSQ+Y R+ WY DVWAIMY WYFPKG           RH+W  VVVWIDN
Sbjct  77   DDSGCKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDKCPY---WRHDWSNVVVWIDN  133

Query  144  PALDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            P ++ S +LG+S+S S   Y  +  P     +GT+  + Y Y   FG+  L    D G+ 
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPML-YRYLPSFGSAGLNTYVDLGQF  192

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            Q LIMWDQL D AR ALN D D    N G  ++P+ DD F + L+K+WPF
Sbjct  193  QGLIMWDQLADAARAALN-DQD----NFGRTEVPISDDHFPEHLEKAWPF  237

>PHYRA_72477
Length=238

 Score = 200 bits (508),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 141/228 (62%), Gaps = 11/228 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            ++ HD+VQPF QP  +T+S+KA VKFKP L  + GC  YPAV A G TSGGL+ +  G  
Sbjct  21   TVDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGS-GGTT  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C  PPLGSQ+Y R+ WY DVWAIMY WYFPKG   +       RH+W   VVWIDNPA
Sbjct  80   SGCALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPF---WRHDWSNAVVWIDNPA  136

Query  146  LDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
            L+N   LG+S+S S   Y      +  + +G +  +S +   +   T L    D+GE QD
Sbjct  137  LENPKALGLSISRSENKYGSTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGEFQD  195

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LIMWDQL D AR ALN D D    N G  ++P+ DD F K+L+++WPF
Sbjct  196  LIMWDQLTDAARAALN-DQD----NFGRTEVPISDDHFPKRLEEAWPF  238

>PHYSO_329114
Length=236

 Score = 199 bits (507),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 136/219 (62%), Gaps = 5/219 (2%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HDQV+PFAQP   TVS+KAAVKF PQ+   +GC+PYPAV A G TSGGL+ T     
Sbjct  22   SINHDQVRPFAQPKPATVSEKAAVKFNPQIHITNGCHPYPAVNAAGETSGGLQ-TNGAPS  80

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C     GSQ+Y RSTWY+  WAIMY+WYFPK S ++    LGHRH+WE VVVWIDNPA
Sbjct  81   AGCKGSGWGSQVYGRSTWYKGRWAIMYSWYFPKDSPST---TLGHRHDWEHVVVWIDNPA  137

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            + N  IL V+ SA  GYSK APPK+  + G + KV+Y       N AL+ T+  G+ QDL
Sbjct  138  VANPKILAVTPSAHSGYSKYAPPKAGTVTGNTAKVNYESHWPV-NHALDSTDVGGDAQDL  196

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTK  244
            IMW+Q     R    T     L +      P+ D+  T+
Sbjct  197  IMWEQQHGKLRRRQCTHERWKLHDESRKGFPVVDEGRTR  235

>PHYRA_71588
Length=242

 Score = 200 bits (508),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 148/232 (64%), Gaps = 16/232 (7%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ-  84
            SI HD+VQPFAQP+ +T+S+K AV+FKP L+  +GC+ YPAV A G T+ GL+ T  G+ 
Sbjct  22   SIGHDKVQPFAQPDPVTISEKTAVRFKPILRIDNGCHSYPAVNAAGETNAGLKGT--GRP  79

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             GDC    LGSQ+Y RS W+ D+WAIMY WYFPK       +G G RH+W  VVVW+DNP
Sbjct  80   SGDCKGSSLGSQVYGRSVWHGDLWAIMYAWYFPKDMPI---LGKGKRHDWANVVVWLDNP  136

Query  145  ALDNSTILGVSMSASI-GYSKRAPPKSKYIDGTSVKVSYFY-SIVFGNTALELT-EDAGE  201
            A +  TI+GVS SA +  Y+K  PP +  + G +  +SY    + +G   L++  E  GE
Sbjct  137  AHERPTIIGVSPSAYVTTYAKYTPPPANRLTGLTSMISYLADDLNYGYHTLDMNWEAGGE  196

Query  202  TQDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             QDL+MW+QL D AR ALN TD+        NA +P  D  F   L+K+WP+
Sbjct  197  FQDLVMWEQLTDEARAALNDTDFGE------NALVPFIDANFKANLEKAWPY  242

>PHYRA_76657
Length=239

 Score = 196 bits (499),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 143/232 (62%), Gaps = 18/232 (8%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLK--TLDGCYPYPAVQADGSTSGGLRWTVVG  83
            SI HD+VQPF QP+ +T+++K+ VKFKP+LK  T  GC  YPAV + G TSGGL+    G
Sbjct  21   SIDHDKVQPFPQPDPVTITEKSGVKFKPELKIDTEHGCVSYPAVNSAGETSGGLK----G  76

Query  84   QRGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWI  141
             +G   CT P LGSQ+Y R+ WY DVWAIMY WYFPKG           RH+W   VVWI
Sbjct  77   TKGTSACTGPILGSQVYGRAEWYNDVWAIMYAWYFPKGFWNRRAY---WRHDWSNAVVWI  133

Query  142  DNPALDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAG  200
            D+PAL+N  +LG+S+S S   Y  +  P     +GT+  + Y     +   AL L   +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAALALYYASG  192

Query  201  ETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            + QDLIMW QL D AR ALN D D    N G  ++P+ DD F K L+K+WPF
Sbjct  193  DVQDLIMWGQLTDAARAALN-DQD----NFGRTEVPINDDHFLKHLEKAWPF  239

>PHYCA_69457
Length=213

 Score = 195 bits (496),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 139/224 (62%), Gaps = 11/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV+PF QP  +T+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T    RG
Sbjct  1    INHDQVKPFPQPEPVTISEKAGVKFKPQIQVRTGCEPYPAVNEFGETSGGLKPT-GNPRG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTW R VWAIMY+WYFPK S +    GLGHRH+WE  +V+IDNP +
Sbjct  60   GCGGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDSPSP---GLGHRHDWEHAIVFIDNPDV  116

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                IL  S+S+  GY K  P     IDGTS+KV Y +S    N  L+ T D G  QDLI
Sbjct  117  PEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHSWP-TNHDLDTTGDGGSFQDLI  175

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MW+Q+ + AR ALN+       N G+A  P  D  F  KL+ +W
Sbjct  176  MWNQMTEDARRALNSV------NFGSANTPFNDGKFMPKLENAW  213

>PHYRA_72165
Length=240

 Score = 196 bits (499),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 142/232 (61%), Gaps = 20/232 (9%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD+VQPFAQP  +TVS+KAAV+FKP L+   GC+PYPAV A G T+ GL+ T     
Sbjct  22   SIDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGT-GPSS  80

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            GDC    LGSQ+YAR+ WY D+WAIMY WYFPK   T    G G RH+W  VVVW+DNPA
Sbjct  81   GDCKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDKPT---FGEGGRHDWANVVVWLDNPA  137

Query  146  LDNSTILGVSMSASI-GYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTED----AG  200
            ++  TI+GVS S+ +  Y K  PP +  + GT+  ++Y    +  N      +      G
Sbjct  138  VERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLADDM--NNGFHTVDTTWLPGG  195

Query  201  ETQDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            E QDLIMW+QL D AR AL +TD+         A +P  D  F   L+K+WP
Sbjct  196  EFQDLIMWEQLTDEARAALSDTDF--------GALVPFIDANFKANLEKAWP  239

>PHYRA_41766
Length=209

 Score = 195 bits (496),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 138/223 (62%), Gaps = 14/223 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I H +V+PFAQP   T+S+KA VKFKPQ++   GC PYPAV   G TSGGL+ T    +G
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLK-TSGAXKG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RS W  DVW    +WYFPK S +S   G+GHRH+WE VVV+IDNP +
Sbjct  60   GCRGSGHGSQVYGRSAWLNDVWX---SWYFPKDSPSS---GMGHRHDWEHVVVFIDNPDV  113

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                I+G S S+  GY K AP     IDGTSVKV Y +S    N  L++T DAG  QDLI
Sbjct  114  AEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQDLI  172

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
            MWDQ+ + AR ALN        + G+A  P+ D  F  KL+K+
Sbjct  173  MWDQMTEDARRALNG------VHFGDANTPMNDGNFIPKLEKA  209

>PHYKE_7568
Length=372

 Score = 200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 135/224 (60%), Gaps = 10/224 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PF+QP   T  Q+ A+KFKPQ+   +GC+PYPAV  DG+TSGGL  T     G
Sbjct  157  ISHDQVVPFSQPTPTTTIQEVAIKFKPQIYINNGCHPYPAVDEDGNTSGGLAPTGSESAG  216

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY R+  Y  V+A MY+WY PK     G   LGHRH+WE  VVW+D+  L
Sbjct  217  -CKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDETLPG---LGHRHDWEACVVWLDDITL  272

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            D   I+ +S SA  GY+   PP S Y+DG S K+ Y  S +  + +L  T  AGETQDLI
Sbjct  273  DEPNIVALSASAHSGYNVYYPPSSSYLDGDSAKIEYSSSYIVIDHSLSATSTAGETQDLI  332

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL    DT   + G+A +P K+  F  KL  ++
Sbjct  333  MWDQLTDAARAALE---DT---DFGSANVPFKEANFQTKLGNAY  370

 Score = 136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 10/139 (7%)

Query  111  MYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSKRAPPKS  170
            MY+WYFPK S  +G    GHRH+WE +VVW++NPA+ +  IL VS SA  GY+   PP S
Sbjct  1    MYSWYFPKDSPLTG---FGHRHDWEHIVVWLNNPAITSPEILAVSTSAHSGYTVYYPPDS  57

Query  171  KYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNL  230
             Y+DG S K+ Y YS++  N A  +T DAGETQDLIMWDQL D A+ AL    DT   + 
Sbjct  58   DYLDGNSAKIDY-YSVLLINHAFRMTSDAGETQDLIMWDQLTDAAQTALE---DT---DF  110

Query  231  GNAQMPLKDDVFTKKLKKS  249
            G+A +P KD  F  KL  +
Sbjct  111  GDANVPFKDANFETKLANA  129

>PHYRA_86968
Length=239

 Score = 196 bits (497),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 135/229 (59%), Gaps = 12/229 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            ++ HD+VQPF QP  +T+S+KA VKFKPQL    GC+PYPAV A G TSGGL+    G  
Sbjct  21   TVDHDKVQPFPQPAPVTISEKAGVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGN--GDE  78

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
             DC    LGSQ+Y R+ WY  VWAIMY WYFPKG   +       RH+W   VVWIDNPA
Sbjct  79   LDCILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVPY---WRHDWSNAVVWIDNPA  135

Query  146  LDNSTILGVSMSASIGY--SKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            L+N  ILG+S+S S     +   P  ++ I+  +    Y Y        L L+   G  Q
Sbjct  136  LENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRGPVQ  195

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMW QL D AR ALN D D    N G   +P+ DD F K L+++WPF
Sbjct  196  DLIMWGQLTDAARAALN-DQD----NFGRTDVPISDDHFPKLLEEAWPF  239

>PHYRA_84273
Length=237

 Score = 194 bits (494),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 140/228 (61%), Gaps = 12/228 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            ++ HD+VQPF QP  +T+S+KA VKFKPQL    GC  YPAV A G TSGGL+ +  G  
Sbjct  21   TVDHDKVQPFPQPAPVTISEKAGVKFKPQLHITTGCTSYPAVNAAGETSGGLKGS--GGT  78

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C  PPLGSQ+Y R+ W+ DV+AIMY WYFPKG   +       RH+W   VVWIDNPA
Sbjct  79   SGCMLPPLGSQVYGRAGWHNDVYAIMYAWYFPKGFWDASPF---WRHDWSNAVVWIDNPA  135

Query  146  LDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
                 ILG+S+S S   Y K    +  + +G +  +S +   +   T L    D+GE QD
Sbjct  136  HKTPKILGLSLSTSENKYGKTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGEFQD  194

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LIMWDQL D AR ALN D D    N G  ++P+ DD F K+L+++WPF
Sbjct  195  LIMWDQLTDAARAALN-DQD----NFGRTEVPISDDHFPKRLEEAWPF  237

>PHYRA_49009
Length=216

 Score = 194 bits (492),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 144/228 (63%), Gaps = 16/228 (7%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+VQPFAQP  +TVS+KAAV+FKP L+   GC+PYPAV A G T+ GL+ T +   G
Sbjct  1    IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGM-PSG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+YAR+ W+ D+WAIMY WYFPK        G G RH+W  VVVW+DNPA+
Sbjct  60   DCKGSGLGSQVYARAVWHSDLWAIMYAWYFPKDKAI---FGKGERHDWANVVVWLDNPAV  116

Query  147  DNSTILGVSMSASI-GYSKRAPPKSKYIDGTSVKVSYFYS-IVFGNTALELT-EDAGETQ  203
            +  TI+GVS S+ +  Y K  PP +  + GT+  ++Y  + +  G   ++ T +  GE Q
Sbjct  117  ERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLANDMNNGFHTVDTTWKTGGEFQ  176

Query  204  DLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            DLIMW+QL D AR AL NTD+         A +P  D  F   L+K+W
Sbjct  177  DLIMWEQLTDEARAALSNTDF--------GALVPFIDANFKANLEKAW  216

>PPTG_06973
Length=165

 Score = 192 bits (487),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 2/162 (1%)

Query  93   LGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIG-LGHRHNWEFVVVWIDNPALDNSTI  151
            L SQ+YAR+TW +D WAIMY W+FPK       +  LGHRH WE+ +VW+D P  DNSTI
Sbjct  4    LDSQVYARTTWVKDKWAIMYAWFFPKARAPFPVLRFLGHRHGWEYAIVWLDKPNADNSTI  63

Query  152  LGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQL  211
            LGVS+SA+ G++K APP  KY+DG S+KV+Y+Y+ ++GNTA++ T++ GE QDLI W+QL
Sbjct  64   LGVSVSAAAGWAKEAPPPEKYLDGNSLKVAYYYNHIYGNTAVKYTDETGEFQDLITWNQL  123

Query  212  PDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             D+AR  L NTDWD T  N    +MP+KD VF KKLK ++PF
Sbjct  124  SDLARSYLNNTDWDETPLNAALLKMPMKDGVFMKKLKSAYPF  165

>PHYCA_576423
Length=234

 Score = 193 bits (490),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 135/224 (60%), Gaps = 12/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP   T  Q  A++FKPQ+   +GC+PYPAV ADG+TSGGL+ T   Q  
Sbjct  21   IDHDQVIPFAQPMPNTTLQSVAIQFKPQIYINNGCHPYPAVDADGNTSGGLKPT-GSQSA  79

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY R+  Y  V+A MY+WY PK        G GHRH+WE  VVW+D  +L
Sbjct  80   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDETLD---GQGHRHDWENCVVWLD--SL  134

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            D  +I+ +S S    Y+   PP S Y+DG S K+ Y  S +  + +L  T  AGE QDLI
Sbjct  135  DRPSIVALSASYHSTYNYYYPPSSSYLDGNSAKIQYSTSWIVLDHSLSATSTAGEIQDLI  194

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL    DT   + G+A +P K+D F  KL K++
Sbjct  195  MWDQLTDAARTALE---DT---DFGSANVPFKEDNFIAKLAKAY  232

>PHYCA_118356
Length=252

 Score = 193 bits (491),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 140/226 (62%), Gaps = 7/226 (3%)

Query  29   HDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDC  88
            HD+V+PFAQP      ++AAVK+KP+L    GC+PYPAVQA+GS S GL  +     G+C
Sbjct  26   HDKVKPFAQPIPTNSFEEAAVKYKPELFVSYGCHPYPAVQANGSVSAGLEGSGPDD-GEC  84

Query  89   TDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDN  148
                LGSQ+Y+RS WY D WAIMYTWY PKG        L  RH WE  V+WID+P L++
Sbjct  85   KGSRLGSQVYSRSDWYNDKWAIMYTWYLPKGRSGK----LQDRHFWETAVIWIDDPTLED  140

Query  149  STILGVSMSASIGYSKRAPPKSKYIDGTSV-KVSYFYSIVFGNTALELTEDAGETQDLIM  207
            S +LGVS++       +   K ++++ + V K   + +       L  TE AG+TQDLI 
Sbjct  141  SKLLGVSLNYEDRRVSKIAIKGRHLNASKVLKFESYEAEKSPKPRLRFTEKAGKTQDLIT  200

Query  208  WDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            WDQLP  AR  L+ T + ++ +     +MPLKD+VF K+LK +WPF
Sbjct  201  WDQLPAKARKGLSTTKFYSSPFGSVKREMPLKDEVFLKRLKDAWPF  246

>PHYSO_334498
Length=229

 Score = 192 bits (488),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 129/213 (61%), Gaps = 11/213 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP  +T+S+KAAVKFKPQL   +GC+PYPAV   G T GGL  T     G
Sbjct  25   ISHDQVAPFAQPEPVTISEKAAVKFKPQLHISNGCHPYPAVNEAGDTDGGLSNTGA-PSG  83

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C    LGSQ+Y RS W++DVW IMY WYFPK   +     LGHRH+WE  V+WIDNP +
Sbjct  84   KCKGSGLGSQVYGRSGWHKDVWTIMYAWYFPKDMAS---FDLGHRHDWEHAVIWIDNPDV  140

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
                ILGVS S+  GY K     +  ++GTSV ++Y  +    +  L  T   GE Q LI
Sbjct  141  AEPKILGVSASSHAGYEKVTTIPAGSLNGTSVLLNYESTWPV-DHELRFTTKGGEYQPLI  199

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKD  239
            MW QL D AR +L+T       + G+A MP+ D
Sbjct  200  MWTQLTDAARVSLSTT------DFGSALMPMTD  226

>PITG_22916
Length=248

 Score = 193 bits (490),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 136/229 (59%), Gaps = 3/229 (1%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
             +I HDQV+PFAQPN+ T  +KAAVK+KPQL   DGC+PYPAV+ DG+ S GL W+    
Sbjct  21   ETIDHDQVRPFAQPNAATTKEKAAVKYKPQLYIEDGCHPYPAVEEDGTISAGLEWSG-DH  79

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             G C   P GSQ+Y+R   Y+D +AIMY WYFPKG   S      HRH+WEF ++W D  
Sbjct  80   NGHCKKSPRGSQVYSRGGSYKDKYAIMYAWYFPKGKGHSRKHHDEHRHDWEFGIIWFDRD  139

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
            +  +S+I GV+ +         P +  ++ G+ +K+  + +       L LT+  G+ QD
Sbjct  140  SDTDSSIAGVTTNIGRDLHDEVPLQPVHVVGSHIKLESYSTFWSAKQGLRLTKKKGDIQD  199

Query  205  LIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LI W+QLP  A+ ALN  D+DT         +P  D+ F +K+  S+PF
Sbjct  200  LIQWEQLPKAAQTALNDADFDTDKAKT-PVVVPFNDNYFQEKVAASYPF  247

>PHALS_06084
Length=260

 Score = 193 bits (491),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 139/227 (61%), Gaps = 11/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +IP+DQV+ F QP   T+SQ+ A+ FKPQL  + GC PYPAV   G TSGGL        
Sbjct  44   TIPYDQVRGFRQPKPTTISQQVALTFKPQLDIVTGCLPYPAVNRLGETSGGLP-KDADTE  102

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C      SQ+Y RSTW+ DVW +M++WYFPK S       LGHRH+WE VV++ID+P 
Sbjct  103  TKCHGSQFNSQVYGRSTWFNDVWVMMFSWYFPKDSPFP---LLGHRHDWENVVIFIDSPK  159

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            +    ILG SMS    Y K AP  +   +GTSVKV Y  S    N AL +TE  G  QDL
Sbjct  160  VPLPKILGCSMSYHSEYIKFAPCPTFATNGTSVKVKYEDSFPL-NHALNVTEKEGTFQDL  218

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMW+QLP + R +LN   DT   + G+A +P+ D  F KK++++WPF
Sbjct  219  IMWNQLPPIVRKSLN---DT---DFGSANVPMNDWNFLKKVEEAWPF  259

>PHYSO_490000
Length=241

 Score = 192 bits (487),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 137/227 (60%), Gaps = 12/227 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PF Q    T++ KAA+K KP+L   +GC+ +PAV A+G TSGGL+       G
Sbjct  23   IDHDQVVPFPQSQPTTITNKAALKLKPRLFINNGCHLHPAVNANGDTSGGLK-PKGSPEG  81

Query  87   DCTDPPLGSQIY--ARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             C     GSQ+Y   RSTWY  VWAIMY WYFPK   T      GHRH+WE V+V I+NP
Sbjct  82   GCRGSGSGSQVYRYGRSTWYNGVWAIMYAWYFPKDEPTDFD---GHRHDWEHVIVRINNP  138

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
             L+N TIL ++ SA  GYS  APP +  + GTS KV Y  S +F +  LE T  AGETQD
Sbjct  139  VLENPTILAMTPSAHSGYSTYAPPPADMVSGTSCKVEYTSSWIFIDHHLEGTSTAGETQD  198

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            LIMW  L D AR AL+T       N G A  P+ +  F  KL K+WP
Sbjct  199  LIMWSDLTDAARYALSTT------NFGKADTPMNNGTFNWKLSKAWP  239

>PHYRA_72403
Length=239

 Score = 191 bits (485),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 141/232 (61%), Gaps = 18/232 (8%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLK--TLDGCYPYPAVQADGSTSGGLRWTVVG  83
            SI HD+VQPF QP+ +T+++K+ VKFKP+L   T  GC  YPAV + G TSGGL+    G
Sbjct  21   SIDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLK----G  76

Query  84   QRGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWI  141
             +G   CT P LGSQ+Y R+ W+ DVWAIMY WYFPKG   S       RH+W   VVWI
Sbjct  77   TKGTSACTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGFWDSRAYW---RHDWSNAVVWI  133

Query  142  DNPALDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAG  200
            D+PAL+N  +LG+S+S S   Y  +  P     +GT+  + Y     +    L     +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYECAELVPYYASG  192

Query  201  ETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            E QDLIMWDQL D AR ALN D D    N G  ++P+ DD F K L+K+WP 
Sbjct  193  EVQDLIMWDQLTDAARAALN-DQD----NFGRTEVPINDDHFLKHLEKAWPL  239

>PHYRA_39489
Length=237

 Score = 190 bits (483),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 133/227 (59%), Gaps = 12/227 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            ++ HD+VQPF QP  +T+S+KA VKFKPQL    GC+PYPAV A G TSGGL+    G  
Sbjct  21   TVDHDKVQPFPQPAPVTISEKAXVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGN--GDE  78

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
             DC    LGSQ+Y R+ WY  VWAIMY WYFPKG   +       RH+W   VVWIDNPA
Sbjct  79   LDCILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVPY---WRHDWSNAVVWIDNPA  135

Query  146  LDNSTILGVSMSASIGY--SKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            L+N  ILG+S+S S     +   P  ++ I+  +    Y Y        L L+   G  Q
Sbjct  136  LENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRGPVQ  195

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            DLIMW QL D AR ALN D D    N G   +P+ DD F K L+++W
Sbjct  196  DLIMWGQLTDAARAALN-DQD----NFGRTDVPISDDHFPKLLEEAW  237

>PPTG_15234
Length=235

 Score = 190 bits (482),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 133/224 (59%), Gaps = 12/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP   T  Q  AV+FKPQ+   +GC+PYPAV  DG+TSGGL+ T     G
Sbjct  22   IDHDQVVPFAQPTPNTTVQSVAVQFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSESAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY R+  Y  V+A MY+WY PK        GLGHRH+WE  VVW+D  +L
Sbjct  82   -CKGSGYGSQIYGRAVEYDGVYAFMYSWYMPKDETLD---GLGHRHDWENCVVWLD--SL  135

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            DN +I+ +S S    Y    PP S Y+DG S K+ Y  S V  + +L  T   GETQDLI
Sbjct  136  DNPSIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVILDHSLSATSTVGETQDLI  195

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL    DT   + G+A +P K+  F  K+  ++
Sbjct  196  MWDQLTDAARTALE---DT---DFGDANVPFKETNFATKVANAY  233

>PPTG_13026
Length=238

 Score = 190 bits (482),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 140/228 (61%), Gaps = 11/228 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            S+  ++V P AQP+  T +QKAA+KFKP+L   +GC  +PAV + G TS GL+    G  
Sbjct  21   SVDFNKVVPIAQPSPSTSAQKAAIKFKPRLSITNGCVSFPAVNSAGETSSGLQEGYRGSS  80

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G CT+ PLGSQ+Y R+TWY   +AI+YTWYFPKG           RH+W   VVWIDNP 
Sbjct  81   G-CTNAPLGSQVYGRTTWYNGTFAILYTWYFPKGFWNEYAT---RRHDWASAVVWIDNPE  136

Query  146  LDNSTILGVSMS-ASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
            L + +ILG+S+S A   +   AP  S   DGT+ ++++  ++  G   L  T+  G+ Q+
Sbjct  137  LASPSILGLSVSTADWKFKTFAPASSGITDGTTPRLAHVLNVEKGYPYLTTTDTVGDFQE  196

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LIMWDQL   AR ALNT       + G A++P+ D  F  KLKK+WPF
Sbjct  197  LIMWDQLTTAARTALNTT------DFGVAKVPVSDAAFDTKLKKAWPF  238

>PYVX_22469
Length=474

 Score = 197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 140/226 (62%), Gaps = 11/226 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V  FAQP+  T S++ A+ +KPQL   +GC+PYPAV ADG+TSGGL+ T   Q  
Sbjct  22   INHDAVAAFAQPSPTTTSEEIAITYKPQLYIANGCHPYPAVDADGNTSGGLKPT-GAQDS  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LG+QIY R+T Y  V+AIMY+WY PK S  S   GLGHRH WE VVVW+D+   
Sbjct  81   DCKGSALGTQIYGRATEYNGVYAIMYSWYMPKDSPLS---GLGHRHEWENVVVWLDSATA  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             + +I+ VS SA   Y    PP S  ++GTS KV Y   +V  N +L++T  +GETQ LI
Sbjct  138  SSPSIVAVSPSAHGNYHIYNPPSSSNVNGTSAKVKYESQVVI-NHSLDITTVSGETQPLI  196

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            +++QL + AR AL T       + G+A +P K+  FT  L  + P 
Sbjct  197  LYEQLSEAARQALETT------DFGSATVPFKNTTFTANLALASPI  236

 Score = 174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 128/224 (57%), Gaps = 10/224 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PFAQP   T  Q AAVKFKP L   +GC+PYPAV  DG+TSGGL+       G
Sbjct  259  IDHDAVVPFAQPTPNTTEQSAAVKFKPTLYIDNGCHPYPAVDEDGNTSGGLK-PTGSTTG  317

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             CT   LGSQIY R   Y  VWAIMY+WY PK   +     +GHRH+WE  V+W+D+   
Sbjct  318  GCTGSSLGSQIYGRVMEYDGVWAIMYSWYMPKDEPSPY---IGHRHDWENAVIWVDDITS  374

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
             + +I+ +S S   GY    PP + Y  G + K+ Y       +  L  T  AGETQDLI
Sbjct  375  ASPSIVAISASEHSGYKVYYPPSADYYSGYTAKIKYESVFFLVDHCLYATSTAGETQDLI  434

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL   A+ AL    DT   + G+A +P K+  F  K+ K++
Sbjct  435  MWDQLTAAAQTALE---DT---DFGSANVPFKEANFATKVAKAY  472

>PITG_23228
Length=254

 Score = 190 bits (483),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 143/248 (58%), Gaps = 31/248 (13%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG-CYPYPAVQADGSTSGGLRWTVV  82
            T  I HD+VQPF+QP  +T+S+KAA+ FKPQL T    C P+PA  A G  +GGL+    
Sbjct  19   TAKIDHDKVQPFSQPTPVTISEKAAITFKPQLYTPKSVCVPFPAANAYGEITGGLK----  74

Query  83   GQRGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVW  140
            G  G+  C  PPLGSQ+Y R  W+RDVWAIMY WYFPKG        +  RH+W+ VVVW
Sbjct  75   GSNGNDACVFPPLGSQVYGRVGWFRDVWAIMYAWYFPKGFWMG---FVSRRHDWKNVVVW  131

Query  141  IDNPALDNSTILGVSMSAS-IGYSK--RAPPKS-------------KYIDGTSVKVSYFY  184
            IDNP L+   ILGVSMS S   Y+K  R  P +              YI G +  + ++Y
Sbjct  132  IDNPGLEEPKILGVSMSKSETKYTKERRLWPSNFAGFYRMGRRYDRSYIYGFNTFLRFYY  191

Query  185  SIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTK  244
                G   L L+E  GE QDLIMW+QL DVAR ALN        N    ++P+ D+ F  
Sbjct  192  HFDVGTPNLYLSEWEGEYQDLIMWEQLTDVARAALNGS-----NNFEEVEVPISDEHFET  246

Query  245  KLKKSWPF  252
            +L ++W F
Sbjct  247  RLDEAWLF  254

>PHYSO_259736
Length=231

 Score = 189 bits (481),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 138/232 (59%), Gaps = 24/232 (10%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
             N I HDQV PFAQ   +  S KAA+KFKP+L+   GC+PYPAVQADG+ S GL+W   G
Sbjct  21   VNWINHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKW---G  77

Query  84   QR--GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWI  141
             +  G C    LGSQ+Y+RS WY+  WAI+                  HRH W ++V+WI
Sbjct  78   GKPDGKCKGSGLGSQVYSRSDWYQGKWAII------------------HRHLWLYLVLWI  119

Query  142  DNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGE  201
            DNP   N  ILGV +  + G  +R PP +K+IDG+S+KV Y+ S   G T ++LTE+ GE
Sbjct  120  DNPEAANPAILGVWLRTAGGNEQRVPPDAKFIDGSSLKVEYYKSSWHGKTGIQLTENPGE  179

Query  202  TQDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             QDL+ W+Q+ + AR AL   ++D       +  +P  D  FT  L+K+W F
Sbjct  180  FQDLVTWEQMTEEARIALTEANFDGHWQERKDLDVPFIDGEFTVNLEKAWIF  231

>PHYRA_71307
Length=237

 Score = 189 bits (481),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 130/224 (58%), Gaps = 10/224 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP   T  Q  AV FKPQ+   +GC+PYPAV  DG+TSGGL+ T   Q  
Sbjct  22   IDHDQVVPFAQPTPNTTVQSVAVNFKPQIYINNGCHPYPAVDEDGNTSGGLKPTG-SQSA  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY R+  Y  V+A MY+WY PK     G   LGHRH+WE  VVW+D+  L
Sbjct  81   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDETLPG---LGHRHDWENCVVWLDDITL  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            D   I+ +S S    Y    PP S Y+DG S K+ Y  S V  + +L  T  +GETQDLI
Sbjct  138  DEPNIVALSASYHSTYLYYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATSTSGETQDLI  197

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MW QL D AR AL    DT   + G+A +P K+  F  K+  ++
Sbjct  198  MWGQLTDAARTALE---DT---DFGSANVPFKEGNFATKVANAY  235

>PHYCA_18373
Length=246

 Score = 189 bits (481),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 126/207 (61%), Gaps = 9/207 (4%)

Query  46   KAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPLGSQIYARSTWYR  105
            KAAVKFKPQL    GC+PYPAVQADG  S GL+ T     G+C    LGSQIYARS WY+
Sbjct  49   KAAVKFKPQLHISYGCHPYPAVQADGVVSAGLKPTG-PDDGECQGSSLGSQIYARSDWYK  107

Query  106  DVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSKR  165
             V+AIMYTWY PKGS +        RH WE VVVWID+PA  NSTILGVS++  +   K 
Sbjct  108  GVYAIMYTWYLPKGSAS--------RHFWESVVVWIDDPAASNSTILGVSLNYGLQLKKE  159

Query  166  APPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDT  225
                 KY+ G+S+K+  F      N  L LTE  GE QDL+ +DQL D A  AL+    +
Sbjct  160  TNIDPKYLSGSSLKLDSFPGFAINNPKLRLTELDGEFQDLVTFDQLTDAAGIALSHAEFS  219

Query  226  TLWNLGNAQMPLKDDVFTKKLKKSWPF  252
                     MPL D VF ++LK +WPF
Sbjct  220  KGLIKAKTPMPLIDGVFNERLKDAWPF  246

>PHYRA_84277
Length=240

 Score = 189 bits (480),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 136/229 (59%), Gaps = 11/229 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            ++ HD+VQPF QP  +T+S+KA VKFKP L  + GC  YPAV A G TSGGL+ +  G  
Sbjct  21   TVDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGS-GGTT  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C  PPLGSQ+Y R+ WY DVWAIMY WYFPKG   +       RH+W   VVWIDNPA
Sbjct  80   SGCALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPF---WRHDWSNAVVWIDNPA  136

Query  146  LDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVS-YFYSIVFGNTALELTEDAGETQ  203
            L+N   LG+S+S S   Y       S +  GT+  +S Y   +     +     +  E Q
Sbjct  137  LENPKALGLSISRSENKYGSTYTDDSVFEYGTTPSLSRYLPPMQTAALSTSSFPNDFELQ  196

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMWDQL D AR ALN D D    N G   +P+ DD F K L+++WPF
Sbjct  197  DLIMWDQLTDAARAALN-DQD----NFGRTDVPISDDHFPKLLEEAWPF  240

>PHYRA_43347
Length=220

 Score = 188 bits (478),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 133/201 (66%), Gaps = 10/201 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD+VQPFAQP+ +TVS+KAAV+FKP L+   GC+PYPAV A G TS GL+ T     
Sbjct  23   SIDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSS-  81

Query  86   GDCTDPPLGSQI---YARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWID  142
            GDC    LGSQ+   YAR+ WY D+WAIMY WYFPK   T      G RH+W  VVVW+D
Sbjct  82   GDCKGSGLGSQVVLRYARAVWYSDLWAIMYAWYFPKDKPT---FRKGERHDWANVVVWLD  138

Query  143  NPALDNSTILGVSMSASI-GYSKRAPPKSKYIDGTSVKVSYFYSI-VFGNTALELT-EDA  199
            NPAL+  T++GVS S+ +  YSK  PP +  ++GT+  ++Y       G  +++ T +  
Sbjct  139  NPALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNHGFHSVDTTWKTG  198

Query  200  GETQDLIMWDQLPDVARDALN  220
            GE QDLIMW+QL D AR ALN
Sbjct  199  GEFQDLIMWEQLTDEARAALN  219

>PHYSO_496064
Length=254

 Score = 189 bits (480),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/244 (45%), Positives = 146/244 (60%), Gaps = 28/244 (11%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ-  84
            +I HD+VQPFAQP   TVS+KAAVKFKP ++   GC+PYPAV A G TSGGL+ +  G+ 
Sbjct  21   NIDHDKVQPFAQPEPTTVSEKAAVKFKPSIRIRSGCHPYPAVNAAGETSGGLKPS--GEP  78

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             GDC +  LGSQ+Y R+ WY+D+WAIMYTWYFPK S  +     G RH W   +VW+DNP
Sbjct  79   DGDCKNSSLGSQVYGRAVWYKDLWAIMYTWYFPKDSYGT-FFRSGQRHKWASFIVWLDNP  137

Query  145  ALDNSTILGVSMS-------------ASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNT  191
            +L+   IL VS S              + G    +PP + YI+GTS  ++Y  +  F  +
Sbjct  138  SLEKPKILAVSTSFQTGEYQILKNGPPACGRRSCSPPFTDYINGTSAMLAYLDT--FYGS  195

Query  192  ALELT--EDAGETQDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKK  248
             LE+T     GE QDLIMW+QL + A+ ALN TD+         A++P  D      L++
Sbjct  196  ILEMTTARTGGELQDLIMWEQLTEEAQIALNETDFGE------KARVPFIDANLNANLEQ  249

Query  249  SWPF  252
            +  F
Sbjct  250  TRSF  253

>PPTG_00460
Length=259

 Score = 189 bits (480),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 134/225 (60%), Gaps = 12/225 (5%)

Query  29   HDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDC  88
            HD+VQPFAQP  IT ++KAAVKFKP L    GC+PYPAV A G TS GL+ T     G+C
Sbjct  22   HDKVQPFAQPEPITDAEKAAVKFKPSLAVKAGCHPYPAVNAAGDTSAGLKGTGAPD-GEC  80

Query  89   TDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDN  148
               PLGSQ+Y+RS WY D WAIMY WYFPK  +  G I  G RH+W  +VVW+DNPAL  
Sbjct  81   EGSPLGSQVYSRSKWYEDKWAIMYAWYFPKDMQNIGLIKKGVRHDWVNLVVWLDNPALAE  140

Query  149  STILGVSMSA-SIGYSKRAPPK-SKYIDGTSVKVSYFYSIVFG-NTALELTEDAGETQDL  205
             TIL  S S    GY    PPK S  I+GT+ KV Y      G +T  +  E+ GE QDL
Sbjct  141  PTILATSASTYGTGYEISKPPKRSDIINGTTPKVRYDEDNREGWHTIFQFHEE-GEYQDL  199

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
            I W+QL +  R AL NTD+         A +P  D  F   LK +
Sbjct  200  IQWNQLTNATRKALENTDFGDF------ANVPFNDAYFETNLKAA  238

>PPTG_18463
Length=254

 Score = 189 bits (479),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 144/245 (59%), Gaps = 29/245 (12%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I  D VQPFAQP  +T+S+KAA+KFKPQL  LDGC  +PAV A G T+GGL  T  G+ 
Sbjct  21   TINRDLVQPFAQPGPVTISEKAAIKFKPQLFILDGCVSFPAVNAAGDTTGGLNGTQGGE-  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C+  PLGSQ+Y RSTWY+D WA+M+ WY PK    +       RH+W  +VVWI+NP+
Sbjct  80   -GCSKAPLGSQVYGRSTWYQDKWAMMFAWYIPKSYMAA---ITSRRHDWASMVVWIENPS  135

Query  146  LDNSTILGVSMSASI----------------GYSKRAPPKSKYIDG--TSVKVSYFYSIV  187
            L+   ILGVS+S S                 GY  R+  + + I G  TS++V +     
Sbjct  136  LEIPEILGVSLSNSANGYLRYTGNIYDWNFSGYVARSRRRDRDIPGSSTSLRVEHTVRKD  195

Query  188  FGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLK  247
            F +  L L +  G+ QDLIMW QL + AR ALNT       + G +++P  D  F  KL+
Sbjct  196  FRSAFLNLAQTDGDYQDLIMWGQLTEEARMALNTT------DFGRSKVPFNDGNFLIKLR  249

Query  248  KSWPF  252
            +++PF
Sbjct  250  QAYPF  254

>PHYCA_124383
Length=280

 Score = 189 bits (480),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/269 (40%), Positives = 143/269 (53%), Gaps = 51/269 (19%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T++I HDQV+PF QP  +T+S+KAAVK+KP L   DGC  +PAV   G  +GGL+ T   
Sbjct  23   TSTIDHDQVKPFRQPEPVTISEKAAVKYKPLLSIGDGCVSFPAVNTAGEITGGLKGT--K  80

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
               DCT+ PLGSQ+Y RS WY+D WA+MYTWYFPK        G   RH+W  VVVWIDN
Sbjct  81   NTKDCTEAPLGSQVYGRSAWYQDKWAMMYTWYFPKNFCAYKAAG---RHDWANVVVWIDN  137

Query  144  PALDNSTILGVSMSA-----------SIGYSKRAPPKS----------------------  170
            PAL+N+T LG S+S            ++   K  P ++                      
Sbjct  138  PALENATFLGASLSQQTLEPIKLVFLALAQRKEEPYENQKEIPMMAFAGTEQIATAMVGR  197

Query  171  -----KYIDG--TSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDW  223
                 KY+ G  T+++  + Y   F    +      GE+QDLIMW+QL D AR AL +  
Sbjct  198  WSYIYKYVGGSNTTMRFIHKYPQKFAWIGMSFAYSDGESQDLIMWNQLTDKARAALESA-  256

Query  224  DTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
                 + GN Q+P  D  F   L+ +WPF
Sbjct  257  -----DFGNTQVPFTDKNFETNLQAAWPF  280

>PHYRA_72531
Length=236

 Score = 187 bits (476),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 135/228 (59%), Gaps = 13/228 (6%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HD+VQPF QP ++T+++K+ VKFKPQL    GC PYPAV A G TS GL    V   
Sbjct  21   AIGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEYGCSPYPAVNAAGETSEGLETNGV---  77

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
             DC  P L SQ+Y R+ WY DVWAIMY WYFPKG           RH+W   VVWIDNPA
Sbjct  78   FDCIIPSLSSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTPW---WRHDWSNAVVWIDNPA  134

Query  146  LDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
             +   +LG+S+S S   Y     P     +GT+  +S    +   + AL    + GE QD
Sbjct  135  HEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLSR-NVLPMRSAALGPAVNPGEFQD  193

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            L+MWDQL D AR ALN D D    N G  ++P+ DD F K LKK+WPF
Sbjct  194  LVMWDQLTDAARAALN-DQD----NFGRTEVPISDDHFPKHLKKAWPF  236

>PHYRA_72541
Length=239

 Score = 187 bits (476),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 138/232 (59%), Gaps = 18/232 (8%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLK--TLDGCYPYPAVQADGSTSGGLRWTVVG  83
            SI HD+VQPF QP+ +T+++K+ VKFKP+L   T  GC  YPAV + G TSGGL+    G
Sbjct  21   SIDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLK----G  76

Query  84   QRGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWI  141
             +G   CT P LGSQ+Y R+ W+ DVWAIMY WYFPKG   S       RH+W   VVWI
Sbjct  77   TKGTSACTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGFWDSRAYW---RHDWSNAVVWI  133

Query  142  DNPALDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAG  200
            D+PAL+N  +LG+S+S S   Y  +  P     +GT+  + Y     +    L     +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAELVPYYASG  192

Query  201  ETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            E QDLIMW QL D AR ALN        N G  ++P+ DD F K L+K+WP 
Sbjct  193  EVQDLIMWGQLTDAARAALNDQ-----GNFGRTEVPINDDHFLKHLEKAWPL  239

>PHYRA_75425
Length=237

 Score = 187 bits (476),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 135/224 (60%), Gaps = 10/224 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PFAQP   T  Q  AVKFKPQ+   +GC+PYPAV  DG+TSGGL+ T   Q  
Sbjct  22   IDHDAVVPFAQPTPTTTLQTLAVKFKPQIYINNGCHPYPAVDEDGNTSGGLKPTG-SQSS  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             CT   LGSQIY R+  Y  V+A MY+WY PK  ET  G+G  HRH+WE  VVW+D+  L
Sbjct  81   GCTGSSLGSQIYGRAVEYEGVYAFMYSWYMPK-DETLDGVG--HRHDWENCVVWLDDITL  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            D   I+ +S S    Y    PP S Y+DG S K+ Y  S V  + +L  T  +GETQDLI
Sbjct  138  DEPNIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVLLDHSLSATSTSGETQDLI  197

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL    DT   + G+A +P K+  F  KL  ++
Sbjct  198  MWDQLTDAARTALE---DT---DFGDANVPFKEANFETKLANAY  235

>PHYRA_76603
Length=239

 Score = 187 bits (476),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 137/232 (59%), Gaps = 18/232 (8%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLK--TLDGCYPYPAVQADGSTSGGLRWTVVG  83
            SI HD+VQPF QP+ +T+++K+ VKFKP+L   T  GC  YPAV + G TSGGL+    G
Sbjct  21   SIDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCVSYPAVNSAGETSGGLK----G  76

Query  84   QRGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWI  141
             +G   CT P LGSQ+Y R+ WY DVWAIMY WYFPKG           RH+W   VVWI
Sbjct  77   TKGTSACTGPILGSQVYGRAEWYNDVWAIMYAWYFPKGFWDRRAYW---RHDWSNAVVWI  133

Query  142  DNPALDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAG  200
            D+PAL+N  +LG+S+S S   Y  +  P     +GT+  + Y     +    L     +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAELVPYYASG  192

Query  201  ETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            E QDLIMW QL D AR ALN        N G  ++P+ DD F K L+K+WP 
Sbjct  193  EVQDLIMWGQLTDAARAALNDQ-----GNFGRTEVPINDDHFLKHLEKAWPL  239

>PHYRA_83851
Length=239

 Score = 187 bits (475),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 137/231 (59%), Gaps = 16/231 (7%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD+VQPF QP+ +T+S+KA VKFKPQL    GC  YPAV A G TSGGL+    G  
Sbjct  21   SIAHDEVQPFPQPDPVTISEKAGVKFKPQLHFEGGCAAYPAVNAAGETSGGLKGN--GDI  78

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGH-RHNWEFVVVWIDNP  144
              C    LGSQ+Y RS WY DVWAIMY WYFPKG   +      H RH+W   V+WIDNP
Sbjct  79   SGCEISLLGSQVYGRSEWYNDVWAIMYAWYFPKGFWDAD----PHWRHDWSNAVLWIDNP  134

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAG---E  201
            AL+N  ILG+S+S S          S  I+ T+  +      V  + AL  ++  G   E
Sbjct  135  ALENPKILGLSLSTSENKYHTKNTYSPTINSTAPALCRDLPSV-ASAALVSSDVCGRPLE  193

Query  202  TQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            TQDLIMW QL D AR ALN D D    N G  ++P+ DD F K L+++WP 
Sbjct  194  TQDLIMWGQLTDAARAALN-DQD----NFGRTEVPISDDHFPKHLEEAWPL  239

>PHYCA_124462
Length=280

 Score = 188 bits (477),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 144/269 (54%), Gaps = 51/269 (19%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            TN+I HDQV+PF QP  +T+S+KAAVK+KP L   +GC  +PAV A G  +GGL+ T   
Sbjct  23   TNTIGHDQVKPFPQPEPVTISEKAAVKYKPLLSIGNGCVSFPAVNAAGEITGGLKGTKDT  82

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
            +  DCT+ PLG+Q+Y RSTW++D WA+MY+WYFPK      G     RH+W  VV+WIDN
Sbjct  83   E--DCTEAPLGTQVYGRSTWFQDKWAMMYSWYFPK---NFCGHKAADRHDWANVVIWIDN  137

Query  144  PALDNSTILGVSMSA-----------SIGYSKRAPPK-------------SKYIDGTSVK  179
            PAL+N+T LG S+S            ++   K  P +              + + G   +
Sbjct  138  PALENATFLGASLSQQTLEPKKFVFLTVAKRKEEPYQKQKAIPMMAFAGTEQIVTGRVSR  197

Query  180  VSYFYSIVFGNT----------------ALELTEDAGETQDLIMWDQLPDVARDALNTDW  223
             SY Y  V G+                  +      GE+QDLIMW+QL D AR AL +  
Sbjct  198  HSYTYKYVGGSNTTMRFIHKYPEKSAWIGMSFANSDGESQDLIMWNQLTDKARAALESA-  256

Query  224  DTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
                 + GN Q+P  D  F   L+ +WPF
Sbjct  257  -----DFGNTQVPFTDKNFETNLQAAWPF  280

>PHYCA_553546
Length=280

 Score = 187 bits (475),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/269 (40%), Positives = 147/269 (55%), Gaps = 51/269 (19%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            TN+I HDQV+PF QP  +T+S+KAAVK+KPQL+  DGC  +PAV A G  +GGL+ T   
Sbjct  23   TNTIDHDQVKPFPQPEPVTISEKAAVKYKPQLEIGDGCVSFPAVNAAGEITGGLKGTKDT  82

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
            +   CT+ PLGSQ+Y RSTW++D WA+MY+WYFPK        G   RH+W  VV+WIDN
Sbjct  83   EA--CTEAPLGSQVYGRSTWFQDKWAMMYSWYFPKNFCAYKAAG---RHDWANVVIWIDN  137

Query  144  PALDNSTILGVSMSAS-----------IGYSKRAPPKS----------------------  170
            PA +N T LG S+S             +G     P ++                      
Sbjct  138  PAAENVTFLGASLSQQTLEPIKLAILPMGTRNEEPYQNQKAIPMMAFAGAERITTGRVGR  197

Query  171  -----KYIDG--TSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDW  223
                 KY+ G  T+++ S+ Y   +G   +   +  GE+QDLIMW+QL D AR AL +  
Sbjct  198  WSYTYKYVAGSNTTMRFSHSYPGTWGWIDMTFADSDGESQDLIMWNQLTDKARAALESA-  256

Query  224  DTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
                 + G+ Q+P  D  F   L+ +WPF
Sbjct  257  -----DFGDTQVPFTDKNFDTNLQAAWPF  280

>PHYSO_560790
Length=237

 Score = 186 bits (471),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 135/226 (60%), Gaps = 14/226 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PF QP   T  Q+AAVK+KPQ+   +GC+PYPAV  +G+TSGGL  T     G
Sbjct  22   INHDQVVPFTQPTPTTALQQAAVKYKPQIHISNGCHPYPAVDNNGNTSGGLNPTGSESAG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFV--VVWIDNP  144
             C     G+QIY R+  Y+ V+A MY+WY PK    +G   LGHRH+WE    VVW+D  
Sbjct  82   -CKGSGYGTQIYGRAVKYQGVYAFMYSWYMPKDETLTG---LGHRHDWEACNCVVWLD--  135

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
            +LDN +I+ +S S    Y    PP S Y+DG S K+ Y  S V  + +L  T  AGETQD
Sbjct  136  SLDNPSIVALSASYHSTYLYYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATSTAGETQD  195

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            LIMWDQL D AR AL    DT   + G+A +P K+  F  K   ++
Sbjct  196  LIMWDQLTDAARTALE---DT---DFGDANVPFKEANFETKRANAY  235

>PHYSO_330015
Length=241

 Score = 186 bits (471),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 134/228 (59%), Gaps = 13/228 (6%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HD+VQPF QP  +TVS+KAAVK+KP L  LD C+PYPAV A G TSGGL+ T  G+R
Sbjct  23   TIDHDKVQPFPQPGPVTVSEKAAVKYKPNLLILDACHPYPAVNAAGETSGGLKGT--GKR  80

Query  86   -GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIG-LGHRHNWEFVVVWIDN  143
             G C    LGSQ+Y R+ W+ D+WAIMY WYFPK     G     G RHNW   VVW+DN
Sbjct  81   DGACKGSGLGSQVYGRAGWHDDMWAIMYAWYFPKDVYYRGTFSDKGFRHNWVNAVVWLDN  140

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            PAL+        +    GY + +PP + Y +GTS  + Y  +    +   + T   GE Q
Sbjct  141  PALETPRYSPCRLR---GYQECSPPFTGYFNGTSAMLVYEANGEEPSALSQNTLGGGELQ  197

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            DLIMW+QL   ARDAL+T       + G  ++P  D  F   LK + P
Sbjct  198  DLIMWEQLTVEARDALSTT------DFGETKVPFIDANFNANLKAARP  239

>PPTG_00471
Length=239

 Score = 186 bits (471),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 129/223 (58%), Gaps = 9/223 (4%)

Query  29   HDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDC  88
            HD+VQPFAQP  IT ++KAA+K+KP L    GC+PYPAV A G TS GL+ T     G+C
Sbjct  22   HDKVQPFAQPEPITDAEKAAIKYKPSLAVKAGCHPYPAVNAAGETSAGLKGTGAPD-GEC  80

Query  89   TDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDN  148
               PLGSQ+Y+RSTWY   WAIMY WYFPK  +  G I  G RH+W  +VVW+DNPAL  
Sbjct  81   EGSPLGSQVYSRSTWYEGKWAIMYAWYFPKDIKDVGLIKKGLRHDWVNLVVWLDNPALAK  140

Query  149  STILGVSMSASIGYSKRAPP--KSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
              IL  + S    Y K + P  +S+ I+G + KV Y      G   +    + GE QDLI
Sbjct  141  PKILATATSTFGAYYKISKPFKRSEVINGITPKVCYDNDDYKGWHTIFPFHEEGEYQDLI  200

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
             W+QL D AR+A          + G A +P  D  F   LK +
Sbjct  201  QWNQLTDAAREAFENG------DFGEANVPFNDAYFETNLKSA  237

>PHYRA_52960
Length=223

 Score = 185 bits (469),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 129/224 (58%), Gaps = 10/224 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PF QP   T  QK AVK KPQ+   +GC+PYPAV  DG+TSGGL+ T   Q  
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTG-DQSS  67

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C    LGSQIY R   YR V+A MY+WY PK     G   LG+RH+WE  VVWI N  L
Sbjct  68   GCIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQTLPG---LGYRHDWEACVVWISNITL  124

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +   I+ +S+S    Y    P    Y++G S K+ Y  S V  + +L  T   GETQDLI
Sbjct  125  EEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQDLI  184

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL   AR AL    DT   + G A++P KD  F +KL K++
Sbjct  185  MWDQLTAAARTALE---DT---DFGGARVPFKDANFKEKLAKAY  222

>PHYRA_52955
Length=223

 Score = 185 bits (469),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 129/224 (58%), Gaps = 10/224 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PF QP   T  QK AVK KPQ+   +GC+PYPAV  DG+TSGGL+ T   Q  
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTG-DQSS  67

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C    LGSQIY R   YR V+A MY+WY PK     G   LG+RH+WE  VVWI N  L
Sbjct  68   GCIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQTLPG---LGYRHDWEACVVWISNITL  124

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +   I+ +S+S    Y    P    Y++G S K+ Y  S V  + +L  T   GETQDLI
Sbjct  125  EEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQDLI  184

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL   AR AL    DT   + G A++P KD  F +KL K++
Sbjct  185  MWDQLTAAARTALE---DT---DFGGARVPFKDANFKEKLAKAY  222

>PPTG_17295
Length=238

 Score = 184 bits (468),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 138/230 (60%), Gaps = 17/230 (7%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            + HD++ P  QP+ +T+S+KAA+KFKPQL   DGC  +PAV   G  SGGL+    G  G
Sbjct  22   VDHDKLGPIPQPDPVTISEKAAIKFKPQLNIADGCVSFPAVNDGGDFSGGLK----GSNG  77

Query  87   D--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
            +  C D P+GSQ+Y R+ WY D WAIMY W+FPKG     G+    R++W   VVWIDNP
Sbjct  78   NSACDDAPMGSQVYGRAAWYNDKWAIMYAWFFPKGFFM--GVA-SRRYDWSSAVVWIDNP  134

Query  145  ALDNSTILGVSMSASIG-YSKRAP-PKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
                  +LG+S S S   Y +++P P    ++G +  +    S V G   L+ +   G+ 
Sbjct  135  DFATPAVLGLSTSTSDDEYQRKSPAPDFGILNGVTPLLYRSISEVAGQPMLDYSSRTGDF  194

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            Q LIMW+QL D AR+ LNT      ++ GNAQ+P  D  F +KLKK++PF
Sbjct  195  QPLIMWEQLTDAARETLNT------FDFGNAQVPFNDANFEEKLKKAYPF  238

>PHYKE_4541
Length=147

 Score = 181 bits (460),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 106/147 (72%), Gaps = 5/147 (3%)

Query  111  MYTWYFPKGSETSG----GIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSKRA  166
            MY WYFPKG E           GHRHNWE+ +VWIDNPALD+  ILGVSMSA+  YSKRA
Sbjct  1    MYAWYFPKGREAVSMHPYARFFGHRHNWEYAIVWIDNPALDDPAILGVSMSAATSYSKRA  60

Query  167  PPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDAL-NTDWDT  225
            PP +KY+DG S+KV Y+ + V  +TAL LT+  GE QDL+ WDQLPD AR+AL +TDWDT
Sbjct  61   PPMAKYLDGDSLKVEYYSNAVVASTALRLTKTKGEFQDLVTWDQLPDAARNALIDTDWDT  120

Query  226  TLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            TL+N   A+ PLKD VF + L K++P 
Sbjct  121  TLFNTAGAKFPLKDGVFNETLAKAYPL  147

>PPTG_11469
Length=253

 Score = 184 bits (468),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 140/247 (57%), Gaps = 33/247 (13%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG-CYPYPAVQADGSTSGGLRWTVVGQ  84
            ++ HD++QPF QP  +T+S+KAA+KFKPQL   +G C  YPAV   G T+GGL+    G 
Sbjct  20   TVDHDKIQPFPQPEPVTISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTGGLK----GS  75

Query  85   RGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GHRHNWEFVVVWI  141
             G+  C   PLGSQ+Y R+ WY+DVWAIMY WYFPKG      +G    RH+W+ VVVWI
Sbjct  76   NGNDACKSAPLGSQVYGRAGWYKDVWAIMYAWYFPKGF----WVGFPTRRHDWKSVVVWI  131

Query  142  DNPALDNSTILGVSMSAS-IGYSKRAPPKSK---------------YIDGTSVKVSYFYS  185
            DNP L+   I+GVSMS S   Y KR    +                Y  G++  + + Y 
Sbjct  132  DNPDLEVPKIVGVSMSKSDTKYDKRLELFASDFAGFQMMGQGRFRTYTYGSNTSLRFGYQ  191

Query  186  IVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKK  245
            +  G+  L      GE QDLIMW+QL D AR ALN D      N   A++P  D+ +   
Sbjct  192  MELGSPYLNFGVRDGEYQDLIMWEQLTDAARAALNDD-----NNFEKAEVPFSDEHYEDH  246

Query  246  LKKSWPF  252
            L K+WP 
Sbjct  247  LDKAWPL  253

>PHYSO_334500
Length=235

 Score = 184 bits (466),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 135/224 (60%), Gaps = 12/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD V PFAQP   T  Q  AVKFKPQ+   +GC+PYPAV  DG+TSGGL+ T     G
Sbjct  22   IDHDTVVPFAQPTPTTTLQTLAVKFKPQIYIANGCHPYPAVDEDGNTSGGLKPTGSESSG  81

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
              T   LGSQIY R+  Y  V+A MY+WY PK        GLGHRH+WE  VVW+D+  L
Sbjct  82   -YTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDETLP---GLGHRHDWEACVVWLDS--L  135

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            D+ +I+ +S S    Y    PP S Y+DG S K+ Y  S V  + +L  T  AGETQDLI
Sbjct  136  DDPSIVALSASYHSTYLTYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATSTAGETQDLI  195

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL    DT   + G+A +P K+  F  K+ K++
Sbjct  196  MWDQLTDAARTALE---DT---DFGSANVPFKEANFATKVAKAY  233

>PPTG_07991
Length=276

 Score = 185 bits (469),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 136/230 (59%), Gaps = 26/230 (11%)

Query  26   SIPHDQVQPF--AQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            +I +DQV+PF  AQP+  TV++KAA+KF+P+L  ++GC+PYPAV A G  S GL+     
Sbjct  69   TIAYDQVEPFEMAQPSDATVTEKAAIKFRPKLHVVNGCHPYPAVNAAGQVSKGLQ-KADA  127

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
               +C+   LG+Q+Y RS W+  VWAIMY WYFP  S            +WE V+VW +N
Sbjct  128  TDAECSGSKLGTQVYGRSAWFGRVWAIMYAWYFPDVSP-----------DWEHVIVWTNN  176

Query  144  PALDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            P + N  IL V+ S S G YS + PP +  I G SVK++Y       N ALE T   G  
Sbjct  177  PNVTNQVILAVTTSDSTGKYSSQVPPDASMISGKSVKIAY------NNNALESTTKEGGA  230

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            Q+L++W QL   A++ALN D      + G  Q+P+ DD F   L K+WPF
Sbjct  231  QNLVLWHQLTPEAQEALNDD-----QSFGGVQVPVNDDYFLLNLGKAWPF  275

>HYAP_08306
Length=286

 Score = 184 bits (468),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 130/228 (57%), Gaps = 13/228 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            + HD +QPF QP  +T     A+K KP+L  + GC+PYPAV A G TS GL+ T     G
Sbjct  58   VGHDTLQPFPQPKPVTRLDVVAIKLKPELFIVHGCHPYPAVNATGHTSNGLK-TSGDADG  116

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y R+TW+R  WAIMY WYFPK +        G RH+WE  +VWI+NP +
Sbjct  117  HCKGSGHGSQVYGRATWFRGKWAIMYAWYFPKDAPDEES---GQRHDWEHAIVWINNPKV  173

Query  147  DNSTILGVSMSAS--IGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
                IL VS+S     GY K+  P     DGT +K+SY       +  L+LT + GE QD
Sbjct  174  KQPKILAVSVSCGKFFGYLKKVAPGPAVFDGTRLKLSYGADHKHEHR-LDLTAEKGEDQD  232

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LIMW+QL D AR A     DT LW   N  MPL D  +  +L ++WPF
Sbjct  233  LIMWEQLTDEARCAF----DTILWT--NDMMPLNDAWYKHELTRAWPF  274

>PHYKE_208
Length=187

 Score = 181 bits (458),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 106/148 (72%), Gaps = 4/148 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP + T+S+KAAVKFKPQ+   +GC+PYPAV + G TSGGL+ T     G
Sbjct  22   ISHDQVVPFAQPEATTISEKAAVKFKPQIHVTNGCHPYPAVNSAGDTSGGLKPTGA-PSG  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQ+Y RSTWY   WAIMY+WYFPK S ++   GLGHRH+WE VVVWIDNP +
Sbjct  81   SCKGSGYGSQVYGRSTWYSGRWAIMYSWYFPKDSPST---GLGHRHDWEHVVVWIDNPDV  137

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYID  174
            +N TILGVS SA  GYSK  PP S  +D
Sbjct  138  ENPTILGVSPSAHSGYSKYVPPSSDTVD  165

>PHYCA_129892
Length=234

 Score = 182 bits (462),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 133/224 (59%), Gaps = 12/224 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFAQP   T  Q  AV++KPQ+   +GC+PYPAV  DG+TSGGL+ T   Q  
Sbjct  21   IDHDQVVPFAQPTPTTTLQTLAVQYKPQIYIANGCHPYPAVDEDGNTSGGLKPT-GSQSA  79

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY R+  Y  V+A MY+WY PK        GLGHRH+WE  VVW+D  +L
Sbjct  80   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDETLP---GLGHRHDWEACVVWLD--SL  134

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLI  206
            +N  ++ +S S    Y    PP S Y+DG S K+ Y  S V  + +L  T  +GETQDLI
Sbjct  135  ENPNVVALSASYHSTYLTYYPPDSGYLDGNSAKIEYSTSWVILDHSLSATSTSGETQDLI  194

Query  207  MWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            MWDQL D AR AL    DT   + G+A +P KD  F  KL  ++
Sbjct  195  MWDQLTDAARTALE---DT---DFGDANVPFKDANFETKLANAY  232

>PITG_22734
Length=168

 Score = 179 bits (455),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 108/151 (72%), Gaps = 7/151 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            + HD+VQPF QP  IT SQK+AVK+KPQL    GC+PYPAV+ +GS SGGL W+     G
Sbjct  24   VNHDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPAD-G  82

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GHRHNWEFVVVWIDNPA  145
            DCT  PLGSQ+Y+RS WY++ WAIMY WYFPKG       GL GHRH WE+VVVW D+  
Sbjct  83   DCTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR-----YGLTGHRHYWEYVVVWADSST  137

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGT  176
              NS+I GVSMSA +G++K  PP  KYI G+
Sbjct  138  STNSSIQGVSMSAGVGHAKATPPMLKYIHGS  168

>PHALS_13513
Length=240

 Score = 181 bits (460),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 133/228 (58%), Gaps = 10/228 (4%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I  + VQPF +    T S+++A+K+KP L   +GC+PYPAVQ +GS S G  W     +
Sbjct  22   AIDANSVQPFPEQKPQTDSERSALKYKPHLHVSEGCHPYPAVQQNGSVSAGFEWDEDYSQ  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C   P GSQIY+RS+WY+  WAIMY WYFPK +   G    G RH W   +VW D   
Sbjct  82   -PCGRSPQGSQIYSRSSWYKGKWAIMYAWYFPKAAVHIGRGVSGRRHYWLHAIVWTDEEN  140

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
             +NS+ILGV+MSA IG  KR   KS Y I GT++K+  + S      AL+ T   GETQD
Sbjct  141  PNNSSILGVTMSAGIGLLKRTKIKSHYIIGGTTLKLMSYVSFWGRRLALKFTVKLGETQD  200

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            LI W+QL   AR AL  D+ +          PL+D  F   +K+++PF
Sbjct  201  LITWEQLSHEARKALALDYKS--------DTPLQDYRFDGLIKEAYPF  240

>PHYSO_253029
Length=252

 Score = 181 bits (460),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 138/230 (60%), Gaps = 12/230 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG-CYPYPAVQADGSTSGGLRWTVVG  83
            +SI  ++V PFAQP + T +QKAAVKFKP+L    G C  +PAV + G TS GL     G
Sbjct  20   SSIDLNKVAPFAQPTASTSAQKAAVKFKPRLSIGSGACVSFPAVNSAGDTSSGLSEEGKG  79

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
               DCT+ PLGSQ+Y R+ WY   +AI+Y WYFPKG           RH+W   VVWIDN
Sbjct  80   ST-DCTNAPLGSQVYGRAAWYNTRFAILYAWYFPKGFWNDYPT---RRHDWASAVVWIDN  135

Query  144  PALDNSTILGVSMS-ASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            P  +   ILG+S+S A   YS +AP  S   DGT+ K+S+  S+  G+  L  T+ +G+ 
Sbjct  136  PDSNTPKILGLSLSTADWEYSTQAPATSGISDGTTPKLSHELSVECGDPYLTTTDGSGDF  195

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            Q LIMW+QL   AR ALN+       + GNA++P  D  F  KLK +WPF
Sbjct  196  QPLIMWEQLTTAARTALNSA------DFGNAKVPTSDVNFEMKLKSAWPF  239

>PPTG_04504
Length=253

 Score = 181 bits (460),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 145/250 (58%), Gaps = 40/250 (16%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI +D+VQP AQP  +T+S+KA VKFKPQL    GC+ +PAV A G TS GL      ++
Sbjct  21   SIAYDKVQPIAQPKPVTISEKAGVKFKPQLFVDSGCFTFPAVNAAGETSSGLP----AEQ  76

Query  86   GD--CTDP--PLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWI  141
            G+  C      LGSQ+Y R+TWY+ VWAIMY WY+PK   T   +     H+W+  VVWI
Sbjct  77   GNYFCVKRYNLLGSQVYGRATWYKGVWAIMYAWYYPK---TITALVATATHDWQNAVVWI  133

Query  142  DNPALDNSTILGVSMS------------------ASIGYSKRAPPKSKYIDGTSVKVSYF  183
            +NP L++  I+G+S S                  + + Y KR     +++DGTS K++  
Sbjct  134  NNPDLESPKIMGLSTSKKSETDHTKPHITRETFKSDVTYDKRTKDFDQFLDGTSFKLA--  191

Query  184  YSIVFGNTALE-LTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVF  242
             +++ G   L  +TE  GE QDL+MW QLPDVAR ALN+        +GN  +P  D  F
Sbjct  192  STLILGPIFLRPMTEKKGEFQDLVMWSQLPDVARAALNST------EIGN--VPFSDANF  243

Query  243  TKKLKKSWPF  252
             KKL ++WPF
Sbjct  244  QKKLAEAWPF  253

>PPTG_17453
Length=254

 Score = 181 bits (460),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 137/246 (56%), Gaps = 31/246 (13%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG-CYPYPAVQADGSTSGGLRWTVVGQ  84
            ++ HD+++PF QP   T+S+KAAVKFKPQL T +  C PYPAV   G  +GGL+    G 
Sbjct  21   TVDHDKIEPFPQPEPATISEKAAVKFKPQLYTPNSVCVPYPAVNVAGEVAGGLK----GT  76

Query  85   RGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWID  142
             G+  C   P GSQIY R+ WY D+WAIMY WYFPKG           RH+W+ VVVWID
Sbjct  77   NGNDACKYAPKGSQIYGRAGWYNDLWAIMYAWYFPKGFWMDSP---SRRHDWKSVVVWID  133

Query  143  NPALDNSTILGVSMSAS---------------IGYSKRAPPKSK-YIDGTSVKVSYFYSI  186
            NP      I+GVSMS S                GY        + YI G++  + + Y  
Sbjct  134  NPESQTPKIVGVSMSKSDTRYNKETKTWPSNFAGYRMEGRRYHRTYIYGSNTSLRFQYQS  193

Query  187  VFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKL  246
              G+  L   +  GE QDLIMW+QL D AR ALN   D    N G+A++P  D+ + K L
Sbjct  194  DLGSPYLNFGDWEGEYQDLIMWEQLTDAARAALN---DGN--NFGDAEVPFSDEHYEKHL  248

Query  247  KKSWPF  252
             K+WPF
Sbjct  249  DKAWPF  254

>PHALS_12600
Length=267

 Score = 181 bits (459),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 136/225 (60%), Gaps = 7/225 (3%)

Query  30   DQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCT  89
            D+VQPF Q    T+SQ++A+K+KP+L   +GC+PYP VQ +GS S G++W     R  C 
Sbjct  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF-RPSCE  106

Query  90   DPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNS  149
              P GSQIY+RS WY+  WA++YTWY P   +++     GHRH W +VV+W D+P  D+S
Sbjct  107  GSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDS  166

Query  150  TILGVSMSA-SIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIM  207
            TIL  SMS       K AP KSKY I   ++KV    S +     LELT+  GE QDLI 
Sbjct  167  TILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLIT  226

Query  208  WDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            W+QL D AR AL+            A  P++D +F + L+KS+PF
Sbjct  227  WEQLSDEARAALSNFHRLE----KRANPPIQDKLFYEVLEKSYPF  267

>PHYRA_45457
Length=199

 Score = 179 bits (453),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 121/195 (62%), Gaps = 9/195 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQV PFA+P  +T+S+KA VKFKPQL   +GC+ YPAV   G T GGL+ T      
Sbjct  12   ISHDQVIPFAEPAPVTISEKAGVKFKPQLHISNGCHSYPAVNEAGDTGGGLK-TSGAPSS  70

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C     GSQIY RS W+ DVWAIMY WYFPK   ++    LGHRH+WE  V+WIDNP +
Sbjct  71   KCKGSGYGSQIYGRSGWHSDVWAIMYAWYFPKDMAST---TLGHRHDWEHAVIWIDNPDV  127

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSY--FYSIVFGNTALELTEDAGETQD  204
                ILGVS+S+  GY+K        + GT+V ++Y  F+ +   +  L LT   G+ Q 
Sbjct  128  AEPKILGVSVSSHSGYAKTTTIPVGSLVGTTVLINYESFWPL---DHELSLTTKGGDLQP  184

Query  205  LIMWDQLPDVARDAL  219
            LIMW QL D AR++L
Sbjct  185  LIMWSQLTDAARNSL  199

>PITG_23211
Length=245

 Score = 180 bits (457),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 131/228 (57%), Gaps = 12/228 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD VQPFAQP   T ++K AVKFKP L    GC+PYP V A G T  GL+ T     
Sbjct  5    SIDHDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSD-  63

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G+CT  PLGSQ+Y+RST Y + WAIMY WYFPK  +  G I  G RH+W  +VVW+DNP 
Sbjct  64   GECTGSPLGSQVYSRSTLYENKWAIMYAWYFPKNMQNIGLIKKGVRHDWVNLVVWLDNPT  123

Query  146  LDNSTILGVSMSA-SIGYSKRAPPK-SKYIDGTSVKVSYFYSIVFG-NTALELTEDAGET  202
            L   TIL  S S     Y    PPK S  I+GT+ KV Y      G +T  +  E+ GE 
Sbjct  124  LAKPTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFHEE-GEY  182

Query  203  QDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
            QDLI W QL D AR+AL NTD+         A +P  D  F   +K +
Sbjct  183  QDLIQWTQLTDAAREALENTDFGDF------ANVPFNDAYFETNVKAA  224

>PHYRA_44405
Length=232

 Score = 180 bits (456),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 139/228 (61%), Gaps = 14/228 (6%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD+VQPFAQP  +T+S+KAAV+FKP+L+   GC+PYPAV A G TS GL+ T     
Sbjct  15   SIDHDKVQPFAQPEPVTISEKAAVQFKPRLQIFGGCHPYPAVNAAGETSAGLKGTGT-HD  73

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            GDC    LGSQ+Y RS WY D+W IMY WYFPK          GHRH W  VVVW+DNPA
Sbjct  74   GDCMRSRLGSQVYGRSVWYGDLWGIMYAWYFPKDKPK---YRKGHRHEWANVVVWLDNPA  130

Query  146  LDNSTILGVSMSASI-GYSKRAPPKSKYIDGTSVKVSYFYSIVF-GNTALELT-EDAGET  202
             +  T++G+S S  +  Y+K     +   DG +  ++Y   ++  G  ++++  E  GE 
Sbjct  131  HERPTMIGMSTSWFVTTYAKYKFVPTNGFDGKTYTINYKDDVLNDGFHSVDVIWEIGGEF  190

Query  203  QDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
            QDLIMW+QL D AR AL +TD+        +A +P  D  F   L+K+
Sbjct  191  QDLIMWEQLTDEARAALSDTDFGE------DAPVPFIDANFKANLEKA  232

>PHYCA_109089
Length=277

 Score = 181 bits (459),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/266 (40%), Positives = 136/266 (51%), Gaps = 50/266 (19%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQVQPFAQP  +T+S+KAAVKFKPQ+   DGC P+PAV A G  SGGL  T     
Sbjct  23   TINHDQVQPFAQPEPVTISEKAAVKFKPQIHITDGCVPFPAVNAAGEVSGGLNPTKYTD-  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              CT+ P+GSQ+Y R++WYRD WAIMY WYFPK        G   RH W  +V+W+DNPA
Sbjct  82   -GCTESPMGSQVYGRASWYRDHWAIMYAWYFPKNFRAFFARG---RHGWANMVLWLDNPA  137

Query  146  LDNSTILGVSMSASIGYSKR-------------------APPKS----------------  170
            L+N  +LG S+S     +++                    PP                  
Sbjct  138  LENQKLLGASLSQQTLKAEKILFIPLDEREKEPYQKFNGIPPMGFVGMQEIRHTQLSRWS  197

Query  171  ---KYIDGTSVKVSYFYSI-VFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTT  226
                Y  G++V     + +  F    L      GE QDLIMW+QL D AR  LN+     
Sbjct  198  WNYTYEGGSNVSTRVIHMMDKFDWIHLSFLGRDGEYQDLIMWEQLTDEARAGLNSA----  253

Query  227  LWNLGNAQMPLKDDVFTKKLKKSWPF  252
              + G+   P  DD F   L+K+WPF
Sbjct  254  --DFGDTFAPFTDDNFKTALEKAWPF  277

>PPTG_08703
Length=254

 Score = 179 bits (455),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 137/246 (56%), Gaps = 31/246 (13%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLD-GCYPYPAVQADGSTSGGLRWTVVGQ  84
            ++ HD+++P  QP  +T+SQKAA+KFKPQL T +  C  +PAV A G  +GGL+    G 
Sbjct  21   TVDHDKIEPIPQPEPVTISQKAAIKFKPQLYTSEIACVSFPAVNAAGEVTGGLK----GT  76

Query  85   RGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWID  142
             G+  C   P GSQ+Y R+ WY+D+WAIMY WYFPKG           RH+W+ VVVWID
Sbjct  77   NGNDACKYAPKGSQVYGRAGWYKDLWAIMYAWYFPKGFWMDFPT---RRHDWKNVVVWID  133

Query  143  NPALDNSTILGVSMSAS---------------IGYSKRAPPKSK-YIDGTSVKVSYFYSI  186
            NP L+   I+GVSMS S                GY        + YI G++  + + Y  
Sbjct  134  NPDLETPKIVGVSMSKSDKKYFKETKIWASNFAGYRMEGRRYHRTYIYGSNTSLRFQYQT  193

Query  187  VFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKL  246
              G+  +      GE QDLIMW+QL DV R ALN   D+   N G A++P  D+ F   L
Sbjct  194  TLGSPYMNFARWDGEYQDLIMWEQLTDVVRVALN---DSK--NFGKAEVPFSDEHFEDHL  248

Query  247  KKSWPF  252
             K+WP 
Sbjct  249  DKAWPL  254

>PHYSO_480350
Length=245

 Score = 179 bits (453),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/245 (44%), Positives = 140/245 (57%), Gaps = 39/245 (16%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI +D+V P AQP ++T+S+KA VKFKPQL    GC  +PAV A G TS G      G  
Sbjct  22   SIAYDKVAPIAQPEAVTISEKAGVKFKPQLFVDGGCTSFPAVNAAGETSNG------GNY  75

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C   PLGSQ+Y R+TWY+DVWAIMY WY+PK    S G G    H+W+  VVWIDNPA
Sbjct  76   G-CVKAPLGSQVYGRATWYKDVWAIMYAWYYPKSFFASIGTG---THDWQNAVVWIDNPA  131

Query  146  LDNSTILGVSMS------------------ASIGYSKRAPPKSKYIDGTSVKVSYFYSIV  187
            + +  IL +S S                  ++  Y K   P    ++GTSVK+    + +
Sbjct  132  VASPKILALSTSKKSETDYMKPTITTETFNSASNYDKAKAPIQN-VNGTSVKL--VSTSI  188

Query  188  FGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLK  247
             G   L  T +AGE QDLIMW+QLP+ AR AL+        ++G+  +P  D  F KKL 
Sbjct  189  LGPMFLRSTPEAGEFQDLIMWNQLPEEARAALSGK------DIGD--VPFSDANFQKKLG  240

Query  248  KSWPF  252
            ++WPF
Sbjct  241  EAWPF  245

>PHYSO_516261
Length=227

 Score = 178 bits (451),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 131/229 (57%), Gaps = 22/229 (10%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
             +I HD VQPFAQPN +TVS+KAAVKF+P L    GC P+PAV + G TSGGL+ T  G 
Sbjct  20   GTIDHDAVQPFAQPNPVTVSEKAAVKFQPLLFVESGCVPFPAVNSAGETSGGLKGT--GG  77

Query  85   RGDCTDP-PLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
               C +    GSQ+Y R+ WY+D WAIMY WYFPKG  +         H+W  +VVWIDN
Sbjct  78   TSGCKEAGATGSQVYGRAVWYKDDWAIMYAWYFPKGFWSRWA---SRHHDWASIVVWIDN  134

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            PAL+   ++G+S S      + A P   Y     ++              +L +  G+TQ
Sbjct  135  PALETPKMIGISTSEGDNDYRTAGPDDVYETTPRLR----------RVLAQLFKILGDTQ  184

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             LIMW+QL D AR  LNT       + G A++P+ D  F  KL+K+WPF
Sbjct  185  PLIMWEQLTDEARITLNTT------DFGKAKVPMSDANFQGKLEKAWPF  227

>PITG_00957
Length=298

 Score = 180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 130/228 (57%), Gaps = 12/228 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ-  84
            SI HD+VQPFAQP  IT  +KAAVKFKP L  + GC+PYPAV A G TS GL+ T  G+ 
Sbjct  57   SIDHDKVQPFAQPQPITDVEKAAVKFKPSLAVMSGCHPYPAVNAAGETSAGLKGT--GEP  114

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             G C    LGSQ+Y+RSTWY   WAIMY WYFPK  +  G    G RH+W  VVVW++NP
Sbjct  115  DGGCEGSELGSQVYSRSTWYEGRWAIMYAWYFPKDIQNGGLAKKGIRHDWVNVVVWLNNP  174

Query  145  ALDNSTILGVSMSA-SIGYSKRAPPKSK-YIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            A+   TIL  S S     Y    PPKS   IDG + K+ Y          +      GE 
Sbjct  175  AVAAPTILATSASTYGTRYVISKPPKSSDIIDGITAKLRYDEEGGEEWHTIFQFYGEGEF  234

Query  203  QDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
            QDLI WDQL D AR+AL NTD+   +       +P  D  F   LK +
Sbjct  235  QDLIQWDQLTDAAREALQNTDFGDYV------NVPFNDAYFETNLKAA  276

>PHYRA_72430
Length=238

 Score = 178 bits (451),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 130/229 (57%), Gaps = 11/229 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
             SI   +V P  QP+  T ++K  VKFKPQL   DGC  +PAV A G T+ GL+    G 
Sbjct  20   GSIDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGG  79

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             G C+  PLGSQ+Y RS WY   +AI+Y WYFPKG   +       RH+W   VVWID P
Sbjct  80   IG-CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWANVAT---RRHDWASAVVWIDRP  135

Query  145  ALDNSTILGVSMS-ASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
               + +ILG+S+S A   Y  +AP  S    GT+ ++S+      G   L  T+  G  Q
Sbjct  136  DAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSPQ  195

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMW+QL   AR AL+T       + GNA++P+ D  F  KLKK+WPF
Sbjct  196  DLIMWEQLSSAARTALSTT------DFGNAKVPMSDANFQTKLKKAWPF  238

>PHYRA_72306
Length=238

 Score = 178 bits (451),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 130/229 (57%), Gaps = 11/229 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
             SI   +V P  QP+  T ++K  VKFKPQL   DGC  +PAV A G T+ GL+    G 
Sbjct  20   GSIDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGG  79

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             G C+  PLGSQ+Y RS WY   +AI+Y WYFPKG   +       RH+W   VVWID P
Sbjct  80   IG-CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWANVAT---RRHDWASAVVWIDRP  135

Query  145  ALDNSTILGVSMS-ASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
               + +ILG+S+S A   Y  +AP  S    GT+ ++S+      G   L  T+  G  Q
Sbjct  136  DAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSPQ  195

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DLIMW+QL   AR AL+T       + GNA++P+ D  F  KLKK+WPF
Sbjct  196  DLIMWEQLSSAARTALSTT------DFGNAKVPMSDANFQTKLKKAWPF  238

>PPTG_14652
Length=257

 Score = 178 bits (452),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 132/228 (58%), Gaps = 12/228 (5%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD V+PFAQP  IT+++KAAVKFKP L    GC+PYP V A G TS GL  T     
Sbjct  19   SINHDMVKPFAQPEPITIAEKAAVKFKPSLAVKSGCHPYPIVNAAGDTSTGLEGTGPPD-  77

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C  P LGSQ+Y+RSTW  D WAIMY WYFPK  +  G +  G RH+W  +VVW+DNPA
Sbjct  78   GGCEGPELGSQVYSRSTWCEDKWAIMYAWYFPKDIQNRGLVKTGVRHDWVNLVVWLDNPA  137

Query  146  LDNSTILGVSMSASIG-YSKRAPPK-SKYIDGTSVKVSYFYSIVFG-NTALELTEDAGET  202
            L    +L  S S     Y    PPK S  I+GT+ K+ Y        +T  +  E+ GE 
Sbjct  138  LVKPAMLATSASTYGNLYVISKPPKTSDVINGTTPKLRYDEDGYEAWHTVFQFHEE-GEY  196

Query  203  QDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
            QDLI W+QL D AR+AL NTD+           +P  D  F   LK++
Sbjct  197  QDLIQWNQLTDAAREALTNTDFGVF------GHVPFIDAFFETNLKEA  238

>PHYCA_12462
Length=177

 Score = 176 bits (445),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 108/161 (67%), Gaps = 8/161 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+VQPF QP   T S+K+AVK+KPQL+         AVQADGS S GL+WT     G
Sbjct  24   INHDKVQPFTQPEPTTNSEKSAVKYKPQLRIS------TAVQADGSVSAGLKWTGWSD-G  76

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+Y+RS WY+D WAIMY WYFPKG +       GHRH W + +VW+D+   
Sbjct  77   DCKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISKYRFGHRHYWSYAIVWMDSDVP  136

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSI  186
            DNSTILGVSMSA +GYSK   PKSKY +DGT+VK   + S 
Sbjct  137  DNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESYNSF  177

>PHYSO_249691
Length=225

 Score = 177 bits (450),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 124/192 (65%), Gaps = 12/192 (6%)

Query  60   GCYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKG  119
            GC+PYPAV  DG+TSGGL+ T     G C     GSQIY R T +  V+A+MY+WYFPK 
Sbjct  43   GCHPYPAVDKDGNTSGGLKPTGSSSAG-CKGSGYGSQIYGRITTFNGVYALMYSWYFPKD  101

Query  120  SETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVK  179
            S  SG   LGHRH+WE VVVW+D+  L + +I+ VS SA  GY+   PP+S  IDG S K
Sbjct  102  SPISG---LGHRHDWEHVVVWVDDITLASPSIIAVSPSAHNGYNIYYPPESGTIDGYSAK  158

Query  180  VSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLK  238
            V Y  S +  N AL+ T DAGETQDLIMWDQL D AR AL NTD+       G+A +P+K
Sbjct  159  VDYSSSWLVVNHALDSTSDAGETQDLIMWDQLTDTARTALENTDF-------GDANVPMK  211

Query  239  DDVFTKKLKKSW  250
            D  F  KL  ++
Sbjct  212  DANFQMKLGNAY  223

>PHYCA_123797
Length=241

 Score = 178 bits (451),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 134/231 (58%), Gaps = 28/231 (12%)

Query  26   SIPHDQVQPF--AQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            +I +D+V PF  AQP+  TV++KAA+KF+P+LK ++GC+PYPAV A G  S GL   V  
Sbjct  34   TIAYDKVVPFPMAQPSESTVTEKAAIKFRPKLKVVNGCHPYPAVNAAGQVSNGLE--VAD  91

Query  84   QRG-DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWID  142
              G  C    LG+Q+Y RS W+  VWAIMY WYFP  +            +WE V+VW +
Sbjct  92   PTGAACKGSKLGTQVYGRSAWFGRVWAIMYAWYFPDVTA-----------DWEHVIVWTN  140

Query  143  NPALDNSTILGVSMSASI-GYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGE  201
            NP + N  +L V+ S S  GY+ + PP +  + G SVKVSY       N  LE T + G 
Sbjct  141  NPNVTNQVVLAVTTSNSKGGYTSQVPPDATMMSGKSVKVSY------NNNGLESTTEEGG  194

Query  202  TQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             Q+LI+W QL   A++ALN D      N    Q+P+ DD F   L K+WPF
Sbjct  195  AQNLILWHQLTAAAQEALNDD-----QNFDGVQVPVNDDYFLLNLGKAWPF  240

>PHYRA_52260
Length=234

 Score = 177 bits (449),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 134/226 (59%), Gaps = 13/226 (6%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            S+ +D+VQPF QP+ +T ++K+ VKFKPQL    GC  YPAV A G  +GGL  + +   
Sbjct  21   SVDYDKVQPFPQPDPVTTTEKSGVKFKPQLDIEYGCSSYPAVNAAGDINGGLPTSGI---  77

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
             DC     GSQ+Y R+ WY DVWAIMY WYFPKG   +       RH+W   VVWIDNPA
Sbjct  78   ADCQFALGGSQVYGRAEWYNDVWAIMYAWYFPKGFWDAAPY---WRHDWSNAVVWIDNPA  134

Query  146  LDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
            L+N  ILG+S+S S   Y     P     +GT+  ++     VF    L  + + GE QD
Sbjct  135  LENPKILGLSLSTSENKYGNTYVPAEAIENGTTPTLNRNLP-VFRAAELRPSTNRGEFQD  193

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            LIMW QL D AR ALN D DT     G  ++P+ DD F K+L+++W
Sbjct  194  LIMWGQLTDAARAALN-DQDT----FGRTEVPISDDHFPKRLEEAW  234

>PITG_22981
Length=259

 Score = 177 bits (450),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 129/225 (57%), Gaps = 12/225 (5%)

Query  29   HDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDC  88
            HD VQPFAQP   T ++K AVKFKP L    GC+PYP V A G T  GL+ T     G+C
Sbjct  22   HDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSD-GEC  80

Query  89   TDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDN  148
            T  PLGSQ+Y+RST Y + WAIMY WYFPK  +  G I  G RH+W  +VVW+DNP L  
Sbjct  81   TGSPLGSQVYSRSTLYENKWAIMYAWYFPKDMQDIGLIKKGVRHDWVNLVVWLDNPTLAK  140

Query  149  STILGVSMSA-SIGYSKRAPPK-SKYIDGTSVKVSYFYSIVFG-NTALELTEDAGETQDL  205
             TIL  S S     Y    PPK S  I+GT+ KV Y      G +T  +  E+ GE QDL
Sbjct  141  PTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFLEE-GEYQDL  199

Query  206  IMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
            I W QL D AR+AL NTD+         A +P  D  F   LK +
Sbjct  200  IQWTQLTDAAREALENTDFGDF------ANVPFNDAYFETNLKAA  238

>PHYCA_544885
Length=256

 Score = 177 bits (448),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 144/251 (57%), Gaps = 39/251 (16%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLD-GCYPYPAVQADGSTSGGLRWTVVGQ  84
            ++ HDQ++PF QP  +TVS+KAA+KFKPQL T    C P+PAV A G  +GGL+ T  G 
Sbjct  21   TVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKIVCVPFPAVNAAGEVTGGLKGTN-GN  79

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKG-----SETSGGIGLGHRHNWEFVVV  139
             G C   P G+QIY R+ WY+D+WAIMY+WYFPKG     S T        RH+W+ VVV
Sbjct  80   DG-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDSPT-------RRHDWKNVVV  131

Query  140  WIDNPALDNSTILGVSMSAS---------------IGY--SKRAPPKSKYI-DGTSVKVS  181
            WIDNP L+   I+GV+MS S               +GY    R   + +Y+   TS++  
Sbjct  132  WIDNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYLGSNTSLRFE  191

Query  182  YFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDV  241
            Y  S + GN  +      GE QDLIMW+QL D AR ALN        + G A++P  D+ 
Sbjct  192  YDTSDI-GNPLMHFAAWDGEYQDLIMWEQLTDAARVALNDG-----KSFGKAEVPFNDEH  245

Query  242  FTKKLKKSWPF  252
            +   L K+WPF
Sbjct  246  YEDHLGKAWPF  256

>HYAP_06628
Length=245

 Score = 176 bits (447),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 131/230 (57%), Gaps = 11/230 (5%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T  IPH +V+ FAQP  +T+S+KAAV+  P L    GC PYPAV   G TSGGL+ T   
Sbjct  26   TERIPHHEVKAFAQPEPVTISEKAAVRLNPTLLVTYGCQPYPAVNEFGQTSGGLKPT-GD  84

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
              G C     GSQ+YARS W+ D WAIM+ +YFPK S+    + +  RH+WEF VVWI N
Sbjct  85   HNGHCKGSGHGSQVYARSAWFGDKWAIMFAYYFPK-SQPRRSVSV--RHSWEFAVVWIAN  141

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTE-DAGET  202
            P     T+   + S + GY K     +  +DG  VK+ Y +     +  LELT  D G T
Sbjct  142  PEAPEKTLALTTRSFAYGYFKYTSFDASEMDGERVKLRY-WQHADSDLYLELTSLDGGVT  200

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            + LIMW+QLP+ AR ALN       WN G  + PL D+ F   L  SWPF
Sbjct  201  RPLIMWEQLPEKARCALN----EATWN-GGFKCPLSDEAFEPLLNASWPF  245

>HYAP_05559
Length=262

 Score = 177 bits (448),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 133/226 (59%), Gaps = 11/226 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            N  PHDQ+QP+AQP   TV++KAA ++KP L +  GCYPYPAV A+G T+GGL+ T  G 
Sbjct  26   NRAPHDQIQPYAQPEETTVTEKAAARYKPSLHSSHGCYPYPAVDAEGRTNGGLKAT-GGS  84

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
            R  C  P +G Q+YAR  W  + + I++ WYFPK S      G+GHRH+WE+  +W++NP
Sbjct  85   RSKCGQPYMGGQVYARGKWCDEQFGIIFAWYFPKDSVRD---GVGHRHDWEWATIWLNNP  141

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
              + S ILGV+   S    +    K +  +G +VK+ Y          + L+ + GE Q 
Sbjct  142  EANVSEILGVTTIGSGKPKRTNKLKRENRNGDTVKLDYRDH--GRRHYIALSGNDGELQP  199

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            LIMWDQ+ + +R ALN    T  WN  +  MPL D VF   L  ++
Sbjct  200  LIMWDQMTEASRCALN----TVGWNK-HRLMPLADTVFDNNLATAY  240

>PHYSO_526541
Length=239

 Score = 176 bits (445),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 136/232 (59%), Gaps = 19/232 (8%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HD+VQPFAQP   TVS+KAAVKFKP L+ +DGC+PYPAV A G TSGGL+ T     
Sbjct  21   TIDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGP-VD  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GHRHNWEFVVVWIDNP  144
            G C    LGSQ+Y RS WY+D+WAIMY+WYFPK       +G  G RH W   VVW+DNP
Sbjct  80   GKCKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDKH----LGYKGQRHKWVDAVVWLDNP  135

Query  145  ALDNSTILG-VSMSASIGYSKRAPPKSKYIDGTSVKVSY--FY-SIVFGNTALELTEDAG  200
            A +   +L  V      G   +A   +++++ T+  +SY  FY    F    +  T   G
Sbjct  136  AFETPKVLANVPQRCEHGSCGKA--FAEFMNNTTPMISYRPFYMETSFHTLEMTSTRGTG  193

Query  201  ETQDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            E QDLIMW+QL   AR AL+ TD+         A++P  D  F   L+ + P
Sbjct  194  ELQDLIMWEQLSPEARTALSETDFGEA------AKVPFIDANFETNLELARP  239

>PHALS_14423
Length=379

 Score = 180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 135/234 (58%), Gaps = 15/234 (6%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            N +  ++VQPF Q    T SQK+A+K++P+L  L  CYPYPAVQADGS S GL W +  Q
Sbjct  155  NFVNVNEVQPFKQRKPTTDSQKSAIKYQPRLYVLGACYPYPAVQADGSLSEGLPWKIFFQ  214

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
               C   P GSQIY+RS WYR  WAIMY WY P+  + +     GH H W FVVVW D+P
Sbjct  215  -SRCNGSPRGSQIYSRSDWYRGKWAIMYAWYLPRALDQNIWDVDGHSHFWTFVVVWTDSP  273

Query  145  ALDNSTILGVSMSASIGYSKR-APPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGET  202
              D STIL  S S      K+ +P KSKY ++  S+KV    +  +  T L+LTE  GE 
Sbjct  274  DPDVSTILAASTSGVGNRIKKYSPLKSKYLLNHKSLKVKLHENHFWDKTGLKLTEKVGEL  333

Query  203  QDLIMWDQLPDVARDALN----TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            Q LI W+QL D AR AL+    +DW          + P++D  F   L  ++PF
Sbjct  334  QTLITWEQLTDEARAALSSVHYSDW--------RMESPIQDKWFRPMLSSAYPF  379

>PHALS_13512
Length=243

 Score = 176 bits (445),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 132/225 (59%), Gaps = 15/225 (7%)

Query  34   PFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCTDPPL  93
            PF QP   T SQK+A+K++P+L  +  CYPYPAVQA+GS S GL W V      C   P 
Sbjct  28   PFKQPTPTTDSQKSAIKYQPRLYVVSDCYPYPAVQANGSLSYGLPWEVFAP-TKCNGSPY  86

Query  94   GSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNSTILG  153
            GSQIY+RS WYR +WAIMY WY P+  + S  +  GHRH W FVVVW ++P  + STIL 
Sbjct  87   GSQIYSRSDWYRGMWAIMYAWYLPRALDHSSWLVDGHRHFWTFVVVWTNSPDPNVSTILA  146

Query  154  VSMSASIGYSKR-APPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQL  211
             S S +    K+  P KSKY +D  ++KV  + +     T L+LT+  G+ Q LI W+QL
Sbjct  147  ASTSGTDNRIKKYLPVKSKYLLDRRTLKVKLYQNYWLDKTGLKLTDKVGDLQPLITWEQL  206

Query  212  PDVARDALNT----DWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             D AR AL++    DW          + P++D  F   L  ++PF
Sbjct  207  TDEARAALSSFHYPDW--------RMETPIQDKWFRYMLSSAYPF  243

>PHYKE_5655
Length=243

 Score = 176 bits (445),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 137/229 (60%), Gaps = 10/229 (4%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+VQPF QP+ +TVS+K AVKFKP L+   GC+ YPAV A    SGGL+ T     G
Sbjct  22   IGHDKVQPFPQPDPVTVSEKTAVKFKPSLRIDSGCHSYPAVNAACEISGGLKGT-GSDDG  80

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DCT   LGSQ+Y R+ WY D+WAIMY+WYFPK    +     G RH+W  VVVW+++PA 
Sbjct  81   DCTGSSLGSQVYGRAVWYNDLWAIMYSWYFPKDMPVA-IFKKGRRHDWVNVVVWLNDPAA  139

Query  147  DNSTILG-VSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIV-FGNTALELTED-AGETQ  203
            +   +LG    S    YSK  PP    ++G S  ++Y  +    G   ++ T +  GE Q
Sbjct  140  EKPIMLGVSPSSYVSSYSKYTPPPVDGLNGMSCMINYLSNPYDHGYHTVDTTRNRGGEFQ  199

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            DL+MW+QL D AR +LN   +T       AQ+P  D+ F   L+K+WP+
Sbjct  200  DLVMWEQLTDAARISLN---ETAFGE--TAQVPFIDENFVANLEKAWPY  243

>HYAP_05558
Length=262

 Score = 176 bits (445),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 134/226 (59%), Gaps = 11/226 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            N  PHDQ++P+AQP   TV++KAA ++KP L +  GCYPYPAV A+G T+GGL+ T  G 
Sbjct  26   NRAPHDQIKPYAQPEETTVTEKAAARYKPSLHSSHGCYPYPAVDAEGRTNGGLKAT-GGS  84

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
            R  C  P +G Q+YAR  W+ + + I++ WYFPK S      G+GHRH+WE+  +W++NP
Sbjct  85   RSKCGQPYMGGQVYARGKWWDEQFGIIFAWYFPKDSVRD---GVGHRHDWEWATIWLNNP  141

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
              + S ILGV+   S    +    K +  +G +VK+ Y          + L+ + GE Q 
Sbjct  142  EANVSEILGVTTIGSGKPKRTNKLKRENRNGDTVKLDYRDH--GRRHYIALSGNDGELQP  199

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            LIMWDQ+ + +R ALN    T  WN  +  MPL D VF   L  ++
Sbjct  200  LIMWDQMTEASRCALN----TVGWNK-HRLMPLADTVFDNNLATAY  240

>PHYSO_254223
Length=227

 Score = 174 bits (442),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 123/226 (54%), Gaps = 29/226 (13%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HDQVQ F QP  +T  +K AVK+KPQL   +GC+PYPAVQAD                
Sbjct  24   IDHDQVQSFPQPEPVTDFEKFAVKYKPQLHISNGCHPYPAVQAD----------------  67

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
                      +Y+RS WYR  W IMY WYFPKG         GHRH WE VVVW+DNP  
Sbjct  68   ----------VYSRSDWYRGKWTIMYAWYFPKGRACKDDFKTGHRHFWEDVVVWVDNPNP  117

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYI-DGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            DNST+LGV M A   + K  P   KY+ DG +VK   + S+  G   + LTED GE QDL
Sbjct  118  DNSTLLGVPMYAGHRHIKVVPVDEKYLKDGKTVKFGSYKSL--GAQVVGLTEDYGEIQDL  175

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            I W+QL   AR AL+         +    +P+KD  F K L+ ++P
Sbjct  176  ITWEQLTVEARTALSEANFHVDGGVREVVVPIKDGQFEKTLESAYP  221

>HYAP_04977
Length=262

 Score = 175 bits (444),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 133/226 (59%), Gaps = 11/226 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            N  PHDQ++P+AQP   TV++KAA ++KP L +  GCYPYPAV A+G T+GGL+ T  G 
Sbjct  26   NRAPHDQIKPYAQPEETTVTEKAAARYKPSLHSSHGCYPYPAVDAEGRTNGGLKAT-GGS  84

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
            R  C  P +G Q+YAR  W  + + I++ WYFPK S      G+GHRH+WE+  +W++NP
Sbjct  85   RSKCGQPYMGGQVYARGKWCDEQFGIIFAWYFPKDSVRD---GVGHRHDWEWATIWLNNP  141

Query  145  ALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQD  204
              + S ILGV+   S    +    K +  +G +VK+ Y          + L+ + GE Q 
Sbjct  142  EANVSEILGVTTIGSGKPKRTNKLKRENRNGDTVKLDYRDH--GRRHYIALSGNDGELQP  199

Query  205  LIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            LIMWDQ+ + +R ALN    T  WN  +  MPL D VF   L  ++
Sbjct  200  LIMWDQMTEASRCALN----TVGWNK-HRLMPLADTVFDNNLATAY  240

>HYAP_07436
Length=267

 Score = 175 bits (444),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 134/229 (59%), Gaps = 12/229 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            N +PHD++QPF++    T ++KA V+FKPQ+K +DGC+ Y AV A G  SGGL+    GQ
Sbjct  46   NDLPHDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPK--GQ  103

Query  85   -RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
              G C     GSQIY RS  + + WAIMY  YFPK  +    +  G+RH +E V+VWID+
Sbjct  104  PEGKCKGSGFGSQIYGRSAPFGNKWAIMYALYFPKDMKV---LNRGYRHAFEHVIVWIDD  160

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
             AL +  IL V+   +  Y K   P  + +DG SVK+ Y   ++ G   L  +   GE Q
Sbjct  161  IALKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQ  220

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             LIMW+QL + AR AL T       N G  +MPL D  F + L+++WPF
Sbjct  221  PLIMWEQLTNEARTALET------VNWGRDKMPLGDVAFNESLEQAWPF  263

>PHYCA_123205
Length=177

 Score = 172 bits (436),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 106/161 (66%), Gaps = 8/161 (5%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+VQPF QP   T S+ +AVK+KPQL+         AVQADGS S GL+W      G
Sbjct  24   INHDKVQPFTQPEPTTNSENSAVKYKPQLRIS------TAVQADGSVSAGLKWAGWSD-G  76

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            DC    LGSQ+Y+RS WY+D WAIMY WYFPKG +       GHRH W + +VW+D+   
Sbjct  77   DCKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISKYRFGHRHYWSYAIVWMDSDVP  136

Query  147  DNSTILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSI  186
            DNSTILGVSMSA +GYSK   PKSKY +DGT+VK   + S 
Sbjct  137  DNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESYNSF  177

>HYAP_07925
Length=267

 Score = 175 bits (443),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 134/229 (59%), Gaps = 12/229 (5%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            N +PHD++QPF++    T ++KA V+FKPQ+K +DGC+ Y AV A G  SGGL+    GQ
Sbjct  46   NDLPHDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPK--GQ  103

Query  85   -RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
              G C     GSQIY RS  + + WAIMY  YFPK  +    +  G+RH +E V+VWID+
Sbjct  104  PEGKCKGSGFGSQIYGRSAPFGNKWAIMYALYFPKDMKV---LNRGYRHAFEHVIVWIDD  160

Query  144  PALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
             AL +  IL V+   +  Y K   P  + +DG SVK+ Y   ++ G   L  +   GE Q
Sbjct  161  IALKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQ  220

Query  204  DLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             LIMW+QL + AR AL T       N G  +MPL D  F + L+++WPF
Sbjct  221  PLIMWEQLTNEARTALET------VNWGRDKMPLGDVAFNESLEQAWPF  263

>PHYRA_47103
Length=226

 Score = 172 bits (435),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 126/220 (57%), Gaps = 13/220 (6%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVG  83
            T +I HD+VQPF QP ++T+++K+ VKFKPQL    GC PYPA  A G TS GL      
Sbjct  19   TAAIGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEXGCSPYPAANAAGETSEGLE---TN  75

Query  84   QRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
               DC  P LGSQ+Y R+ WY DVWAIMY WYFPKG           RH+W   VVWIDN
Sbjct  76   GAFDCIIPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTPW---WRHDWSNAVVWIDN  132

Query  144  PALDNSTILGVSMSASIG-YSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            PA +   +LG+S+S S   Y     P     +GT+  +S    +   + AL    + GE 
Sbjct  133  PAHEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLSR-NVLPMRSAALGPAVNPGEF  191

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVF  242
            QDL+MW QL D AR ALN D D    N G  ++P+ DD F
Sbjct  192  QDLVMWTQLTDAARAALN-DQD----NFGRTEVPISDDHF  226

>PHYRA_52296
Length=237

 Score = 172 bits (436),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 128/228 (56%), Gaps = 14/228 (6%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD+VQPF QP+ +T+S+KA VKFK  L   +GC  YPAV A G TSGGL+ +  G  
Sbjct  21   SIAHDEVQPFPQPDPVTISEKAGVKFKIPLNIQEGCASYPAVNAAGETSGGLKGS--GGI  78

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C    LGSQ+Y R+ WY DVWAIMY WYFPKG   S       RH+W   ++WIDNPA
Sbjct  79   SGCELSLLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDSTPW---WRHDWSNAILWIDNPA  135

Query  146  LDNSTILGVSMSAS---IGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
             +N  ILG+S+S S    G     PP           ++        +  +  T    E 
Sbjct  136  HENPKILGLSLSTSENKYGNKNTYPPAENSTXSPLSPIAVRRKCCISDLHVCGTPPP-EN  194

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSW  250
            QDLIMW QL D AR ALN D D    N G  ++P+ DD F K L+++W
Sbjct  195  QDLIMWSQLTDAARAALN-DQD----NFGRTEVPISDDHFPKHLEEAW  237

>PPTG_04799
Length=245

 Score = 172 bits (436),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 140/240 (58%), Gaps = 28/240 (12%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQL----KTLDGCYPYPAVQADGSTSGGLRWTV  81
            +I HD+++PF QP  +T+S+KAA+KFKPQL    KT+  C P+PAV A G  +GGL+   
Sbjct  21   TIDHDKIEPFPQPKPVTMSEKAAIKFKPQLFTSIKTV--CAPFPAVNAAGDVTGGLK---  75

Query  82   VGQRGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVV  139
             G  G+  C     GSQ+Y R+ W++D+WAIMY WYFPKG           RH+W+ VVV
Sbjct  76   -GTNGNDACRFARKGSQVYGRAGWHKDMWAIMYAWYFPKGFWMDFPT---RRHDWKNVVV  131

Query  140  WIDNPALDNSTILGVSMSASIGYSKRAPPKS------KYIDG-TSVKVSYFYSIVFGNTA  192
            WIDNP L++  I+ VSMS S G S     +S       + +G     + + Y    G+  
Sbjct  132  WIDNPDLESPKIVAVSMSKS-GRSYHTEDQSGGLISRSFFNGFDRTSLRFHYQTDLGSPY  190

Query  193  LELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            L      GE QDLIMW+QL D AR ALN      ++N G+A++P  D+ F   L K+WPF
Sbjct  191  LNFAWWGGEYQDLIMWEQLTDPARVALN-----DIYNFGDAEVPFSDNNFEDYLDKAWPF  245

>PHYCA_109163
Length=247

 Score = 172 bits (436),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 135/237 (57%), Gaps = 22/237 (9%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG-CYPYPAVQADGSTSGGLRWTVVGQR  85
            + HDQ++PF QP  +TVS+KAA+KFKPQL T    C P+PAV A G  +GGL+ T     
Sbjct  22   VDHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPGNLCAPFPAVNAAGEVTGGLKGT--NGN  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G C     G+Q+Y R+ WY+DVWAIMY+WYFPKG    G      RH+W+ VVVWIDNPA
Sbjct  80   GACKHATKGAQVYGRAGWYKDVWAIMYSWYFPKGFNWLGFP--TRRHDWKNVVVWIDNPA  137

Query  146  LDNSTILGVSMSAS-IGYSKRAPPKSKYIDGTSVKVS---------YFYSIVFGNTALEL  195
            L+   I+GV++S S   Y K       Y  G+ ++           +FY++    + L+ 
Sbjct  138  LETPKIVGVALSKSDTKYRKVREVWPPYFVGSEIRYDSSPASSTNIHFYNV--AGSDLDF  195

Query  196  TEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
                GE  DLIMW+QL D AR ALN          G+A++P  D+ +   L ++ P 
Sbjct  196  ARWDGEYHDLIMWEQLTDAARVALNNS-----EFFGDAEVPFSDEHYENHLDRACPL  247

>PITG_23076
Length=276

 Score = 173 bits (438),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/271 (41%), Positives = 144/271 (53%), Gaps = 57/271 (21%)

Query  25   NSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            ++I HD+VQPFAQP+ +T+S+KAAVKFKPQL    GC  +P V A G  SGGL+ T  G 
Sbjct  20   SAIDHDKVQPFAQPDPVTISEKAAVKFKPQLHIDRGCVSFPVVNAAGEISGGLKGT-KGT  78

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGH---RHNWEFVVVWI  141
             G C + PLGSQ Y+RS WY+D WAI++ WYFPK      G   G    RH W  +V+WI
Sbjct  79   DG-CRESPLGSQTYSRSAWYQDRWAIVFAWYFPK------GFAAGQPRIRHYWSSMVLWI  131

Query  142  DNPALDNSTILGVSMSASI-----------------GYSKRA--PPK-------------  169
            DNPALD  TILGVS+S  +                  Y+K+   PP              
Sbjct  132  DNPALDTPTILGVSLSQQLLKPAKFLIGLFTAELQEPYNKQTSIPPAGFVGAQATVVSQI  191

Query  170  ------SKYIDGT--SVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNT  221
                  S Y  G+  S++VS+ Y+      AL      GE  DL+ WDQL + AR ALN+
Sbjct  192  NGWSNPSNYSGGSNVSIRVSHTYTNKDDWLALTFATQDGEYHDLVTWDQLTEEARAALNS  251

Query  222  DWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
                   + G +++P  D  F + L+ SW F
Sbjct  252  A------DFGESKVPFSDQNFQRTLELSWLF  276

>PPTG_05581
Length=275

 Score = 172 bits (437),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 139/266 (52%), Gaps = 50/266 (19%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HDQVQPFAQP+ +T+S+KAAVK++PQL   DGC  +PAV A G  +GGL+ T   + 
Sbjct  21   TINHDQVQPFAQPDPVTISEKAAVKYRPQLHVKDGCASFPAVNAAGDITGGLKPT--KET  78

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C + PLGSQ+Y RS WY+D WA+M+ WYFPKG  TS       RH W  +V+W+DNPA
Sbjct  79   DGCAEAPLGSQMYGRSKWYQDRWAMMFAWYFPKGFITSQP---RIRHYWMSMVLWLDNPA  135

Query  146  LDNSTILGVSMSASIGYSKR------APPKSKYIDGTSV---------------------  178
            L+   +LG S+S  +   +R      A  K  Y   TSV                     
Sbjct  136  LETPKVLGASLSQQLLKPRRWMGFNMAGDKDPYQKFTSVPPIGFVGTQEIRQNRITRTRW  195

Query  179  ------------KVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTT  226
                        +VS      FG   L  +   G+  DLIMW+QL D AR ALN+     
Sbjct  196  NFTYEGGSNISTRVSTIMVDSFGWLPLTFSYRDGQYHDLIMWEQLTDEARAALNSA----  251

Query  227  LWNLGNAQMPLKDDVFTKKLKKSWPF  252
              + G +++P  D+ F   L  +WPF
Sbjct  252  --DFGESKVPFNDENFETSLGLAWPF  275

>PPTG_03796
Length=255

 Score = 172 bits (435),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 141/248 (57%), Gaps = 34/248 (14%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKT--LDGCYPYPAVQADGSTSGGLRWTVVG  83
            ++ HD+V+PF QP+  T+S+KAA+KFKPQL +  L+ C  +PAV A G  +GGL+    G
Sbjct  21   TVDHDKVEPFPQPDPATISEKAAIKFKPQLYSAKLEYCVSFPAVNAVGEVTGGLK----G  76

Query  84   QRGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GHRHNWEFVVVW  140
              G+  C   PLGSQIY R+ W+ D WAIMY WYFPKG      +GL   RH+W+ VVVW
Sbjct  77   TNGNDACRLAPLGSQIYGRAGWHNDRWAIMYAWYFPKGFY----MGLPTRRHDWKSVVVW  132

Query  141  IDNPALDNSTILGVSMSAS-IGYSKRAPPKSKYIDGTSVKVSYFYSI-VFG-NTALE---  194
            IDN  L+   ILGVS S S   Y +      +   G  ++   F+   VFG NT+L    
Sbjct  133  IDNAELETPKILGVSTSVSDTRYKRDLVIFPRNFAGYQLQGPRFHHTEVFGSNTSLRFKI  192

Query  195  ----------LTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTK  244
                        +  GE QDLIMW+QL D AR ALN D      N G A++P  D  + +
Sbjct  193  WPTLFVPYMGFADFDGEYQDLIMWEQLTDAARAALNDD-----NNFGRAEVPFSDTHYKE  247

Query  245  KLKKSWPF  252
             L+ +WPF
Sbjct  248  HLENAWPF  255

>PPTG_13004
Length=255

 Score = 171 bits (434),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 139/243 (57%), Gaps = 32/243 (13%)

Query  30   DQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCT  89
            D V+PFAQP  +TV +K A+KFKP L    GC  +PAV   G+ S GLR  + G  G C 
Sbjct  25   DFVKPFAQPEPVTVLEKVALKFKPTLLIDGGCVSFPAVNEAGAISSGLR-PLNGNDG-CI  82

Query  90   DPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GHRHNWEFVVVWIDNPALDN  148
              P GSQ+Y RST ++D WAIM+ WYFPKG  +    G+   RH+W  +VVWID+P  + 
Sbjct  83   KAPQGSQVYGRSTQFQDKWAIMFAWYFPKGFWS----GMPSRRHDWASMVVWIDDPDFET  138

Query  149  STILGVSMSASIG-YSKRAPPKSK----------------YIDG--TSVKVSYFYSIVFG  189
              +LGVS+S S   Y+K   P S+                Y++G  TS+++S+     FG
Sbjct  139  PKLLGVSLSKSKKRYTKATAPLSEVYFAGFQEYGRRGYKTYVNGSSTSIRISHSSGFFFG  198

Query  190  NTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKS  249
              +L+L+   G+ QDLIMW QL + AR ALN+       N G + +P  DD F   L+K+
Sbjct  199  PASLDLSTRDGDYQDLIMWKQLTEEARKALNSA------NFGKSVVPFNDDNFEDMLEKA  252

Query  250  WPF  252
            WPF
Sbjct  253  WPF  255

>PHALS_14425
Length=302

 Score = 172 bits (437),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 133/223 (60%), Gaps = 6/223 (3%)

Query  30   DQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCT  89
            D V PF +  + T SQK+A+ F+PQL   DGC+PYPAVQ++GS + GL + +  +   C 
Sbjct  84   DSVHPFPRTKARTSSQKSALMFQPQLYIEDGCHPYPAVQSNGSLNAGLEYELF-RDPTCE  142

Query  90   DPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNS  149
              PLGSQ+Y+RS+WY+  WA +YTWYFP   + +     GHRH W + +VW  +P     
Sbjct  143  GSPLGSQVYSRSSWYQMKWATIYTWYFPVAYDHASPFSTGHRHYWLWAIVWTTDPNPAEG  202

Query  150  TILGVSMSASIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMW  208
              L VSMS + G S    P  K+ ++GT+V +    S++    AL+LTE +GE +DLI W
Sbjct  203  HFLAVSMSGNFGISSYTLPHIKHLVNGTTVLLKSHKSLMSARLALDLTEKSGEKEDLITW  262

Query  209  DQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            ++L   AR AL++   T       A  PL+D+ F   L+K++P
Sbjct  263  EELTPEARAALSSVKRTE----ATANSPLQDNKFFSLLEKAYP  301

>PPTG_15220
Length=236

 Score = 171 bits (432),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 134/227 (59%), Gaps = 13/227 (6%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            + +D+V PF +    T   K A+KFKPQL   +GC+PYPAV ADG+T+ GL  T V    
Sbjct  22   LEYDEVAPFPEVLPTTTESKVALKFKPQLHISNGCHPYPAVDADGNTNAGLGITEV--LT  79

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C   PLGSQ+Y R T Y  V AIMY WYFP+    S  + +GHRH+WE  +VW+D+  L
Sbjct  80   SCKGSPLGSQVYGRVTEYEGVVAIMYAWYFPRDYMVS-PMWVGHRHDWEHAIVWLDS--L  136

Query  147  DNST-ILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            D S  +L V+    +GY    PP++K++DG+SVK+ Y + ++     L  T  AG+ QDL
Sbjct  137  DTSAELLAVTAQHLLGYKTYKPPRAKHMDGSSVKLKYTW-LIQTQHYLSATTKAGKFQDL  195

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
             MW  + D A+DAL +      W+    Q P+ D  F   ++K++PF
Sbjct  196  AMWSNMTDAAQDALGS--TKFFWS----QAPMNDAKFQSNIEKAYPF  236

>PPTG_16647
Length=254

 Score = 171 bits (433),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/245 (41%), Positives = 135/245 (55%), Gaps = 31/245 (13%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKT-LDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            + HD+V+PF QP  +T+S+KAA+KFKPQL T  + C P+P V A G  +GGL+    G  
Sbjct  22   VDHDKVEPFPQPVPVTISEKAAIKFKPQLYTPYNICVPFPGVNAVGEVTGGLK----GTN  77

Query  86   GD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
            G+  C   P GSQIY R  WY+D+WAIMY  Y PKG           RH+ + VVVWI+N
Sbjct  78   GNDACKYAPKGSQIYGRGGWYKDIWAIMYACYLPKGFWMD---LPSRRHDGKSVVVWINN  134

Query  144  PALDNSTILGVSMSAS---------------IGYSKRAPPKSK-YIDGTSVKVSYFYSIV  187
            P  +   I+GVSMS S                GY K      + YI G++  + + Y   
Sbjct  135  PGFETPKIVGVSMSKSDTKYYKETKIGPFAFAGYRKEGRRSERAYIYGSNTSLRFQYESG  194

Query  188  FGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLK  247
             G++ L   +  GE QDLIMW+QL D AR ALN        N G+A++P  D+ + + L 
Sbjct  195  LGSSYLSFADCDGEYQDLIMWEQLTDAARAALNDG-----NNFGDAEVPFSDEHYKQHLD  249

Query  248  KSWPF  252
            K+WP 
Sbjct  250  KAWPL  254

>PHYCA_109174
Length=277

 Score = 172 bits (435),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/268 (40%), Positives = 145/268 (54%), Gaps = 52/268 (19%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HD+VQPFAQP+ +TVS+KAAVK+KPQL+  D C  +PAV A G  +GGL+ T  G  
Sbjct  21   TIGHDKVQPFAQPDPVTVSEKAAVKYKPQLQISDSCVSFPAVNAAGEITGGLKGT-KGTD  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            G CT+ PLGSQ+Y RSTWY+D WA+M+ WYFPK      G G   RH W  +V+WIDNPA
Sbjct  80   G-CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPK---NFWGGGAKSRHLWANMVLWIDNPA  135

Query  146  LDNSTILGVSMSA-----------SIGYSKRAP-------PKSKYIDGTSVKVS------  181
            L+   ILG S+S            S+G  ++ P       P   ++   +++ S      
Sbjct  136  LETPKILGASLSRQTLEVPKAVFLSMGEQQKDPYSKVTAIPPMGFVGMQAIQTSRISRFR  195

Query  182  YFYSIVFGN----------------TALELTEDAGETQDLIMWDQLPDVARDALNTDWDT  225
            Y Y+   G+                 +L      GE QDLIMW+QL D AR AL +    
Sbjct  196  YTYNYTGGSDISTRVSQGYPDNSAWISLTFAGTDGEYQDLIMWNQLTDQARAALESA---  252

Query  226  TLWNLG-NAQMPLKDDVFTKKLKKSWPF  252
               + G + ++P  D  F   L ++WPF
Sbjct  253  ---DFGEDTKVPFNDKNFEAALAQAWPF  277

>PPTG_10591
Length=254

 Score = 170 bits (430),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 137/246 (56%), Gaps = 31/246 (13%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKT-LDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            +I HD+VQ F QP  +T S+K A+KFKP+L T    C PYPAV A G  SGGL+    G 
Sbjct  21   TIDHDKVQAFPQPEPVTASEKTAIKFKPRLYTPRHVCVPYPAVNAAGEVSGGLK----GT  76

Query  85   RGD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWID  142
             G+  C     GSQ+Y R+ WYRD+WAIMYTWYFPKG           RH+W+ VVVWI+
Sbjct  77   NGNDACKYSIQGSQVYGRAGWYRDLWAIMYTWYFPKGFFADFA---SKRHDWQNVVVWIN  133

Query  143  NPALDNSTILGVSMS-ASIGYSKRAPPKSKY---------------IDGTSVKVSYFYSI  186
            NP L+   I+GVSMS     Y+ +    + Y               I G++  + + Y +
Sbjct  134  NPDLEWPKIVGVSMSNVDSEYTTKLEMMAYYFSGYRMEGTRGYRRSIYGSATSLRFAYEM  193

Query  187  VFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKL  246
            +  +  L+  ++ GE Q LIMW+QL D AR ALN   D++  N    ++P  D+ +   L
Sbjct  194  ILTSPYLDFADEDGEYQSLIMWEQLTDAARAALN---DSS--NFEEREIPFSDEHYMDHL  248

Query  247  KKSWPF  252
            + +WP 
Sbjct  249  EMAWPL  254

>PITG_22709
Length=281

 Score = 171 bits (432),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 139/262 (53%), Gaps = 49/262 (19%)

Query  29   HDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDC  88
            HDQVQPFAQP   T+S+KAAVK++PQL  LDGC  +PAV A G  +GGL+ T  G  G C
Sbjct  31   HDQVQPFAQPKPATISEKAAVKYRPQLHVLDGCASFPAVNAAGDITGGLKPT-KGTDG-C  88

Query  89   TDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDN  148
            T+ PLGSQ+Y RS WY+D WA+M+ WYFPKG  T        RH W  +V+W+DNPAL+ 
Sbjct  89   TEAPLGSQMYGRSKWYQDRWAMMFAWYFPKGFITGQP---RIRHYWMNMVLWLDNPALET  145

Query  149  STILGVSMSASIGYSKR---------APPKSKYI--------------------------  173
             TILG S+S  +   +R           P  K+                           
Sbjct  146  PTILGASLSQRLLKPRRWMGLKLTEEKDPYRKFTTIPPIGFVGTKEIRQNRLTRTRWNFT  205

Query  174  -DGTSVKVSYFYSIVFGNTALELTEDA--GETQDLIMWDQLPDVARDALNTDWDTTLWNL  230
             +G S   +  ++++     L LT     G+  DLIMWDQL D AR ALN+       + 
Sbjct  206  YEGGSNISTRVFTVIDSKDWLPLTFSYYDGQYHDLIMWDQLTDEARAALNSA------DF  259

Query  231  GNAQMPLKDDVFTKKLKKSWPF  252
            G +++P  D+ F   L  +WPF
Sbjct  260  GESKVPFNDENFEALLSLAWPF  281

>PHYRA_52426
Length=152

 Score = 166 bits (420),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 106/157 (68%), Gaps = 5/157 (3%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I ++++QPFA+P   T S+KAAVKFKPQL    GCYPYPAVQADGS S GLR +     G
Sbjct  1    IDNEKIQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPAD-G  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C    LGSQ+Y+RS WY D WAIMYTWY PKG  T        RH WE  VVWID+PAL
Sbjct  60   ECRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGCPTK----YQRRHFWETAVVWIDDPAL  115

Query  147  DNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYF  183
             NSTILGVS++      +  P   +++DG+SVK++ +
Sbjct  116  ANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSY  152

>PHYRA_47241
Length=176

 Score = 166 bits (420),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 106/158 (67%), Gaps = 5/158 (3%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD+VQPFAQP  +T S+KAAV+FKP L+   GC+PYPAV A G TS GL+ T     
Sbjct  23   SIDHDKVQPFAQPEPVTDSEKAAVRFKPSLQIFSGCHPYPAVNAAGETSAGLKGTGPSS-  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
            GDC    LGSQ+YAR+ WY D+WAIMY WYFPK   T      G RH+W  VVVW+DNPA
Sbjct  82   GDCKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDKPT---FRKGERHDWVNVVVWLDNPA  138

Query  146  LDNSTILGVSMSASI-GYSKRAPPKSKYIDGTSVKVSY  182
            L+  TI+GVS S+ +  Y K  PP +  + GT+  ++Y
Sbjct  139  LERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTSMINY  176

>PITG_23051
Length=280

 Score = 169 bits (429),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 132/239 (55%), Gaps = 27/239 (11%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG-CYPYPAVQADGSTSGGLRWTVVGQR  85
            + HD+V+PF QP  +T+S+KAA+KFK QL    G C  YPAV A G   GGL     G  
Sbjct  22   VDHDKVEPFPQPEPVTISEKAAIKFKTQLVIPQGVCVSYPAVNAAGEVGGGLNDWDNGND  81

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C    LGSQ+Y R+ W++D WAIMY WYFPK   T       HRH+W+ VVVWIDNPA
Sbjct  82   A-CLSAALGSQVYGRAGWHKDRWAIMYAWYFPKDFWTGFPT---HRHDWKSVVVWIDNPA  137

Query  146  LDNSTILGVSMSAS-----------IGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALE  194
            L+   I GVSMS S             Y   AP      +G++  + + Y   FG+T + 
Sbjct  138  LEIPKIEGVSMSKSDTKYKKKLKLKESYFSGAP-----TNGSNTSLRFEYEAGFGSTFMG  192

Query  195  LTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLG-NAQMPLKDDVFTKKLKKSWPF  252
             T   GE Q+LIMW+QL D AR  LN   D    N G  A +P  D+ F  +L ++WPF
Sbjct  193  FTRWDGEYQNLIMWEQLTDAARATLN---DGN--NFGKEASVPFSDEHFEDRLDEAWPF  246

>PHYSO_504553
Length=257

 Score = 169 bits (427),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 137/244 (56%), Gaps = 27/244 (11%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ-  84
            +I HD+VQPFAQP  +TVS+K AVKFKP L  +DGC+PYPAV A G TS GL+ +  G+ 
Sbjct  23   TIDHDKVQPFAQPEPVTVSEKTAVKFKPSLHIVDGCHPYPAVNAAGETSAGLKGS--GRI  80

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             G C    LGSQ+Y R+ WY+D+WAI+Y WYFPK  +    +  G RH W   VVW+DNP
Sbjct  81   DGKCKGSALGSQVYGRAIWYKDLWAIVYGWYFPK--DKVDFLNKGQRHKWVSAVVWLDNP  138

Query  145  ALDNSTILGVSM-SASIGYS--KRAPPKS----------KYIDGTSVKVSYFYSIVFGNT  191
            A++   IL +S  +   GY   K  PP+           +YI+ T+  +SY  S+     
Sbjct  139  AVETPKILAISTWNVKGGYDILKNEPPECYRYGCDPKFVEYINMTTPMLSYVRSLEEPVH  198

Query  192  ALELT--EDAGETQDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKK  248
             L  T     GE QDL+MW+QL + AR AL   D+         + +P  D      L+ 
Sbjct  199  TLRPTTARGTGELQDLVMWEQLSEEARIALGEADFGE------KSPVPFIDTNLNANLEA  252

Query  249  SWPF  252
            + PF
Sbjct  253  ARPF  256

>PPTG_06202
Length=275

 Score = 169 bits (428),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 138/267 (52%), Gaps = 52/267 (19%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HD+VQPFAQP  +T+++KAAV FKPQL    GC  +PAV A G  SGG++ T     
Sbjct  21   TIDHDKVQPFAQPVPVTIAEKAAVMFKPQLHISQGCVSFPAVNAAGEISGGVKGT--KNT  78

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              CT+ PLGSQ+Y R+ WY+D WA+++ WYFPK   +   +    RH W  +V+W+DNPA
Sbjct  79   EGCTEAPLGSQVYGRAKWYQDKWAMVFAWYFPKSFWSFEAV---DRHYWASMVLWLDNPA  135

Query  146  LDNSTILGVSMSASIGYSKRA-------PPKSKYIDGTSV--------------------  178
            L    I+G S+   +   KR         P+  Y   TS+                    
Sbjct  136  LSAPKIIGASLQQQL-LKKRGFLGFMFTEPREPYFKQTSIDIMSYVGAQRIRLNPIGYRR  194

Query  179  -------------KVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDT  225
                         +V++ Y   F   AL  +E  G+ QDLIMW+QL D AR ALN+    
Sbjct  195  WSYNFTPGSNVSTRVTHTYWNSFEYLALHFSETDGQFQDLIMWEQLTDEARSALNSA---  251

Query  226  TLWNLGNAQMPLKDDVFTKKLKKSWPF  252
               + G +++P  D+   + L+ +WPF
Sbjct  252  ---DFGESKVPFNDENIEETLELAWPF  275

>PHYSO_255972
Length=215

 Score = 167 bits (422),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 126/229 (55%), Gaps = 37/229 (16%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            +I HD+VQPFAQP   TVS+KAAVKFKP L+ +DGC+PYPAV A G TSGGL+ T     
Sbjct  21   TIDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGP-VD  79

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GHRHNWEFVVVWIDNP  144
            G C    LGSQ+Y RS WY+D+WAIMY+WYFPK       +G  G RH W   VVW+DNP
Sbjct  80   GKCKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDKH----LGYKGQRHKWVDAVVWLDNP  135

Query  145  ALDNSTILGVSM-SASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQ  203
            A +   +L VS  S   GY+                        F    +  T   GE Q
Sbjct  136  AFETPKVLAVSTWSWGGGYTS-----------------------FHTLEMTSTRGTGELQ  172

Query  204  DLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWP  251
            DLIMW+QL   AR AL+ TD+         A++P  D  F   L+ + P
Sbjct  173  DLIMWEQLSPEARTALSETDFGEA------AKVPFIDANFETNLELARP  215

>PHYSO_365942
Length=233

 Score = 167 bits (424),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 124/213 (58%), Gaps = 25/213 (12%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+VQPFAQP  +TVS+K AVKFKP L+ + GC+PYPAV A G TS GL+     + G
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIVGGCHPYPAVNAAGETSAGLKGRGP-KDG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C    LGSQ+Y R+ WY+D+WAI+Y WYFPK       +  G RH W   VVW+DNPAL
Sbjct  60   ECKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDKGYGSILAKGQRHKWVSAVVWLDNPAL  119

Query  147  DNSTILGVSM-SASIGYS--KRAPPK----------SKYIDGTSVKVSY-------FYSI  186
            +   IL +S  +   GY   K  PP+          ++YI+ T+  +SY        Y  
Sbjct  120  ETPKILAISTWNVEGGYDILKNEPPQCYRYSCDAKFAEYINMTTPMLSYERCRPEPSYHT  179

Query  187  VFGNTALELTEDAGETQDLIMWDQLPDVARDAL  219
            +   TA       GE QDL+MW+QL + AR AL
Sbjct  180  LRPTTA----RGTGELQDLVMWEQLSEEARIAL  208

>PHYSO_423056
Length=233

 Score = 167 bits (423),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 121/210 (58%), Gaps = 17/210 (8%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I HD+VQPFAQP  +TVS+K AVKFKP L+   GC+PYPAV A G TS GL+ +     G
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIDGGCHPYPAVNAAGETSAGLKGSGP-DDG  59

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
             C    LGSQ+Y R+ WY+D+WAI+Y WYFPK     G +  G RH W   VVW+DNPA+
Sbjct  60   KCKGSGLGSQVYGRAIWYKDLWAIVYGWYFPKDKGFGGILAKGQRHKWVSAVVWLDNPAV  119

Query  147  DNSTILGVSM-SASIGYS--KRAPPK----------SKYIDGTSVKVS---YFYSIVFGN  190
            +   IL +S  +   GY   K  PP+          ++YI+ T+  +S   YF    F  
Sbjct  120  ETPKILAISTWNLEGGYVILKNEPPECSRHGCDPKFAEYINMTTPMLSYEPYFQRDSFHT  179

Query  191  TALELTEDAGETQDLIMWDQLPDVARDALN  220
                     GE QDL+MW+QL + AR AL 
Sbjct  180  LRPTTARGTGELQDLVMWEQLSEEARIALG  209

>PHYCA_109162
Length=257

 Score = 168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/245 (41%), Positives = 136/245 (56%), Gaps = 28/245 (11%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDG-CYPYPAVQADGSTSGGLRWTVVGQR  85
            + HD+++PF QP  +TVS+KAA+KFKPQL T    C P+PAV A G  +GGL     G  
Sbjct  22   VDHDKIEPFPQPEPVTVSEKAAIKFKPQLYTHKQLCAPFPAVNAAGEVTGGLS----GAN  77

Query  86   GD--CTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDN  143
            G+  C     G+Q+Y R+ WY+DVWAIMY+WYFPKG    G      RH+W+ VVVWIDN
Sbjct  78   GNDACKYALKGAQVYGRAGWYKDVWAIMYSWYFPKGFNWLGFP--TRRHDWKNVVVWIDN  135

Query  144  PALDNSTILGVSMSAS-IGYSKRAPPKSKYIDGTSVKVSYFY-------------SIVF-  188
            P L+   I+GV+M+ S   Y +     +    G+ V+V+                ++ F 
Sbjct  136  PELETPKIIGVAMAGSDTKYRREREMYNSNFVGSQVQVTRRDRRYYRSDSPGSSTNLRFE  195

Query  189  -GNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLK  247
             G T L+     G+ QDLIMW+QL D AR ALN   D   +    A++P  D+ F     
Sbjct  196  NGATHLDFARQDGDYQDLIMWEQLTDAARIALN---DNGSFGYSYAEVPFSDEHFEANRD  252

Query  248  KSWPF  252
            K+WP 
Sbjct  253  KAWPL  257

>PHYSO_251206
Length=243

 Score = 167 bits (422),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 131/236 (56%), Gaps = 21/236 (9%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            SI HD+VQPFAQ   +T+S+K  VK+KP +   +GC  +PAV A G T+GGL+ +  G  
Sbjct  20   SIDHDKVQPFAQREPVTLSEKLGVKYKPTMDDQEGCAVFPAVNAAGETNGGLKGS--GGT  77

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
              C + PLG+Q+Y RS WY   +AI+Y WYFP G      +    RH+W   VVW+D+P 
Sbjct  78   TGCREAPLGAQVYGRSMWYEGKYAILYAWYFPNGFSADWPV---RRHDWASAVVWLDDPE  134

Query  146  LDNSTILGVSMSAS-IGYSKRAPPKSKYIDGTSVKVSYFYSIV--------FGNTALELT  196
              + T+ G+S S S   Y K APP        SV    + ++V         G   L  +
Sbjct  135  AASPTVSGLSYSTSDTKYDKEAPPSGDNACLASVNGGPYVTMVLEHAIPYFLGPMYLRCS  194

Query  197  EDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
               G+  DLIMW+QL D AR ALNT       + G A++P  D  F K+LKK+WP+
Sbjct  195  GGGGD-YDLIMWEQLTDAARMALNTA------DFGEAEVPFNDVNFEKRLKKAWPY  243

>PHYCA_69122
Length=249

 Score = 167 bits (422),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 140/249 (56%), Gaps = 39/249 (16%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLD-GCYPYPAVQADGSTSGGLRWTVVGQ  84
            ++ HDQ++PF QP  +TVS+KAA+KFKPQL T    C P+PAV   G  +GGL+ T  G 
Sbjct  16   TVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKLVCVPFPAVNTAGEITGGLKGTN-GN  74

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKG-----SETSGGIGLGHRHNWEFVVV  139
             G C   P G+QIY R+ WY+D+WAIMY+WYFPKG     S T        RH+W+ +VV
Sbjct  75   DG-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDSPT-------RRHDWKNIVV  126

Query  140  WIDNPALDNSTILGVSMSAS---------------IGY--SKRAPPKSKYI-DGTSVKVS  181
            WIDNP L+   I+GV+MS S               +GY    R   + +Y+   TS++  
Sbjct  127  WIDNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYLGSNTSLRFE  186

Query  182  YFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDV  241
            Y  S + GN  +      GE QDLIMW+QL D AR ALN        +   A++P  D+ 
Sbjct  187  YDTSDI-GNPLMHFAAWDGEYQDLIMWEQLTDAARVALNDG-----KSFEKAEVPFSDEH  240

Query  242  FTKKLKKSW  250
            +   L K+W
Sbjct  241  YEDHLGKAW  249

>PHYSO_365377
Length=220

 Score = 166 bits (419),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 134/231 (58%), Gaps = 18/231 (8%)

Query  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86
            I +DQV+PF +    T+S+KAA+KFKP L   DGC+PY AV A G TSGGL         
Sbjct  1    IDYDQVEPFPELGPKTISEKAAIKFKPTLFIKDGCHPYAAVNAAGDTSGGL--DPKASDD  58

Query  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPAL  146
            +C    LGSQ+Y+RSTWYR+ WA MY WYFPK +        G RH+W   +VW+DNPAL
Sbjct  59   ECKGSTLGSQVYSRSTWYRNTWATMYAWYFPKDTNL---YLRGVRHDWVSAIVWLDNPAL  115

Query  147  DNSTILGVSMS---ASIG--YSKRAPPKSKYIDGTSVKVSYFYS-IVFGNTALELTEDAG  200
             N T++GVS S   AS G  +  R+     Y+DGT  K+ Y  +    G   ++ +ED G
Sbjct  116  ANQTLIGVSFSSGGASYGGFHLDRSRMWDGYVDGTHPKMEYSAADTRSGYHTIDASEDVG  175

Query  201  ETQDLIMWDQLPDVARDALNTDWDTTLWNLG-NAQMPLKDDVFTKKLKKSW  250
            + QDLI W QL + AR+AL T       + G +  +P  +  F K L++ +
Sbjct  176  DFQDLIHWSQLTEEARNALETG------DFGSDTPVPFNNANFKKNLERGF  220

>HYAP_14846
Length=221

 Score = 166 bits (419),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 127/230 (55%), Gaps = 17/230 (7%)

Query  26   SIPHDQVQPFAQP-NSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQ  84
            SI HDQVQPF Q     + +  AA+KFKPQL    GC+ YPAV   G  SGGL+ T    
Sbjct  3    SIKHDQVQPFQQVVGDDSPTAVAALKFKPQLHISSGCHSYPAVNTVGEFSGGLKPTG-HD  61

Query  85   RGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNP  144
             G C     GSQ+Y RS W++D WAIMY WYFPK +          RH+WE +VVW+DNP
Sbjct  62   NGKCKGSGYGSQVYGRSAWHQDKWAIMYVWYFPKDNRDDD------RHDWEHIVVWLDNP  115

Query  145  ALDNSTILGVSM--SASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202
            A+ N  +L VS+       Y   A P   ++DG+SVK+ Y  +     T L LT  AGE 
Sbjct  116  AVANQKLLAVSLWNGRKSDYWTLAIPGPVFVDGSSVKLDYGKANKDERT-LSLTHLAGEF  174

Query  203  QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            Q LIMW Q+ + AR   N    T LW      MPL D  F + LKK++ F
Sbjct  175  QPLIMWGQMSEKARTTFN----TVLWR--KEFMPLSDSCFEQHLKKAYDF  218

>PPTG_05868
Length=257

 Score = 166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 136/249 (55%), Gaps = 29/249 (12%)

Query  24   TNSIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLD-----GCYPYPAVQADGSTSGGLR  78
            T ++ HD+++PF QP  +T+S+KAA+KFKPQL +        C PYPAV A G  +GGL+
Sbjct  18   TATVDHDKIEPFPQPEQVTISEKAAIKFKPQLGSTKIVSEKVCVPYPAVNAAGEVTGGLK  77

Query  79   WT-------VVGQRGDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-GH  130
             T       ++     C   P GSQ+Y R+ W++D+WAIMYTWYFPKG      +G    
Sbjct  78   ETNGKYTVGLIIHIAACKYAPKGSQVYGRARWHKDLWAIMYTWYFPKGF----WMGFPTR  133

Query  131  RHNWEFVVVWIDNPALDNSTILGVSMSAS-IGYSK--RAPPKSKYIDGTSVKVSYFYSIV  187
            RH+W+ VVVWIDNP+L+   I+GVSMS S   Y+K  R  P +  +       S+   I 
Sbjct  134  RHDWKSVVVWIDNPSLEEPKIVGVSMSESDTKYNKETRIWPSNFVVTEMEGSRSHRTYIN  193

Query  188  FGNTALELTEDAGET----QDLIMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFT  243
              NT+         +    QDLI W+QL D AR ALN +        G A++P  D  + 
Sbjct  194  GSNTSFRFQNQMPMSLKLAQDLITWEQLTDAARVALNDN-----AKFGTAEVPFSDTHYE  248

Query  244  KKLKKSWPF  252
              L  +WP 
Sbjct  249  DHLDNAWPL  257

>PHYCA_114913
Length=224

 Score = 164 bits (416),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 125/227 (55%), Gaps = 22/227 (10%)

Query  26   SIPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQR  85
            ++P D+V+PF +    T+SQKAAV+ KPQL    GC+PY AV A G  + G+  T   + 
Sbjct  17   ALPFDKVEPFPELEPTTISQKAAVRLKPQLHISKGCHPYAAVNAAGEITAGITTT---RD  73

Query  86   GDCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPA  145
             DC+   +GSQ+Y RSTWY+DVWAIMY WYFP              H+W+ +VVWIDNP+
Sbjct  74   PDCSGRGIGSQVYVRSTWYKDVWAIMYAWYFPS----------SLIHDWKNIVVWIDNPS  123

Query  146  LDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDL  205
            L    +LGVS     GY +         DG S K+ Y Y        L+ T   GE Q+L
Sbjct  124  LAVPRVLGVSAQVDGGYLRYNKFNWDKFDGASPKIKYDYP------DLDWTSKRGEFQNL  177

Query  206  IMWDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252
            IMWDQL + AR ALN   +T     G+A +P  D  F   L  + P+
Sbjct  178  IMWDQLTEAARTALN---NTNFKGNGDATVPFIDANFKANLDFAIPY  221

Lambda      K        H        a         alpha
   0.320    0.135    0.444    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13924837920

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40