Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_811021475425125112533e-176
PHYRA_725046951625125112533e-176
PHYCA_1294851475425125110485e-145
PPTG_171251475428323010412e-143
PITG_18453147542522309652e-132
PHYRA_7182580282542307934e-106
PHYRA_81103712622522317804e-104
PITG_0971680282502307413e-98
PPTG_0889380282512307264e-96
PPTG_16851236932492307152e-94
PHYCA_12149480282482307125e-94
PHYSO_26126580282472317119e-94
PHYCA_10034368662742307087e-93
PHYKE_6286599492502317005e-92
PPTG_17049237772552346728e-88
PHYSO_254108170262462306682e-87
PHYCA_118548170262462306535e-85
PITG_22053170262452306465e-84
PPTG_07664170262452306466e-84
PITG_04208205112452306432e-83
PITG_19936157132492316414e-83
PHYRA_74356698952442306353e-82
PHYCA_118674205112812316358e-82
PITG_19938353892452286311e-81
PHYRA_74306205112452306301e-81
PHYCA_9298368522482316284e-81
PHYRA_52440170262432286196e-80
PPTG_19331246513682306263e-79
PHYSO_526774157132492316075e-78
PPTG_0767136902462306051e-77
PHYCA_132252157132492316051e-77
PHYCA_11855136902452306041e-77
PHYSO_526832353892492306041e-77
PHYSO_249692459152482306041e-77
PHYRA_72386459152452306032e-77
PHYRA_72344817002452306032e-77
PHYCA_122048693172362306013e-77
PHYSO_526623599492492316014e-77
PITG_0424836902452306014e-77
PHYRA_71404563202452305981e-76
PHYRA_72433694822452305971e-76
PHYRA_76249246513262306033e-76
PHYCA_129784817002462305953e-76
PHYSO_329843510942392305935e-76
PHYRA_74307422182492335936e-76
PHYCA_107869246513422306017e-76
PHYKE_2376459153222305981e-75
PHYRA_74343698872492315911e-75
PPTG_17409743732352305882e-75
PHYSO_507736135312362495882e-75
PHYRA_71477693172382305892e-75
PHYCA_108039563202152305862e-75
PPTG_15230817002522305893e-75
PITG_0420036612472315874e-75
PHYRA_4287689222132285829e-75
PHYCA_11951135312342275822e-74
PITG_0426737012792325862e-74
PHYCA_123779173642772305844e-74
PHYRA_71308231122362495781e-73
PHYRA_74310599492492315781e-73
PHYRA_72438135312362495762e-73
PHYSO_52607137012492335754e-73
PHYSO_51088870892552305746e-73
PPTG_15224963762462305729e-73
PHYKE_5753763302382295666e-72
PHYKE_4438758943392345756e-72
PPTG_15233231122352285641e-71
PPTG_06973368661651665571e-71
PPTG_08017207076162305912e-71
PPTG_17245238632572375624e-71
PHYSO_468315563202552305616e-71
PHYSO_406265173642322305587e-71
PHYCA_9358368552522365591e-70
PPTG_07089202542552305581e-70
PPTG_19330563203162305632e-70
PHYRA_71618578972432355572e-70
PITG_22668173645192305792e-70
PHYRA_71931510942392285553e-70
PYVX_22467135312362495543e-70
PHYSO_414520550602132285524e-70
PHYKE_494670892632305555e-70
PHYRA_72345517562402515502e-69
PPTG_12847511263312305582e-69
PPTG_1285370893422305582e-69
PYU1_G011231459142382285483e-69
PHYRA_5242336901932015417e-69
PYU1_G011237817002352285458e-69
PPTG_08005173647592305818e-69
PHYRA_74617699543372305531e-68
PHYCA_10840970892822305481e-68
PHYSO_397673703072242305422e-68
PPTG_18464243182472335442e-68
PYIR_13251817002362285422e-68
PPTG_12852223223312305502e-68
PPTG_13769592663492305513e-68
PHYCA_18373353892462115415e-68
PPTG_0766037012162195386e-68
PHYRA_5432770892192285386e-68
PHYCA_69480391942132285377e-68
PHALS_06162173644882285597e-68
PPTG_07277203402982305449e-68
PHYCA_11835636612522315372e-67
PHYSO_25411236902242285342e-67
PHYSO_527352600202452305363e-67
PHYSO_259736247322312305334e-67
PHYRA_46230550602122275299e-67
PHYSO_249751459202382505311e-66
PHYKE_7564459204732305501e-66
PPTG_13736226162362515311e-66
HYAP_0924370892662295331e-66
PHYCA_69477391922132285282e-66
PHYCA_119748423082612345322e-66
PHYSO_334487517562582515312e-66
PHYRA_72475695022432355302e-66
PHYRA_72165599392402345292e-66
PYIR_13252817012362495283e-66
PYU1_G011235963762382285283e-66
PHYRA_74630202543432305365e-66
PITG_0852270893822315386e-66
PHYRA_71588693332422335251e-65
PYU1_G011233694602392285241e-65
PPTG_07661600202232255213e-65
PHYKE_5655578972432355223e-65
PHYRA_49009690712162335186e-65
PHYSO_334498517572292185171e-64
PPTG_19506247322232255161e-64
PYU1_G011230817012382285111e-63
PHYKE_7566459142602285104e-63
PHYRA_86968733682392325075e-63
PHYRA_43347688002202055065e-63
PHYCA_69479391932132285038e-63
PPTG_15231135312582205079e-63
PHYCA_683589222102125002e-62
PHYRA_52960691982232285003e-62
PHYRA_52955691972232285003e-62
PYU1_G011236135312372285005e-62
PYIW_25259817002462295015e-62
PITG_22734422181681534945e-62
PHALS_0608470892602305017e-62
PHYRA_83592763302372304971e-61
PHYSO_329114510052362024972e-61
PYIR_13275135312372204972e-61
PHYKE_4541759501471474882e-61
PHYRA_41766511262092274932e-61
PPTG_2217436987712315292e-61
PHYSO_496064578972542464973e-61
PHYRA_45457517571991964913e-61
PHYRA_39489686262372304945e-61
PHYRA_72390592662372304902e-60
PHYRA_72477695042382314892e-60
PITG_22916720282482304902e-60
PHYCA_69457511262132284855e-60
PHYSO_526541599392392324875e-60
PHYSO_336498177692382534859e-60
PITG_16866135312382214823e-59
PPTG_004608462592254826e-59
PHYRA_44405688542322294788e-59
PHYSO_490000575402412324781e-58
HYAP_06628642572452314772e-58
PHYSO_330015511262412294762e-58
PPTG_17295238912382534762e-58
PHYSO_255972205112152294733e-58
PHYRA_84273720242372314744e-58
PITG_23228177692542474746e-58
PPTG_07991207012762334767e-58
PHYKE_7568608783722494838e-58
HYAP_08306563202862324768e-58
PHYRA_84277720282402334692e-57
PHYRA_76657703212392324693e-57
PHYCA_132529435382322354683e-57
PPTG_14652229162572294704e-57
PHYRA_72385694602372494684e-57
PHYSO_254223422182272304674e-57
PHYRA_71307608782372414668e-57
PPTG_17453177692542474661e-56
PHYCA_123797207012412334633e-56
PPTG_11469451342532474624e-56
PHYCA_12462369161771614564e-56
PHYSO_423056554102332194614e-56
PHYRA_83851719182392344605e-56
PHYSO_365942537682332234606e-56
PPTG_04799194622452414608e-56
PITG_23211177602452274609e-56
PHYRA_71310459142372494599e-56
PPTG_15234608782352204581e-55
PHYRA_72531695292362304571e-55
PHYRA_52260691692342494572e-55
PHYSO_52785036611951764532e-55
PHYCA_544885451342562694592e-55
PHYCA_123205425681771614512e-55
PHYSO_504553689972572214573e-55
PPTG_08703209012542474564e-55
PITG_23051176512802444576e-55
PITG_22981175962592284557e-55
PHYRA_72403694692392334537e-55
PITG_23076176682762704568e-55
PHYKE_208743731871724471e-54
PPTG_13026694282382314502e-54
PHYRA_52426600201521604432e-54
PHYRA_75425176762372284492e-54
PHYCA_576423176762342284492e-54
PPTG_00471720282392244493e-54
PHYSO_560790608782372444493e-54
PHYSO_254099368522352284483e-54
PHYSO_516261592662272314474e-54
PHYSO_482931571392542474494e-54
PHYRA_76603703072392324485e-54
PYVX_22469517584742514637e-54
PHYRA_72541695342392324468e-54
PHYCA_124462426702802754499e-54
PITG_009578462982294473e-53
PHYRA_47241690031761604373e-53
HYAP_07436646842672304444e-53
HYAP_07925649412672304435e-53
PHALS_12600147542672314435e-53
PHYSO_480321570042542474416e-53
PHYCA_129892608782342284371e-52
PHYSO_253029461762522324382e-52
PHYCA_109163413312472414382e-52
PHYCA_109162413302572474382e-52
PPTG_13004176512552494382e-52
HYAP_14846685472212374352e-52
PHYSO_328418509152192134342e-52
PHYKE_8391147537781444653e-52
PHYCA_69122177692492464364e-52
PHYSO_521124595742542424364e-52
PHALS_13513157132402364345e-52
PPTG_16647236412542474356e-52
PHYCA_114913419272242274326e-52
PHYRA_72430461762382314338e-52
PHYRA_72306694282382314338e-52
PHYRA_5242737011241324228e-52
PHYCA_553546452582802714342e-51
PHYSO_514298591312642424332e-51
PHYRA_47103689972262204292e-51
PHYSO_365377537622202324282e-51
PHALS_14425357673022304343e-51
PPTG_00542691692382554275e-51
PHYSO_334500517582352494276e-51
PPTG_18463452582542704286e-51
PHYSO_246397456772642424287e-51
PHYCA_124383426672802704299e-51
PHYRA_52296691712372314251e-50
PPTG_03796191822552494252e-50
PHYCA_109089173962772724262e-50
PHYCA_109192413382782754253e-50
PHALS_1442380283792364315e-50
PHYCA_109174413332772744245e-50
PPTG_10591215032542474201e-49
PPTG_15262459142332264181e-49
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_81102

Length=252
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_81102                                                           487        3e-176
PHYRA_72504                                                           487        3e-176
PHYCA_129485                                                          408        5e-145
PPTG_17125                                                            405        2e-143
PITG_18453                                                            376        2e-132
PHYRA_71825                                                           310        4e-106
PHYRA_81103                                                           305        4e-104
PITG_09716                                                            290        3e-98 
PPTG_08893                                                            284        4e-96 
PPTG_16851                                                            280        2e-94 
PHYCA_121494                                                          278        5e-94 
PHYSO_261265                                                          278        9e-94 
PHYCA_10034                                                           277        7e-93 
PHYKE_6286                                                            274        5e-92 
PPTG_17049                                                            263        8e-88 
PHYSO_254108                                                          261        2e-87 
PHYCA_118548                                                          256        5e-85 
PITG_22053                                                            253        5e-84 
PPTG_07664                                                            253        6e-84 
PITG_04208                                                            252        2e-83 
PITG_19936                                                            251        4e-83 
PHYRA_74356                                                           249        3e-82 
PHYCA_118674                                                          249        8e-82 
PITG_19938                                                            247        1e-81 
PHYRA_74306                                                           247        1e-81 
PHYCA_9298                                                            246        4e-81 
PHYRA_52440                                                           243        6e-80 
PPTG_19331                                                            245        3e-79 
PHYSO_526774                                                          238        5e-78 
PPTG_07671                                                            237        1e-77 
PHYCA_132252                                                          237        1e-77 
PHYCA_118551                                                          237        1e-77 
PHYSO_526832                                                          237        1e-77 
PHYSO_249692                                                          237        1e-77 
PHYRA_72386                                                           236        2e-77 
PHYRA_72344                                                           236        2e-77 
PHYCA_122048                                                          236        3e-77 
PHYSO_526623                                                          236        4e-77 
PITG_04248                                                            236        4e-77 
PHYRA_71404                                                           234        1e-76 
PHYRA_72433                                                           234        1e-76 
PHYRA_76249                                                           236        3e-76 
PHYCA_129784                                                          233        3e-76 
PHYSO_329843                                                          233        5e-76 
PHYRA_74307                                                           233        6e-76 
PHYCA_107869                                                          236        7e-76 
PHYKE_2376                                                            234        1e-75 
PHYRA_74343                                                           232        1e-75 
PPTG_17409                                                            231        2e-75 
PHYSO_507736                                                          231        2e-75 
PHYRA_71477                                                           231        2e-75 
PHYCA_108039                                                          230        2e-75 
PPTG_15230                                                            231        3e-75 
PITG_04200                                                            230        4e-75 
PHYRA_42876                                                           228        9e-75 
PHYCA_11951                                                           228        2e-74 
PITG_04267                                                            230        2e-74 
PHYCA_123779                                                          229        4e-74 
PHYRA_71308                                                           227        1e-73 
PHYRA_74310                                                           227        1e-73 
PHYRA_72438                                                           226        2e-73 
PHYSO_526071                                                          226        4e-73 
PHYSO_510888                                                          225        6e-73 
PPTG_15224                                                            224        9e-73 
PHYKE_5753                                                            222        6e-72 
PHYKE_4438                                                            226        6e-72 
PPTG_15233                                                            221        1e-71 
PPTG_06973                                                            219        1e-71 
PPTG_08017                                                            232        2e-71 
PPTG_17245                                                            221        4e-71 
PHYSO_468315                                                          220        6e-71 
PHYSO_406265                                                          219        7e-71 
PHYCA_9358                                                            219        1e-70 
PPTG_07089                                                            219        1e-70 
PPTG_19330                                                            221        2e-70 
PHYRA_71618                                                           219        2e-70 
PITG_22668                                                            227        2e-70 
PHYRA_71931                                                           218        3e-70 
PYVX_22467                                                            218        3e-70 
PHYSO_414520                                                          217        4e-70 
PHYKE_4946                                                            218        5e-70 
PHYRA_72345                                                           216        2e-69 
PPTG_12847                                                            219        2e-69 
PPTG_12853                                                            219        2e-69 
PYU1_G011231                                                          215        3e-69 
PHYRA_52423                                                           213        7e-69 
PYU1_G011237                                                          214        8e-69 
PPTG_08005                                                            228        8e-69 
PHYRA_74617                                                           217        1e-68 
PHYCA_108409                                                          215        1e-68 
PHYSO_397673                                                          213        2e-68 
PPTG_18464                                                            214        2e-68 
PYIR_13251                                                            213        2e-68 
PPTG_12852                                                            216        2e-68 
PPTG_13769                                                            216        3e-68 
PHYCA_18373                                                           213        5e-68 
PPTG_07660                                                            211        6e-68 
PHYRA_54327                                                           211        6e-68 
PHYCA_69480                                                           211        7e-68 
PHALS_06162                                                           219        7e-68 
PPTG_07277                                                            214        9e-68 
PHYCA_118356                                                          211        2e-67 
PHYSO_254112                                                          210        2e-67 
PHYSO_527352                                                          211        3e-67 
PHYSO_259736                                                          209        4e-67 
PHYRA_46230                                                           208        9e-67 
PHYSO_249751                                                          209        1e-66 
PHYKE_7564                                                            216        1e-66 
PPTG_13736                                                            209        1e-66 
HYAP_09243                                                            209        1e-66 
PHYCA_69477                                                           207        2e-66 
PHYCA_119748                                                          209        2e-66 
PHYSO_334487                                                          209        2e-66 
PHYRA_72475                                                           208        2e-66 
PHYRA_72165                                                           208        2e-66 
PYIR_13252                                                            207        3e-66 
PYU1_G011235                                                          207        3e-66 
PHYRA_74630                                                           211        5e-66 
PITG_08522                                                            211        6e-66 
PHYRA_71588                                                           206        1e-65 
PYU1_G011233                                                          206        1e-65 
PPTG_07661                                                            205        3e-65 
PHYKE_5655                                                            205        3e-65 
PHYRA_49009                                                           204        6e-65 
PHYSO_334498                                                          203        1e-64 
PPTG_19506                                                            203        1e-64 
PYU1_G011230                                                          201        1e-63 
PHYKE_7566                                                            201        4e-63 
PHYRA_86968                                                           199        5e-63 
PHYRA_43347                                                           199        5e-63 
PHYCA_69479                                                           198        8e-63 
PPTG_15231                                                            199        9e-63 
PHYCA_6835                                                            197        2e-62 
PHYRA_52960                                                           197        3e-62 
PHYRA_52955                                                           197        3e-62 
PYU1_G011236                                                          197        5e-62 
PYIW_25259                                                            197        5e-62 
PITG_22734                                                            194        5e-62 
PHALS_06084                                                           197        7e-62 
PHYRA_83592                                                           196        1e-61 
PHYSO_329114                                                          196        2e-61 
PYIR_13275                                                            196        2e-61 
PHYKE_4541                                                            192        2e-61 
PHYRA_41766                                                           194        2e-61 
PPTG_22174                                                            208        2e-61 
PHYSO_496064                                                          196        3e-61 
PHYRA_45457                                                           193        3e-61 
PHYRA_39489                                                           194        5e-61 
PHYRA_72390                                                           193        2e-60 
PHYRA_72477                                                           192        2e-60 
PITG_22916                                                            193        2e-60 
PHYCA_69457                                                           191        5e-60 
PHYSO_526541                                                          192        5e-60 
PHYSO_336498                                                          191        9e-60 
PITG_16866                                                            190        3e-59 
PPTG_00460                                                            190        6e-59 
PHYRA_44405                                                           188        8e-59 
PHYSO_490000                                                          188        1e-58 
HYAP_06628                                                            188        2e-58 
PHYSO_330015                                                          187        2e-58 
PPTG_17295                                                            187        2e-58 
PHYSO_255972                                                          186        3e-58 
PHYRA_84273                                                           187        4e-58 
PITG_23228                                                            187        6e-58 
PPTG_07991                                                            187        7e-58 
PHYKE_7568                                                            190        8e-58 
HYAP_08306                                                            187        8e-58 
PHYRA_84277                                                           185        2e-57 
PHYRA_76657                                                           185        3e-57 
PHYCA_132529                                                          184        3e-57 
PPTG_14652                                                            185        4e-57 
PHYRA_72385                                                           184        4e-57 
PHYSO_254223                                                          184        4e-57 
PHYRA_71307                                                           184        8e-57 
PPTG_17453                                                            184        1e-56 
PHYCA_123797                                                          182        3e-56 
PPTG_11469                                                            182        4e-56 
PHYCA_12462                                                           180        4e-56 
PHYSO_423056                                                          182        4e-56 
PHYRA_83851                                                           181        5e-56 
PHYSO_365942                                                          181        6e-56 
PPTG_04799                                                            181        8e-56 
PITG_23211                                                            181        9e-56 
PHYRA_71310                                                           181        9e-56 
PPTG_15234                                                            181        1e-55 
PHYRA_72531                                                           180        1e-55 
PHYRA_52260                                                           180        2e-55 
PHYSO_527850                                                          179        2e-55 
PHYCA_544885                                                          181        2e-55 
PHYCA_123205                                                          178        2e-55 
PHYSO_504553                                                          180        3e-55 
PPTG_08703                                                            180        4e-55 
PITG_23051                                                            180        6e-55 
PITG_22981                                                            179        7e-55 
PHYRA_72403                                                           179        7e-55 
PITG_23076                                                            180        8e-55 
PHYKE_208                                                             176        1e-54 
PPTG_13026                                                            177        2e-54 
PHYRA_52426                                                           175        2e-54 
PHYRA_75425                                                           177        2e-54 
PHYCA_576423                                                          177        2e-54 
PPTG_00471                                                            177        3e-54 
PHYSO_560790                                                          177        3e-54 
PHYSO_254099                                                          177        3e-54 
PHYSO_516261                                                          176        4e-54 
PHYSO_482931                                                          177        4e-54 
PHYRA_76603                                                           177        5e-54 
PYVX_22469                                                            182        7e-54 
PHYRA_72541                                                           176        8e-54 
PHYCA_124462                                                          177        9e-54 
PITG_00957                                                            176        3e-53 
PHYRA_47241                                                           172        3e-53 
HYAP_07436                                                            175        4e-53 
HYAP_07925                                                            175        5e-53 
PHALS_12600                                                           175        5e-53 
PHYSO_480321                                                          174        6e-53 
PHYCA_129892                                                          172        1e-52 
PHYSO_253029                                                          173        2e-52 
PHYCA_109163                                                          173        2e-52 
PHYCA_109162                                                          173        2e-52 
PPTG_13004                                                            173        2e-52 
HYAP_14846                                                            172        2e-52 
PHYSO_328418                                                          171        2e-52 
PHYKE_8391                                                            183        3e-52 
PHYCA_69122                                                           172        4e-52 
PHYSO_521124                                                          172        4e-52 
PHALS_13513                                                           171        5e-52 
PPTG_16647                                                            172        6e-52 
PHYCA_114913                                                          171        6e-52 
PHYRA_72430                                                           171        8e-52 
PHYRA_72306                                                           171        8e-52 
PHYRA_52427                                                           167        8e-52 
PHYCA_553546                                                          171        2e-51 
PHYSO_514298                                                          171        2e-51 
PHYRA_47103                                                           169        2e-51 
PHYSO_365377                                                          169        2e-51 
PHALS_14425                                                           171        3e-51 
PPTG_00542                                                            169        5e-51 
PHYSO_334500                                                          169        6e-51 
PPTG_18463                                                            169        6e-51 
PHYSO_246397                                                          169        7e-51 
PHYCA_124383                                                          169        9e-51 
PHYRA_52296                                                           168        1e-50 
PPTG_03796                                                            168        2e-50 
PHYCA_109089                                                          168        2e-50 
PHYCA_109192                                                          168        3e-50 
PHALS_14423                                                           170        5e-50 
PHYCA_109174                                                          167        5e-50 
PPTG_10591                                                            166        1e-49 
PPTG_15262                                                            165        1e-49 
PHALS_13512                                                           165        1e-49 
PHYCA_544875                                                          165        2e-49 
PPTG_11475                                                            165        3e-49 
PHYCA_10570                                                           165        4e-49 
PPTG_04504                                                            164        8e-49 
PHYCA_109095                                                          163        2e-48 
PHYSO_249691                                                          162        2e-48 
PITG_23094                                                            161        4e-48 
PPTG_06202                                                            161        9e-48 
PYAP_24304                                                            160        1e-47 
PPTG_05581                                                            161        1e-47 
PHYCA_123587                                                          161        1e-47 
PPTG_05868                                                            160        3e-47 
PHYSO_480350                                                          159        3e-47 
PHYCA_133546                                                          158        2e-46 
PHYCA_108964                                                          156        9e-46 
PPTG_15220                                                            155        1e-45 
PITG_22709                                                            156        2e-45 
PPTG_15219                                                            153        4e-45 
PITG_23075                                                            154        5e-45 
HYAP_04977                                                            154        7e-45 
PHYRA_72357                                                           153        8e-45 
PHYCA_133455                                                          150        1e-44 
HYAP_05559                                                            153        1e-44 
PPTG_15218                                                            152        2e-44 
PHYCA_118700                                                          151        2e-44 
PHALS_08480                                                           152        2e-44 
PHYSO_449487                                                          148        2e-44 
HYAP_05558                                                            152        3e-44 
PHYKE_7565                                                            150        3e-44 
PHYCA_10715                                                           150        4e-44 
PHYSO_251206                                                          150        6e-44 
PHALS_03592                                                           150        1e-43 
PHALS_02474                                                           149        2e-43 
PHYKE_5284                                                            149        3e-43 
PYAP_24339                                                            147        5e-43 
PITG_23055                                                            146        1e-42 
PHYCA_132177                                                          147        1e-42 
HYAP_14784                                                            147        2e-42 
PHYRA_45462                                                           144        3e-42 
PPTG_15860                                                            144        3e-42 
PHALS_08945                                                           145        5e-42 
PHALS_08947                                                           145        1e-41 
PYAP_24757                                                            143        5e-41 
PHYSO_481543                                                          143        8e-41 
PITG_23062                                                            143        1e-40 
PHYCA_59113                                                           138        4e-40 
PHALS_08447                                                           140        7e-40 
PYAR_24955                                                            139        1e-39 
PHYSO_263794                                                          137        6e-39 
PPTG_07667                                                            133        3e-38 
PHYCA_109151                                                          133        3e-38 
PPTG_11648                                                            136        8e-38 
PPTG_07668                                                            130        2e-37 
PHALS_05391                                                           132        7e-37 
PHALS_01213                                                           133        7e-37 
PHYSO_327908                                                          139        2e-36 
PITG_10839                                                            127        3e-36 
PHYCA_5621                                                            130        4e-36 
PHALS_08445                                                           130        4e-36 
PHYSO_257244                                                          129        2e-35 
PHYCA_109441                                                          127        3e-35 
PHYSO_526791                                                          125        4e-35 
PHYSO_327912                                                          127        5e-35 
PHYSO_246660                                                          127        1e-34 
PHYSO_477165                                                          123        1e-34 
HYAP_08846                                                            127        3e-34 
PHYSO_260049                                                          125        3e-34 
PHYSO_342831                                                          122        7e-34 
PHYSO_245789                                                          122        1e-33 
PHYSO_508915                                                          119        2e-32 
PHYCA_11676                                                           119        3e-32 
PHYSO_251461                                                          119        4e-32 
PYIW_24350                                                            118        8e-32 
PHYSO_327911                                                          119        9e-32 
PPTG_11479                                                            119        2e-31 
PHYSO_338051                                                          117        3e-31 
HYAP_07033                                                            116        4e-31 
PHYRA_39486                                                           112        4e-30 
PHYRA_39485                                                           112        5e-30 
PHALS_05247                                                           114        7e-30 
PHYSO_444351                                                          108        2e-29 
PHYSO_264058                                                          111        2e-29 
PHYKE_1224                                                            110        2e-29 
PYAR_25201                                                            110        2e-29 
PHYCA_507156                                                          108        8e-29 
PHYRA_44618                                                           107        3e-28 
PPTG_07690                                                            106        3e-28 
PHYCA_73404                                                           105        4e-28 
PHYCA_59410                                                           102        7e-27 
PHYSO_333132                                                          102        5e-26 
PPTG_23721                                                            107        1e-25 
PYAR_21977                                                            102        2e-25 
PHYRA_52174                                                           99.8       2e-24 
PHYSO_341539                                                          99.8       3e-24 
PHALS_13274                                                           99.4       5e-24 
PHYCA_73400                                                           92.8       2e-23 
PHYSO_509491                                                          91.7       6e-23 
HYAP_07922                                                            93.2       7e-23 
HYAP_05562                                                            93.6       3e-22 
PHYCA_18619                                                           91.3       4e-22 
PHYSO_335497                                                          94.4       4e-22 
PPTG_11420                                                            92.4       7e-22 
PHYSO_261711                                                          92.8       9e-22 
PHYCA_119285                                                          88.2       2e-21 
PHYKE_7051                                                            89.0       3e-21 
PHYSO_526695                                                          86.3       2e-20 
PHYCA_73406                                                           85.1       2e-20 
PHYCA_73407                                                           85.1       2e-20 
PHYSO_245887                                                          86.7       3e-20 
PITG_22876                                                            86.3       3e-20 
PYAR_26314                                                            85.5       5e-20 
PHYSO_377094                                                          81.3       6e-19 
PYU1_G011232                                                          80.1       2e-18 
HYAP_07496                                                            80.1       4e-18 
PHYKE_4231                                                            80.1       4e-18 
PHYKE_6288                                                            79.0       7e-18 
PHYSO_264049                                                          77.8       3e-17 
PHYSO_445618                                                          76.6       4e-17 
HYAP_07372                                                            78.6       7e-17 
PHALS_14424                                                           76.3       2e-16 
PPTG_05373                                                            74.7       2e-15 
PITG_23039                                                            72.0       1e-14 
PPTG_08713                                                            70.9       2e-14 
PHYCA_108999                                                          69.7       3e-14 
PPTG_11472                                                            72.0       2e-13 
HYAP_08078                                                            66.6       1e-12 
PHYSO_515401                                                          63.2       9e-12 
HYAP_11184                                                            59.3       2e-10 
PPTG_23679                                                            60.1       3e-10 
PYAR_26415                                                            57.4       7e-10 
PPTG_19242                                                            57.8       9e-10 
PYIW_25932                                                            56.2       1e-09 
PHYSO_260072                                                          57.8       2e-09 
PHYSO_336673                                                          53.9       3e-08 
PPTG_19622                                                            50.4       9e-08 
PPTG_17455                                                            50.8       3e-07 
PPTG_20067                                                            50.8       3e-07 
PPTG_04456                                                            48.9       5e-07 
PYIR_26577                                                            46.2       5e-06 
HYAP_08850                                                            47.8       1e-05 
PYVX_16508                                                            47.0       3e-05 
PHYKE_6287                                                            43.5       3e-05 
PHYRA_85280                                                           47.0       5e-05 
PPTG_20194                                                            44.7       7e-05 
PYVX_21088                                                            45.8       9e-05 
PHYSO_335499                                                          45.8       1e-04 
HYAP_03446                                                            42.0       2e-04 
HYAP_12828                                                            40.8       3e-04 
PYAP_24306                                                            38.5       0.005 
PHYSO_333483                                                          33.5       0.53  
HYAP_08851                                                            31.6       0.99  
PHALS_01805                                                           30.8       2.1   
CCI47165                                                              32.3       3.0   
PHYSO_361758                                                          31.2       7.4   
PYIW_20076                                                            31.2       7.5   
PHYSO_326307                                                          30.4       9.8   

>PHYRA_81102
Length=251

 Score = 487 bits (1253),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%), Gaps = 0/251 (0%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP
Sbjct  1    MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP
Sbjct  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
            DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY
Sbjct  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV
Sbjct  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240

Query  241  FEELLDKTWPF  251
            FEELLDKTWPF
Sbjct  241  FEELLDKTWPF  251

>PHYRA_72504
Length=251

 Score = 487 bits (1253),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%), Gaps = 0/251 (0%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP
Sbjct  1    MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP
Sbjct  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
            DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY
Sbjct  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV
Sbjct  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240

Query  241  FEELLDKTWPF  251
            FEELLDKTWPF
Sbjct  241  FEELLDKTWPF  251

>PHYCA_129485
Length=251

 Score = 408 bits (1048),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 201/251 (80%), Positives = 220/251 (88%), Gaps = 0/251 (0%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MNFR V +  +ASLA AQAQVIGHDQVRPFPQP PVTVS K AVKFKPQLKI  GCHPYP
Sbjct  1    MNFRIVLLVLVASLAGAQAQVIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AVQKDGS++GGLKWSGPQDGECTGS+LGSQIYARSAWVNDVWAIMYAWYFPKGR A   P
Sbjct  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
               R FGHRHNWEYV+VWIDNP  +N+T+LGVSMSA++GY+ Q P +  YVDG SVK+ Y
Sbjct  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            YYNHLLG+T+LQLTEDTGEFQDLI WD+LS LARYSLNHTDWD+TLF LAGLKMPLKDGV
Sbjct  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240

Query  241  FEELLDKTWPF  251
            F+ELLDK WPF
Sbjct  241  FQELLDKAWPF  251

>PPTG_17125
Length=283

 Score = 405 bits (1041),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 185/230 (80%), Positives = 206/230 (90%), Gaps = 0/230 (0%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGH+QVRPFP+P+PVT SQK AVK+KPQLKI+ GCHPYPAVQKDGS+SGGLKWSGPQDGE
Sbjct  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS+LGSQIYARS WVNDVWAIMYAWYFPKGR A   P  LR FGHRHNWEY +VWIDN
Sbjct  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P LEN+T+LGVSMSAS+GY+ Q P + +YVDG SVK+ YYYNHLLG+T+LQLTE TGEFQ
Sbjct  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WD+LS LARYSLNHTDWD+TLF LAGLKMPLKDGVF+ELL+K WPF
Sbjct  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283

>PITG_18453
Length=252

 Score = 376 bits (965),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 202/230 (88%), Gaps = 0/230 (0%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGH+QVRPF +P+PVT SQK AVK+KPQLKI+ GCHPYPAVQKDGS+SGGLKWSGPQDGE
Sbjct  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS+LGSQIYARS WVNDVWAIMYAWYFPKGR A   P  LR FGHRHNWEY +VWIDN
Sbjct  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P LEN+T+LGVS+SASI Y+ + P +  +VDG SVK+ YYYNHL G+T+LQLTEDTGEFQ
Sbjct  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DL+ WDQL+ LARYSLN+TDWD+TLF LAGLKMPLKDG F+ELL+K WPF
Sbjct  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252

>PHYRA_71825
Length=254

 Score = 310 bits (793),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 177/230 (77%), Gaps = 0/230 (0%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF QP P T ++K AVK+KP+L ++ GCHPY AVQ DG++SGGL+WSGPQDGE
Sbjct  25   IPHDTVEPFAQPRPKTDAEKAAVKYKPRLLVEDGCHPYAAVQADGAISGGLEWSGPQDGE  84

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YAR   V DVWAIMYAWYFPKGRA    P  LRFFGHR+ WEY VVW+DN
Sbjct  85   CRGSPLGSQVYARWMKVKDVWAIMYAWYFPKGRAPLPVPLSLRFFGHRNGWEYAVVWLDN  144

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               +N+TVL  S+SA++G+SK+AP   KY DGTS+ V+YYYNH+ GNTA++ TED GEFQ
Sbjct  145  LNAKNSTVLATSLSAAVGWSKEAPPKEKYFDGTSLMVSYYYNHIFGNTAVKYTEDAGEFQ  204

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             LI WDQL  LAR +LN+TDWD T   +A +KMP+KDGVF E L+  +PF
Sbjct  205  PLITWDQLPDLARKALNNTDWDATPSNVARVKMPMKDGVFLEKLEGAYPF  254

>PHYRA_81103
Length=252

 Score = 305 bits (780),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 177/231 (77%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGP-QDG  80
            I HDQV+PF QP+ +TVSQK AVKFKPQLK   GC+PYPAVQ DGS SGGL+W+   Q G
Sbjct  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
            +CT   LGSQIYARS W  DVWAIMY WYFPKG   +         GHRHNWE+VVVWID
Sbjct  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL----GHRHNWEFVVVWID  142

Query  141  NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            NP L+N+T+LGVSMSASIGYSK+AP   KY+DGTSVKV+Y+Y+ + GNTAL+LTED GE 
Sbjct  143  NPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  202

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI WDQL  +AR +LN TDWD TL+ L   +MPLKD VF + L K+WPF
Sbjct  203  QDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252

>PITG_09716
Length=250

 Score = 290 bits (741),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 174/230 (76%), Gaps = 3/230 (1%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +D ++PFPQP P T +QK  +K+KPQLK++ GCHPYPAVQ++G +S GL+WSGP+D  
Sbjct  24   IPYDTLQPFPQPIPTTDAQKAILKYKPQLKVEEGCHPYPAVQRNGDISSGLRWSGPEDIG  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQIYARS    D WA+MY WYFPKGRA   P   LR  GHRH WEY VVW+D 
Sbjct  84   CKGSSLGSQIYARSKLFKDKWAVMYTWYFPKGRA---PIPGLRSSGHRHGWEYAVVWLDR  140

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                ++T+LG S+SA++G++K++PT  +Y+DG S+KVAYY+N    NTA++ T+D G FQ
Sbjct  141  LDANSSTILGTSLSAAVGWAKESPTPKEYLDGHSLKVAYYFNDDFSNTAVKYTQDGGAFQ  200

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLIQWDQLS  AR SL +TDWD+TLF +A +KMP+KDGVFEE L   +PF
Sbjct  201  DLIQWDQLSDPARASLINTDWDETLFNVARVKMPMKDGVFEEKLSGAYPF  250

>PPTG_08893
Length=251

 Score = 284 bits (726),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 172/230 (75%), Gaps = 3/230 (1%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +D V+PFPQP P T +QK  +K+KPQLK++ GC PYPAVQ+DG++S GL+WSGP+D  
Sbjct  25   IPYDTVQPFPQPVPTTEAQKAILKYKPQLKVEEGCRPYPAVQQDGAISSGLRWSGPEDIG  84

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIYARS    D WA+MY WYFPKGRA    P   R  GHRH WEY VVW+D 
Sbjct  85   CKGSLRGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPGP---RSSGHRHGWEYAVVWLDK  141

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               +N+T+LG S+SA++G++K++PT  +Y+DG S+KVAYY+N    NTA++ T+  G FQ
Sbjct  142  LTADNSTILGTSLSAAVGWAKESPTPKEYLDGNSLKVAYYFNDDFKNTAVKYTQAGGAFQ  201

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQLS +AR SL++TDWD+T F +A +KMP+KDGVFEE L   +PF
Sbjct  202  DLIIWDQLSDVARASLSNTDWDETPFNVARVKMPMKDGVFEEKLSGAYPF  251

>PPTG_16851
Length=249

 Score = 280 bits (715),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 172/230 (75%), Gaps = 4/230 (2%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +D V+PF Q  P T +QK  +K+KPQLKI+ GCHPYPAVQKDGS+S GLKWSGP +  
Sbjct  24   IPYDSVQPFSQQVPNTDAQKAILKYKPQLKIEEGCHPYPAVQKDGSISSGLKWSGPDNIG  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YAR+ W+   WA+MYAWYFPKGRA    P   R +GHRH WEY VVW+D 
Sbjct  84   CKGSPLGSQVYARATWLKGKWAVMYAWYFPKGRAPIPAP---RSYGHRHGWEYAVVWLDK  140

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                N+T+LG SMSA+IG++K++PT  +Y+DG S+KVAYY+N    NTA++ T+D GEFQ
Sbjct  141  -ASANSTLLGTSMSAAIGWAKESPTPKEYLDGNSLKVAYYFNDDSINTAVKYTQDAGEFQ  199

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQL  +AR +L +TDWD+T   +A +KMP+KDGVF E L+  +PF
Sbjct  200  DLIIWDQLPDVARNALVNTDWDETPLNVARVKMPMKDGVFMEKLNGAYPF  249

>PHYCA_121494
Length=248

 Score = 278 bits (712),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 170/230 (74%), Gaps = 4/230 (2%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +D V P P     T +QK AVK+ PQL I+ GCHPY AVQ DG++S GLKWSGPQDG 
Sbjct  23   IPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPQDGA  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YARS WV   WAIMYAWYFP G+A  VPP  L   GHR+ WEY V+W+D 
Sbjct  83   CKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQA-PVPPVGL---GHRNGWEYAVIWLDR  138

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P  +N+T+LGVS+SA++G+SK+AP   K++DG S+KV+YYYN++  NTA++ TE+ GEFQ
Sbjct  139  PTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFRNTAVKYTEEKGEFQ  198

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             LI WDQL   AR +L +TDWD+T F +A +KMP+KDGVF E L   +PF
Sbjct  199  TLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  248

>PHYSO_261265
Length=247

 Score = 278 bits (711),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 172/231 (74%), Gaps = 7/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD-G  80
            I +D+V PF QP PVT   KT +K+KP LKI  GCHPYPAVQK+G +SGGL+WS P D  
Sbjct  23   IPYDEVHPFAQPAPVTDLHKTMLKYKPHLKIKEGCHPYPAVQKNGDISGGLEWSSPTDNA  82

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
            EC GS LGSQ+YARS+WV   +AIMYAWYFP GRA  +P      FGHR+ WEY +VW+D
Sbjct  83   ECKGSPLGSQVYARSSWVKGKFAIMYAWYFPMGRAPLLP------FGHRNGWEYAIVWLD  136

Query  141  NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            +    N+T+LG S+SA++G++K+ P + KY+DG ++KVAYY+N  +  TA++ TE+ GEF
Sbjct  137  SVSSTNSTILGTSLSAAVGWAKEVPRNRKYLDGNNLKVAYYFNRDVRCTAVEYTEEIGEF  196

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QD+I WDQL +  R SL++TDWD T F +A LKMP+KDGVF+E L+  +PF
Sbjct  197  QDVITWDQLPAPTRDSLSNTDWDHTPFNVALLKMPMKDGVFQEKLNSAYPF  247

>PHYCA_10034
Length=274

 Score = 277 bits (708),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 169/230 (73%), Gaps = 4/230 (2%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +D V P P     T +QK AVK+ PQL I+ GCHPY AVQ DG++S GLKWSGP DG 
Sbjct  49   IPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPHDGA  108

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YARS WV   WAIMYAWYFP G+A  VPP  L   GHR+ WEY V+W+D 
Sbjct  109  CKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQA-PVPPVGL---GHRNGWEYAVIWLDR  164

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P  +N+T+LGVS+SA++G+SK+AP   K++DG S+KV+YYYN++  NTA++ TE+ GEFQ
Sbjct  165  PTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFHNTAVKYTEEKGEFQ  224

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             LI WDQL   AR +L +TDWD+T F +A +KMP+KDGVF E L   +PF
Sbjct  225  TLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  274

>PHYKE_6286
Length=250

 Score = 274 bits (700),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 170/231 (74%), Gaps = 5/231 (2%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+PV+ ++K AVKFKPQL +  GC PYPAV  +GS+S GLKW+G  DG+
Sbjct  24   ISHDQVQPFAQPEPVSDAEKAAVKFKPQLAVTYGCDPYPAVDSNGSISAGLKWAGKPDGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQ+Y+R+ W  D WAIMYAWYFPK R          F+GHRH W++ VVWID+
Sbjct  84   CTGSPLGSQVYSRADWYEDKWAIMYAWYFPKARQRLSK----YFYGHRHMWQWAVVWIDD  139

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLL-GNTALQLTEDTGEF  200
            P  +N+TV GVSMSAS+GY K++P   KYVD +SVK+  Y +    G  +L+LTEDTGE 
Sbjct  140  PASDNSTVQGVSMSASVGYQKRSPPKSKYVDDSSVKLDSYVDFWWSGKASLRLTEDTGET  199

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLIQWDQL+  AR SL+  D+D++L+    +KMPLKDGVF + L +++PF
Sbjct  200  QDLIQWDQLTDAARESLSSFDFDESLWNTKKIKMPLKDGVFTKNLKRSYPF  250

>PPTG_17049
Length=255

 Score = 263 bits (672),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 162/234 (69%), Gaps = 9/234 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            +GHD+V+PFPQP+P+T SQK AVKFKPQL I  GCHPYPAVQ DG++SGGLK+SG  DG+
Sbjct  25   VGHDRVKPFPQPEPITTSQKAAVKFKPQLSIAFGCHPYPAVQADGAVSGGLKYSGKPDGD  84

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  DVWAI YAWY PKG         +   GHRH W YV VWI+N
Sbjct  85   CKGSALGSQVYSRSTWYRDVWAITYAWYLPKGYERFSGLSMVE--GHRHFWGYVTVWINN  142

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLL----GNTALQLTEDT  197
            P +ENA +LGVSMS  +G+  QAP D K VDG+++K+  +  H++    G   L+  E  
Sbjct  143  PAVENAYILGVSMSGQLGHDTQAPVDKKCVDGSTLKLE-FDGHVMDGAKGKQGLRCVEAV  201

Query  198  GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            G+FQDLI WDQL+  AR SLN  ++D    G     +PLKDGVF  LL+ TWPF
Sbjct  202  GKFQDLITWDQLTEAARDSLNTYNFDS--IGRDMGTVPLKDGVFTNLLNSTWPF  253

>PHYSO_254108
Length=246

 Score = 261 bits (668),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 162/230 (70%), Gaps = 9/230 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+P  QP PVT +QK AVK+KPQL++  GCHPYPAVQ +GS+SGGL+WSGP DG+
Sbjct  26   INHDQVQPMAQPTPVTDAQKLAVKYKPQLRVSYGCHPYPAVQANGSVSGGLEWSGPADGD  85

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YARS W  D WA MY WYFPKGR           +GHRH WEY ++W D+
Sbjct  86   CEGSSLGSQVYARSDWFKDKWATMYTWYFPKGRQ--------DVWGHRHFWEYAIIWTDS  137

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P  +N+T LG+SMSA +G+ KQ P  +KY++G SVK+  +Y+ L    ALQLT+D+G+FQ
Sbjct  138  PSPDNSTFLGISMSAGVGHGKQTPVLLKYMNGNSVKLESHYSVLGNKAALQLTKDSGDFQ  197

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W QL   AR +LN   +D T F     +MPLKD VF  +L+K +P+
Sbjct  198  DLITWGQLPVPARDALNGDAFDVTYF-FNKFEMPLKDRVFMSVLNKAYPW  246

>PHYCA_118548
Length=246

 Score = 256 bits (653),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 158/230 (69%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HDQV+PF QP+P+T SQK+AVK+KPQL I  GCHPY AVQ DGS SGGL+WSG  DG+
Sbjct  25   VNHDQVQPFAQPEPITDSQKSAVKYKPQLHISYGCHPYAAVQADGSASGGLEWSGRVDGD  84

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS+LGSQ+Y+RS W +D WAIMYAWYFPKGR            GHRH WEY +VW D+
Sbjct  85   CTGSQLGSQVYSRSDWYHDKWAIMYAWYFPKGR--------YHLGGHRHYWEYAIVWTDS  136

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N+++ GVSMSA +GY K  P  +KY+DG S+K   +++ L    ALQLT++ GE Q
Sbjct  137  PTSSNSSIQGVSMSAGVGYGKATPPMLKYIDGNSIKFDSHFSLLGNKAALQLTKEAGERQ  196

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQL+  AR +LN    D   +     ++P KD +F + L K +PF
Sbjct  197  DLITWDQLTVAARDTLNGDALDGKAWFTDKDEVPFKDDIFVKRLQKAFPF  246

>PITG_22053
Length=245

 Score = 253 bits (646),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 159/230 (69%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PF QP P+T SQK+AVK+KPQL I  GCHPYPAV+ +   SGGL+W GP DG+
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR            GHRH WEYVVVW D 
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWTDT  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N+++ GVSMSA +G++K  P  +KY+ G+S+K+  Y++ L    ALQLT++TGE Q
Sbjct  136  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ++  ARY+LN    D  ++     ++P KD +F + L+  +PF
Sbjct  196  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLENAFPF  245

>PPTG_07664
Length=245

 Score = 253 bits (646),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 159/230 (69%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PF Q  P+T SQK+AVK+KPQL I  GCHPYPAVQ +GS SGGL+WSGP DG+
Sbjct  24   VNHDKVQPFAQLQPITDSQKSAVKYKPQLHISYGCHPYPAVQANGSASGGLEWSGPVDGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQ+Y+RSAW  + WAIMYAWYFPKGR            GHRH WEY +VW D+
Sbjct  84   CTGSPLGSQVYSRSAWYKEKWAIMYAWYFPKGRYGIT--------GHRHYWEYAIVWTDS  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                N+++ GVSMSA +G++K  P  +KYVDG+S+K+  Y++ +    ALQLT++ GE Q
Sbjct  136  ATSTNSSIQGVSMSAGVGHAKATPPMLKYVDGSSIKLDSYFSFMGNKAALQLTKEHGETQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQL+  AR +LN    D  ++     ++P KD +F + L   +PF
Sbjct  196  DLITWDQLTVAARDTLNSDALDGNVWLTNKDEVPFKDDIFMQRLKNAFPF  245

>PITG_04208
Length=245

 Score = 252 bits (643),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 158/230 (69%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PF QP P+T SQK+AVK+KPQL I  GCHPYPAV+ +   SGGL+W GP DG+
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR            GHRH WEYVVVW D 
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWTDT  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N+++ GVSMSA +G++K  P  +KY+ G+S+K+  Y++ L    ALQLT++TGE Q
Sbjct  136  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ++  ARY+LN    D  ++     ++P KD +F + L   +PF
Sbjct  196  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLANAFPF  245

>PITG_19936
Length=249

 Score = 251 bits (641),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 160/231 (69%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PF QP+P   SQK+AVK+KPQL I  GCHPYPAVQ+DGS+S GLKW+G  +G+
Sbjct  24   IDHDAVQPFAQPEPTMESQKSAVKYKPQLHISYGCHPYPAVQEDGSISAGLKWAGWPNGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W    WAIMYAWYFPK R      D  R FGHRH W Y +VW +N
Sbjct  84   CKGSALGSQVYSRSDWYKGKWAIMYAWYFPKSRQYV---DKYR-FGHRHYWSYAIVWTNN  139

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P  +N+T+LGVSMS+ +GY K++P   KY VDGT+VK+ +Y++       LQLTE +GE 
Sbjct  140  PNPDNSTILGVSMSSGVGYMKRSPPKSKYVVDGTTVKLDWYWSFWGSKQGLQLTEKSGET  199

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QLS  AR +L+  D+D + +      MPLKD +F   L K +PF
Sbjct  200  QDLITWEQLSEEARNALSEADFDVS-WAFTKAVMPLKDDIFTSRLKKAYPF  249

>PHYRA_74356
Length=244

 Score = 249 bits (635),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 152/230 (66%), Gaps = 9/230 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF +P+P T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GLK SGP DGE
Sbjct  24   IDHDQVQPFAEPEPTTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLKGSGPADGE  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQ+Y+RS W  D WAIMYAWY PKG            +  RH WE  VVWID+
Sbjct  84   CTGSSLGSQVYSRSDWYEDKWAIMYAWYLPKGNYK---------YQRRHYWETAVVWIDD  134

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P L N+T+LGVSM+       + P   +++DG+SVK+  Y  +      LQ T++ GEFQ
Sbjct  135  PALSNSTILGVSMNYGRRSEFETPVQARFLDGSSVKLDSYRGYGYPKPRLQFTQEEGEFQ  194

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+QL+  AR +L+  D+D  LF     KMPLKDG+FE  L   WPF
Sbjct  195  DLITWEQLTEEARDALSTADFDGPLFKKKKRKMPLKDGIFEFRLKDAWPF  244

>PHYCA_118674
Length=281

 Score = 249 bits (635),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 158/231 (68%), Gaps = 7/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+K+AVK+KPQL I  GCHPYPAVQ +GS+SGGLKW+G  DG+
Sbjct  57   INHDQVQPFTQPEPTTDSEKSAVKYKPQLHISDGCHPYPAVQANGSVSGGLKWAGRSDGD  116

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  S LGSQIY+RS W ND WAIMYAWYFPKG       D     GHRH W Y +VW  +
Sbjct  117  CKRSALGSQIYSRSDWHNDKWAIMYAWYFPKGNEFQANFD----SGHRHYWSYAIVWTGS  172

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P  EN+TVLGVSMS+S GY K+AP   KYV DGT+VK   Y +      A++LT+  GE 
Sbjct  173  PNPENSTVLGVSMSSS-GYGKKAPPKSKYVIDGTTVKFDSYVSFWASKQAIRLTKKEGEA  231

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QL+  AR +L+  D+ +     + + MPLKD VF  +L K +PF
Sbjct  232  QDLITWEQLTQEARTALSEADF-KAESTFSKVVMPLKDDVFSSILKKAYPF  281

>PITG_19938
Length=245

 Score = 247 bits (631),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 160/228 (70%), Gaps = 8/228 (4%)

Query  24   HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
            HD+V+PF QP P+T SQK+AVK+KPQL I  GCHPYPAV+ +GS SGGL+WSGP DG+CT
Sbjct  26   HDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGDCT  85

Query  84   GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
            GS LGSQ+Y+RS W  + WAIMYAWYFPKGR            GHRH WEYVVVW D+  
Sbjct  86   GSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYGLT--------GHRHYWEYVVVWADSST  137

Query  144  LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
              ++++ GVSMSA +G++K  P  +KY+ G+SVK+  Y++ L    ALQLT++TGE QDL
Sbjct  138  STSSSIQGVSMSAGVGHAKATPPMLKYIHGSSVKLDSYFSFLGSKAALQLTKETGETQDL  197

Query  204  IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            I WDQ++  AR +LN    D  ++     ++P KD +F + L+  +PF
Sbjct  198  ITWDQMTVAARDTLNSDTLDGNVWLTNKDEVPFKDTIFLKRLEDAFPF  245

>PHYRA_74306
Length=245

 Score = 247 bits (630),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 152/230 (66%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF +P+P+T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  24   IDHDKVQPFAEPEPMTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLRGSGPADGE  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR+             RH WE  VVWID+
Sbjct  84   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRSTR--------HQRRHFWETAVVWIDD  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P L N+T+LGVSM+      +Q P  VKY+DG+SVK+  Y  +      LQ T++ G+FQ
Sbjct  136  PALANSTILGVSMNYGWRSKEQTPVKVKYLDGSSVKLESYRAYGFPKPRLQFTQEDGQFQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+QL+  AR +L+  D+D  L      +MPLKD +FE  L   WPF
Sbjct  196  DLITWEQLTEEARDALSTADFDTYLIEQKKREMPLKDDIFEYRLKDAWPF  245

>PHYCA_9298
Length=248

 Score = 246 bits (628),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 155/231 (67%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+K+AVK+KPQL I  GCHPYPAVQ DG++S GLKW+G   G+
Sbjct  23   IDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHPYPAVQADGAVSAGLKWAGTASGQ  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  + WAIMYAWYFPKGR           FGHRH W Y +VW+D+
Sbjct  83   CKGSGLGSQVYSRSDWYKNKWAIMYAWYFPKGRQYISK----YRFGHRHFWSYAIVWMDS  138

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               +N+T+LGVSMSA +GYSK+ P   KY VDGT+VK   Y++      A+ LT   GE 
Sbjct  139  DVPDNSTILGVSMSAGVGYSKETPPKSKYVVDGTTVKFKSYHSFWGSKLAVGLTTKEGES  198

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QL+  AR  L   D+D   +    + MP+ DGVF E L K +PF
Sbjct  199  QDLIAWEQLTDEARSGLTDADFD-VDWSFRKVVMPMTDGVFTEKLKKNYPF  248

>PHYRA_52440
Length=243

 Score = 243 bits (619),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 157/228 (69%), Gaps = 8/228 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD V+PF QP PVT SQK+AVK+KPQL I  GCHPYPAV+ +G  SGGL+WSGP DG+
Sbjct  24   VNHDLVQPFAQPTPVTDSQKSAVKYKPQLYISYGCHPYPAVEANGYASGGLEWSGPNDGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W ++ WAIMYAWYFPKGR            GHR+ WEY +VW D+
Sbjct  84   CKGSSLGSQVYSRSDWYHEKWAIMYAWYFPKGRYGVT--------GHRNYWEYAIVWTDS  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               +N+T+LGVSMSA +G+ K  P  +KY++G+SVK+  +++ L    AL+LT+  GEFQ
Sbjct  136  TSPDNSTLLGVSMSAGVGHDKTTPPMLKYMNGSSVKLNSHFSLLGSKAALELTKKEGEFQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQL+  AR +LN    D  ++     ++P KD +F + L+  +
Sbjct  196  DLITWDQLTVAARETLNSDALDGNVWLSNKDEVPFKDDIFVDRLEDAY  243

>PPTG_19331
Length=368

 Score = 245 bits (626),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 150/230 (65%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PFPQP+PVT+S+K AVKFKPQ+ I  GCHPYPAV + G  SGGLK  G    +
Sbjct  152  IDHDQVKPFPQPEPVTISEKAAVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAK  211

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS WV  +WAIMY+WYFPK   ++         GHRH+WE+V+VWIDN
Sbjct  212  CKGSGWGSQVYGRSTWVQGIWAIMYSWYFPKDSPSS-------GLGHRHDWEHVIVWIDN  264

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN  +L V+ SA  GYSKQ P +   VDGTSVKV  Y +H   N AL+ T + G+FQ
Sbjct  265  PDVENPKILAVTPSAHDGYSKQVPPNADCVDGTSVKVK-YESHWPINHALESTSEGGDFQ  323

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQLS  AR ++N   W +          P  DG F+  L+K WPF
Sbjct  324  DLIMWDQLSEDARRAMNGVGWGKA-------NTPFNDGNFKPKLEKAWPF  366

>PHYSO_526774
Length=249

 Score = 238 bits (607),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 153/231 (66%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+P  QP+P T S+KTAVK+KPQL I  GCHPYPAVQ DGS+S GLKWSG  +G+
Sbjct  24   INHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWANGK  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W    WAIMYAWYFPKGR      +     GH H W Y +VWIDN
Sbjct  84   CKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGRRMGDGYN----SGHHHYWSYAIVWIDN  139

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P  +N+T+LGVSMSA +GY K +P   KY VDG +VK   Y +       ++LT  +G+ 
Sbjct  140  PNPDNSTILGVSMSAGVGYRKASPPKSKYVVDGVTVKFDSYRSFWGSKQGVRLTTKSGDQ  199

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QL+  AR +L+  D+D   + L  + MPLKD    E L+K +PF
Sbjct  200  QDLITWEQLTDEARTALSDADFDVN-WSLKNVVMPLKDDALRERLEKAYPF  249

>PPTG_07671
Length=246

 Score = 237 bits (605),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V PF QP P T S+K AVK+KPQ  +  GCHPYPAVQ DGS+S GLK SGP DGE
Sbjct  24   INHDEVEPFAQPKPTTDSEKAAVKYKPQFHVSYGCHPYPAVQADGSVSAGLKGSGPMDGE  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D+WAIMYAWY PKGR+          +  RH WE  VVWID+
Sbjct  84   CEGSPLGSQVYSRSGWYEDMWAIMYAWYLPKGRSTK--------YQRRHYWEVAVVWIDD  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P L N+T+LGVS++    ++ Q P + +Y+ G+ VK+  +    +    L+ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRHNSQVPVEEQYLHGSRVKLESFKGFGVPRPRLRFTDLEGETQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+QL+  AR +L++  + + L       MPLKDGVFE+ L+  +PF
Sbjct  196  DLITWEQLTEEARDALSNAKFQRGLIKRLRGDMPLKDGVFEKRLEDAYPF  245

>PHYCA_132252
Length=249

 Score = 237 bits (605),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 153/231 (66%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+K+AVK+KPQL I  GCH YPAVQ DG++S GLKW+G   G+
Sbjct  24   IDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHSYPAVQADGAVSAGLKWAGSVSGQ  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR           FGHRH W Y +VW+D+
Sbjct  84   CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISK----YRFGHRHFWSYAIVWMDS  139

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               +N+T+LGVSMSA +GY+K+ P   KY VDGT+VK   Y +   G  A+ LT   GE 
Sbjct  140  DVPDNSTILGVSMSAGVGYNKKTPPKSKYVVDGTTVKFDSYQSFWGGKLAVGLTTKEGET  199

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QL+   R  L   D+D   + +  + MP+ D VF + L K +PF
Sbjct  200  QDLITWEQLTDEGRTGLTDADFD-VDWSIRKVVMPMADDVFVKKLKKNYPF  249

>PHYCA_118551
Length=245

 Score = 237 bits (604),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 148/230 (64%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PFPQP P T S+K AVK+KPQL +  GCHPYPAVQ DGS+S GLK +GP  GE
Sbjct  24   IDHDTVKPFPQPKPKTDSEKAAVKYKPQLLVSYGCHPYPAVQADGSVSAGLKGTGPAAGE  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY+WY PKGR A         +  RH WE  VVWID+
Sbjct  84   CGGSALGSQVYSRSDWYKDKWAIMYSWYLPKGRPAK--------YQRRHLWETAVVWIDD  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P L N+T+LGVS++    +   AP + +++D + VK+  Y         L+ T   GE Q
Sbjct  136  PSLANSTILGVSLNYGWRHKTMAPIESEFLDDSRVKLESYRGFSYPRPKLRFTTHVGETQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+QL+  AR +L++ ++D  L      +MPLKDGVFE+ L   WPF
Sbjct  196  DLITWEQLTVEAREALSNAEFDSGLIKTTRREMPLKDGVFEKRLKDAWPF  245

>PHYSO_526832
Length=249

 Score = 237 bits (604),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 150/230 (65%), Gaps = 4/230 (2%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF Q +PV  S K A+KFKP+L+I  GCHPYPAVQ DG++S GLKW+G  DG+
Sbjct  24   INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWAGKADGK  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RSAW    +AIMYAWYFPKG       +    + HRH W Y+V+WIDN
Sbjct  84   CKGSGLGSQVYSRSAWFEGKFAIMYAWYFPKGFEQRGKIN----YSHRHLWLYLVLWIDN  139

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P  EN  +LGV +  + G  ++ P D K++DG+S+KV YY +   G T +QLTE+ GEFQ
Sbjct  140  PENENPAILGVWLRTAGGNERRTPPDAKFLDGSSLKVDYYKSSWHGKTGIQLTENPGEFQ  199

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+Q++  AR +L   D+D        L +P  DG F   L K W F
Sbjct  200  DLITWEQMTEEARIALTEADFDGHWQERKDLDVPFIDGEFTVNLKKAWVF  249

>PHYSO_249692
Length=248

 Score = 237 bits (604),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 151/230 (66%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQVRPF QP+PVT+S++ AVKFKPQL +  GCHPYPAV   G  SGGLK SG     
Sbjct  34   ISHDQVRPFAQPEPVTISERAAVKFKPQLHVTNGCHPYPAVNDAGETSGGLKTSGAPSAG  93

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWI+N
Sbjct  94   CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWINN  146

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + +  +L V+ SA  GYSK +P +   +DGTS+KV Y  N+ + N A  +T + G+FQ
Sbjct  147  PDVPDPIILAVTPSAHSGYSKYSPPNADTLDGTSIKVNYESNYPM-NHATDVTTEGGDFQ  205

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ+S LAR +LN     +  FG A   +P+ DG F   LD+ WPF
Sbjct  206  DLIMWDQMSDLARRALN-----EVSFGDA--NVPMNDGNFVGKLDRAWPF  248

>PHYRA_72386
Length=245

 Score = 236 bits (603),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 149/230 (65%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQVRPF QP+PVT+S++ A+KFKPQL +  GCHPYPAV   G + GGLK +G     
Sbjct  31   ISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTAG  90

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY RS W  D+WAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  91   CKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  143

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + N  +L VS SA  GYSK AP     +DGTS K+ Y  ++ + N AL  T D GEFQ
Sbjct  144  PDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEFQ  202

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+Q+S LAR +LN  +     FG A   +P+ DG F   LDK WPF
Sbjct  203  DLIMWEQMSDLARQALNTMN-----FGDA--NVPMNDGNFVGKLDKAWPF  245

>PHYRA_72344
Length=245

 Score = 236 bits (603),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 149/230 (65%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQVRPF QP+PVT+S++ A+KFKPQL +  GCHPYPAV   G + GGLK +G     
Sbjct  31   ISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTAG  90

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY RS W  D+WAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  91   CKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  143

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + N  +L VS SA  GYSK AP     +DGTS K+ Y  ++ + N AL  T D GEFQ
Sbjct  144  PDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEFQ  202

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+Q+S LAR +LN  +     FG A   +P+ DG F   LDK WPF
Sbjct  203  DLIMWEQMSDLARQALNTMN-----FGDA--NVPMNDGNFVGKLDKAWPF  245

>PHYCA_122048
Length=236

 Score = 236 bits (601),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 145/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H+QV PF QP+  T+SQK A+KFKPQ+ I  GCHPYPAV + G  SGGLK SG     
Sbjct  22   IDHNQVVPFAQPEATTISQKAAIKFKPQIHITNGCHPYPAVNEAGETSGGLKTSGAPSSS  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N  WAIMY+WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  82   CKGSGWGSQVYGRSTWYNGKWAIMYSWYFPKDSPST-------GLGHRHDWEHVVVWIDN  134

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + N T+L  S SA  GYS  AP     VDGTSVKV Y  N  + N AL +T  +GE Q
Sbjct  135  PDVANPTILATSPSAHSGYSFYAPPSSDSVDGTSVKVNYESNWPI-NHALDMTSKSGETQ  193

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQLS  ARY+LN TD     FG A   +P+ DG F   L K WPF
Sbjct  194  DLIMWDQLSEAARYALNTTD-----FGKA--NVPMNDGNFVAKLGKAWPF  236

>PHYSO_526623
Length=249

 Score = 236 bits (601),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 150/231 (65%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PF QP+P T S+KTAVKFKPQL I  GCHPYPAV+ +GS+S GLKW+G  DG+
Sbjct  24   INHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVEANGSVSAGLKWTGWADGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W Y +VW D+
Sbjct  84   CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYASQ----YRSGHRHFWSYAIVWTDS  139

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               +N+T+ GVSMSA +GY K  P   KY VDG +VK   Y++       ++ T  TGE 
Sbjct  140  DKPDNSTIQGVSMSAGVGYGKATPPKSKYVVDGVTVKFDSYFSFWGSKVGIRTTTKTGET  199

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QL+  AR +L   D+D   +    + MPL D VF E L+K +PF
Sbjct  200  QDLITWEQLTDEARTALTDADFD-VDWSYKKVVMPLLDDVFTEKLEKAYPF  249

>PITG_04248
Length=245

 Score = 236 bits (601),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP P T S+  AVK+KPQL +  GC PYPAVQ DGS+S GLK SGP DGE
Sbjct  24   INHDEVKPFAQPKPTTDSEVAAVKYKPQLYVSYGCRPYPAVQADGSVSAGLKGSGPMDGE  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWY PKGR           +  RH WE  VVWID+
Sbjct  84   CEGSPLGSQVYSRSTWYEDKWAIMYAWYLPKGRNTK--------YQRRHFWEAAVVWIDD  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P L N+T+LGVS++    +  +AP + +Y++G++VK+  Y  +      L+ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRHKSKAPLERRYLEGSNVKLESYKGYGKPRPRLRFTQLKGETQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             LI W+QL+  AR +L++  ++  LF     +MPLKDGVFE+ L   +PF
Sbjct  196  HLITWEQLTKEARDALSNAKFNTGLFKRTKREMPLKDGVFEKRLKDAYPF  245

>PHYRA_71404
Length=245

 Score = 234 bits (598),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 148/230 (64%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PFPQPDPVT+S+K  VKFKPQL I  GCH YPAV   G  SGGLK +G     
Sbjct  31   IDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSAG  90

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  91   CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPST-------GIGHRHDWEHVIVWIDN  143

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN  +L V+ SA  GY K AP +   +DGT+ KVA Y +H   + AL  + + G+FQ
Sbjct  144  PDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDFQ  202

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQLS  AR +LN  +     FG A   +P+ DG F+  L + WPF
Sbjct  203  DLIMWDQLSENARRALNSVN-----FGNA--NVPMNDGNFQAKLGRAWPF  245

>PHYRA_72433
Length=245

 Score = 234 bits (597),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 148/230 (64%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PFPQPDPVT+S+K  VKFKPQL I  GCH YPAV   G  SGGLK +G     
Sbjct  31   IDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSAG  90

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  91   CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPST-------GIGHRHDWEHVIVWIDN  143

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN  +L V+ SA  GY K AP +   +DGT+ KVA Y +H   + AL  + + G+FQ
Sbjct  144  PDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDFQ  202

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQLS  AR +LN  +     FG A   +P+ DG F+  L + WPF
Sbjct  203  DLIMWDQLSENARRALNSVN-----FGNA--NVPMNDGNFQAKLGRAWPF  245

>PHYRA_76249
Length=326

 Score = 236 bits (603),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 143/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+P+T+S+K  VKFKPQ+ +  GCHPYPAV + G   GGLK  G     
Sbjct  112  IDHDQVKPFAQPEPITISEKAGVKFKPQIHVTNGCHPYPAVNEAGETGGGLKTKGAPSAG  171

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  172  CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  224

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN  +L V+ SA  GYSKQ P +   VDGTSVKV Y     + N AL+ T   G+FQ
Sbjct  225  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSVKVEYKSKWPI-NHALESTSQGGDFQ  283

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQLS  AR +LN   W            P+ DG F+  L K WPF
Sbjct  284  DLIMWDQLSENARRALNSVPW-------GDANTPMNDGNFQNKLGKAWPF  326

>PHYCA_129784
Length=246

 Score = 233 bits (595),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 146/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PFPQP PVT+S++ A+KFKPQL +  GCHPYPAV   G   GGLK +G     
Sbjct  32   IDHDQVKPFPQPQPVTISERAAMKFKPQLHVVDGCHPYPAVNDAGETGGGLKTTGSPTAG  91

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWI N
Sbjct  92   CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWISN  144

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + N T+L V+ SA  GYSK AP     VDGTS+KV Y   + + N A  +T + GEFQ
Sbjct  145  PDVPNPTILAVTPSAHSGYSKYAPPSADTVDGTSIKVRYESTYPM-NHATDVTTEAGEFQ  203

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ++  AR +LN        FG A +  P+ DG F   LDK WPF
Sbjct  204  DLIMWDQMTDAARNALN-----TVSFGDANV--PMNDGNFVPKLDKAWPF  246

>PHYSO_329843
Length=239

 Score = 233 bits (593),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 145/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF QP+ VT+SQK AVKFKPQ+ I  GCHPYPA  + G  SGGLK +G     
Sbjct  25   IDHDQVVPFAQPEAVTISQKAAVKFKPQIHITNGCHPYPAANEAGQTSGGLKPTGAPSSS  84

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W +  WAIMY+WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  85   CKGSGWGSQVYGRSTWYSGRWAIMYSWYFPKDSPST-------GLGHRHDWEHVVVWIDN  137

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN T+L  S SA  GYS   P     +DGTSVKV  Y +H   N AL +T ++GEFQ
Sbjct  138  PDVENPTILSTSPSAHSGYSYYVPPSADSIDGTSVKVN-YESHWPINHALDMTSESGEFQ  196

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQLS  AR +LN T      FG A   +P+ DG F   L K WPF
Sbjct  197  DLIMWDQLSDAARLALNTTS-----FGSA--NVPMNDGNFLTKLGKAWPF  239

>PHYRA_74307
Length=249

 Score = 233 bits (593),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 157/233 (67%), Gaps = 10/233 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PF QP+P T S+KTAVKFKPQL I  GCHPYPAV  +GS++ GLKW+G  DG+
Sbjct  24   IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWADGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWI  139
            C GS LGSQ+Y+RS    D WAIMYAWYFPKGR       ++  +  GHRH W Y +VW 
Sbjct  84   CKGSGLGSQVYSRSDSYKDKWAIMYAWYFPKGR------QYIHKYHSGHRHYWSYGIVWT  137

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTG  198
            D+   +N+T+LGVSMSA +GY K +P   K+V DGT+VK   Y +       ++LT+ TG
Sbjct  138  DSSSPDNSTILGVSMSAGVGYRKVSPPKSKFVIDGTTVKFDSYKSFWGSKQGVRLTKKTG  197

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            + QDLI W+Q++  AR +L  TD+D   + L  + MPL D  F E L+K++PF
Sbjct  198  DTQDLITWEQMTEEARTALVDTDFD-VEWSLKKVVMPLSDDAFTERLEKSYPF  249

>PHYCA_107869
Length=342

 Score = 236 bits (601),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 144/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+K AVK+KPQ+ I  GCHPYPAV + G  SGGLK  G     
Sbjct  128  IDHDQVKPFAQPEPVTISEKAAVKYKPQIHIVNGCHPYPAVNEAGETSGGLKTKGAPSAG  187

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS WV  VWAIMY+WYFPK   ++         GHRH+WE+V+VWIDN
Sbjct  188  CKGSGWGSQVYGRSTWVRGVWAIMYSWYFPKDSPSS-------GLGHRHDWEHVIVWIDN  240

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN  +L V+ SA  GYSKQ P     VDGTSVKV Y     + N AL  T + G+FQ
Sbjct  241  PDIENPKILAVTPSAHSGYSKQVPPKADCVDGTSVKVKYESKWPV-NHALDSTSEGGDFQ  299

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQLS  AR ++N   W +          P  DG F   LDK WPF
Sbjct  300  DLIMWDQLSENARRAMNGVGWGKA-------NTPFNDGNFLPKLDKAWPF  342

>PHYKE_2376
Length=322

 Score = 234 bits (598),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 144/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+K  VKFKPQ+ I  GCHPYPAV + G  SGGLK  G     
Sbjct  108  IDHDQVKPFGQPEPVTISEKAGVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAG  167

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W NDVWAIMY+WYFPK   +T         GHRH+WE+V++WIDN
Sbjct  168  CKGSGWGSQVYGRSGWKNDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIIWIDN  220

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN  +L V+ SA  GYS   P +   +DGTS KV  Y +H   N AL  T + G+FQ
Sbjct  221  PDVENPRILAVTPSAHSGYSTYRPPNADTLDGTSAKV-NYESHWPVNHALDSTSEGGDFQ  279

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ++  AR +LN   W           +P+ DG F   LDK WPF
Sbjct  280  DLIMWDQMTDNARRALNEVSW-------GDANVPMNDGNFGPKLDKAWPF  322

>PHYRA_74343
Length=249

 Score = 232 bits (591),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 150/231 (65%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PF QP+P T S+KTAVKFKPQL I  GCHPYPAV  +GS++ GLKW+G  DG+
Sbjct  24   IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWDDGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR  T         GHRH W Y +VW D+
Sbjct  84   CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTSA----YRTGHRHYWSYGIVWTDS  139

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               +N+T+LGVSMSA +G+ K  P   KY VDGT+VK   + +       ++LT   GE 
Sbjct  140  SSPDNSTILGVSMSAGVGFGKATPPKSKYVVDGTTVKFDSFRSFWGSKMGVKLTTKEGEM  199

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+Q++  AR +L   D+D   + +  + MP+ D VF   L K +PF
Sbjct  200  QDLITWEQMTEEARTALTDADFD-VDWSVRKVVMPMSDDVFMTKLKKAYPF  249

>PPTG_17409
Length=235

 Score = 231 bits (588),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 146/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+K AVKFKPQL I  GCHPYPAV   G   GGLK +G   G 
Sbjct  21   IDHDQVQPFAQPEPVTISEKAAVKFKPQLHITNGCHPYPAVNAAGDTGGGLKPTGAPSGS  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   ++         GHRH+WE VV+WI+N
Sbjct  81   CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSSS-------LGHRHDWENVVIWINN  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + N  +L +  SA  GYS+ AP D   +DGTS KV  Y +H   N A   T + G+FQ
Sbjct  134  PDVPNPVILAICPSAHGGYSRYAPPDADTIDGTSAKVN-YESHWPINHATDTTSEGGDFQ  192

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQL+  AR +L  TD     FG A   +P+K+G F   L+K WPF
Sbjct  193  DLIMWDQLTDAARTALQDTD-----FGDA--NVPMKEGSFLSNLEKAWPF  235

>PHYSO_507736
Length=236

 Score = 231 bits (588),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/249 (52%), Positives = 155/249 (62%), Gaps = 15/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R + VAA+A L  + A VI HDQV PF QP P + SQ  AVKFKPQL I  GCHPYP
Sbjct  1    MNLRRLVVAAVAFLTASHASVIDHDQVVPFAQPTPTSTSQTAAVKFKPQLHITNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV  DG+ SGGL  +G     C GS  GSQIY RS W N VWAIMY+WYFPK   A+   
Sbjct  61   AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                 FGHRH+WE++VVW++NP + +  +L VS SA  GY+   P    Y+DG S K+  
Sbjct  118  ----GFGHRHDWEHIVVWLNNPAVTSPELLAVSTSAHSGYTTYYPPSSSYLDGNSAKID-  172

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            YYN LL N A ++T D+GE QDLI WDQL+  AR +L +TD     FG A   +P KD  
Sbjct  173  YYNVLLINHAFRMTSDSGETQDLIMWDQLTDAARTALENTD-----FGDA--NVPFKDAN  225

Query  241  FEELLDKTW  249
            FE  L   W
Sbjct  226  FETKLANAW  234

>PHYRA_71477
Length=238

 Score = 231 bits (589),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 147/230 (64%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V PFPQP+PVT+S+K AV+FKP++ I  GCHPYPAV + G  SGGL+ +G    +
Sbjct  24   IGHDEVVPFPQPEPVTISEKAAVRFKPEIHITNGCHPYPAVSEAGMTSGGLQATGGPSSK  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W + VWAIMY WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  84   CKGSGWGSQMYGRSTWYSGVWAIMYTWYFPKDSPSTR-------LGHRHDWEHVVVWIDN  136

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + N  +L VS SA  GYSK  P     VDGTSVK+  Y +H   N AL  T  +GEFQ
Sbjct  137  PDVSNPILLAVSPSAHSGYSKYVPPSADSVDGTSVKIN-YESHWPVNHALDTTSKSGEFQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W Q+S  AR +LN TD+ + +       MP+ DG F   L   WP+
Sbjct  196  DLIMWHQMSDAARLALNTTDFGKAI-------MPMNDGSFLGKLAGAWPW  238

>PHYCA_108039
Length=215

 Score = 230 bits (586),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 142/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HDQV+PF QPDPVTVS+K AVKFKPQ+ I  GCHPYPAV   G  SGGLK  G     
Sbjct  1    MDHDQVQPFKQPDPVTVSEKAAVKFKPQIHITNGCHPYPAVTWWGETSGGLKTKGAPSAG  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS WV  VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  61   CKGSGWGSQVYGRSTWVKGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  113

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN  +L V+ SA  GYSKQ P     VDGTSVKV Y     + N AL+ T + GE Q
Sbjct  114  PDIENPKILAVTPSAHSGYSKQVPPSADCVDGTSVKVKYESKWPI-NHALESTTEGGETQ  172

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+QLS  A  ++N   W            P  DG F+  LDK WPF
Sbjct  173  DLIMWNQLSENALRAMNSVTWGDA-------NCPFCDGNFQAKLDKAWPF  215

>PPTG_15230
Length=252

 Score = 231 bits (589),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 147/230 (64%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHDQV+PF QP PVT+S++ A+KFKPQ+ I  GCHPYPAV   G   GGLK +G     
Sbjct  38   IGHDQVKPFAQPQPVTISERAAIKFKPQIHIGDGCHPYPAVNDIGETGGGLKTTGSPTAG  97

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWI+N
Sbjct  98   CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWINN  150

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + +  +L V+ SA  GYSK AP +   +DGTSVKV Y   + + N A  +T D GEFQ
Sbjct  151  PDVPDPIILAVTPSAHSGYSKYAPPNADTLDGTSVKVNYESTYPM-NHATDVTTDPGEFQ  209

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ++  AR +LN        FG A   +P+ DG F   LDK WPF
Sbjct  210  DLIMWDQMTDAARLALN-----TVSFGDA--NVPMNDGNFIPKLDKAWPF  252

>PITG_04200
Length=247

 Score = 230 bits (587),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 151/231 (65%), Gaps = 9/231 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP P T S+K AVK+KP+L +  GCHPYPAVQ +G +S GLK SGP DGE
Sbjct  24   INHDEVKPFAQPTPTTDSEKAAVKYKPKLYVSYGCHPYPAVQANGFVSAGLKGSGPIDGE  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWY PKGR++         +  RH WE  VVWID+
Sbjct  84   CEGSSLGSQVYSRSMWYEDKWAIMYAWYLPKGRSSK--------YQRRHFWEAAVVWIDD  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P L N+T+LGVS++       + P +++++DG++VK+  Y         LQ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRQKSEVPLELQFLDGSNVKLESYRGFGRPRPRLQFTQLEGETQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTL-FGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+QL+  AR  L+  +++  L F     +MPLKDGVFE+ L   +PF
Sbjct  196  DLITWEQLTDEARDGLSDAEFNTGLFFKRTRREMPLKDGVFEKRLIDAYPF  246

>PHYRA_42876
Length=213

 Score = 228 bits (582),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 141/228 (62%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+P+T+S+K+ VKFKPQ+ +  GCHPYPAV   G   GGLK  G     
Sbjct  1    IDHDQVQPFAQPEPITISEKSGVKFKPQIHVTNGCHPYPAVNYKGETGGGLKTKGAPSAG  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y R+AW  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  61   CKGSGWGSQVYGRAAWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  113

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN  +L V+ SA  GYSKQ P +   VDGTS KV Y     + N AL+ T   G+FQ
Sbjct  114  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSAKVEYKSKWPI-NHALESTSQGGDFQ  172

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQLS  AR +LN   W            P+ DG F   LDK W
Sbjct  173  DLIMWDQLSENARRALNSVPWGDA-------NTPMNDGNFLPKLDKAW  213

>PHYCA_11951
Length=234

 Score = 228 bits (582),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 145/227 (64%), Gaps = 15/227 (7%)

Query  23   GHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGEC  82
            GHDQV PF QP P ++SQ TAV FKPQL I  GCHPYPAV  DG+ SGGL  +G     C
Sbjct  21   GHDQVVPFAQPTPTSISQTTAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPAGSSSAGC  80

Query  83   TGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNP  142
             GS  GSQIY RSAW N VWAIMY+WYFPK   ++        FGHRH+WE++VVW+DNP
Sbjct  81   KGSGYGSQIYGRSAWYNGVWAIMYSWYFPKDSPSSG-------FGHRHDWEHIVVWLDNP  133

Query  143  GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
             + +  +L VS SA  GY+   P +  Y++G S K+  YY+ LL N A ++T D GE Q+
Sbjct  134  AVASPKILAVSTSAHSGYTVYYPPNSNYLNGKSAKID-YYSILLINHAFRMTSDAGETQN  192

Query  203  LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            LI WDQ++  AR +L +TD     FG A   +P KDG FE  L   W
Sbjct  193  LIMWDQMTDAARTALQNTD-----FGDA--NVPFKDGNFESKLANAW  232

>PITG_04267
Length=279

 Score = 230 bits (586),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 154/232 (66%), Gaps = 8/232 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF Q  P T S+K+A+K+KPQL I  GCHPYPAVQ +GS+SGGLKWSG  +G+
Sbjct  54   INHDQVQPFEQIKPATDSEKSAIKYKPQLHISDGCHPYPAVQSNGSISGGLKWSGKANGD  113

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF-FGHRHNWEYVVVWID  140
            C    LGSQ+Y+RSAW    WAIMYAWYFPKG     P   LRF  GHRH W Y ++W D
Sbjct  114  CKEPGLGSQVYSRSAWFKGKWAIMYAWYFPKG-----PQFVLRFDTGHRHFWSYAILWTD  168

Query  141  NPGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            +P  +N+T+LGVSMS S GY K++    KY V GT+VK+  Y +  +G  ALQLT+  GE
Sbjct  169  DPNHDNSTILGVSMSGSRGYVKESSPKAKYIVKGTTVKLDSYASFWMGVQALQLTKKLGE  228

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W+QL+  A  +L   D++      A + MPL D  F  +L  ++PF
Sbjct  229  TQDLITWEQLTDEACDALTEFDFESDP-SRAMVVMPLGDDNFTPILKDSYPF  279

>PHYCA_123779
Length=277

 Score = 229 bits (584),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 142/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF QP+PVT+S K A+KFKPQL I  GCHPYPAV   G  SGGLK SG     
Sbjct  59   IDHDAVVPFKQPEPVTISDKAAIKFKPQLHITNGCHPYPAVNAIGQTSGGLKTSGAPSAG  118

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  119  CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  171

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +LGV+ SA  GYS Q P D   VDG+SVKV Y     + N AL+ T + G+FQ
Sbjct  172  PEVPEPKILGVTPSAHSGYSSQVPPDADKVDGSSVKVKYLSKWPI-NHALESTGEGGDFQ  230

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W Q++  AR  L+ T W +         +P+ DG FE  L K WPF
Sbjct  231  DLIMWTQMTDAAREGLSKTGWGKA-------NVPMVDGNFEAKLGKAWPF  273

>PHYRA_71308
Length=236

 Score = 227 bits (578),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 151/249 (61%), Gaps = 15/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R + V+A   L      VI HD V PF QP P +VSQ  AV FKPQL I  GCHPYP
Sbjct  1    MNLRGLLVSAAVGLTAIYGAVIDHDTVVPFAQPTPTSVSQIAAVNFKPQLHITNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV  DG+ SGGL  +G     C GS  GSQIY RS W N VWAIMY+WYFPK   A+   
Sbjct  61   AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                 FGHRH+WE++VVW++NP + +  +L VS SA  GY+   P D+ Y+DG S K+  
Sbjct  118  ----GFGHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPPDLDYLDGNSAKID-  172

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            YY+ LL N A ++T DTGE QDLI WDQL+  AR +L  TD     FG A   +P KD  
Sbjct  173  YYSVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTD-----FGDA--NVPFKDTN  225

Query  241  FEELLDKTW  249
            FE  L   W
Sbjct  226  FETKLANAW  234

>PHYRA_74310
Length=249

 Score = 227 bits (578),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 149/231 (65%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PF QP+P T S+KTAVKFKPQL I  GCHPYPAV  +GS++ GLKW+G  DG+
Sbjct  24   IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVDANGSVNAGLKWAGWADGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS +GSQ+Y+RS W  D WAIMYAWYFPKGR  T         GHRH W Y +VW D+
Sbjct  84   CKGSAMGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTSK----YRAGHRHYWSYGIVWTDS  139

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               +N+T+LGVSMSA +G+ K  P   KYV DGT+VK   +++       ++LT   G  
Sbjct  140  SSPDNSTILGVSMSAGVGFGKATPPKSKYVIDGTTVKFDSFWSFWGSKLGVKLTTKEGAT  199

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            Q LI W+Q++  AR +L   D+D   +    + MP+ D VF + L K +PF
Sbjct  200  QALITWEQMTEEARTALTDADFD-VDWSFRKVVMPMSDDVFTKKLKKAYPF  249

>PHYRA_72438
Length=236

 Score = 226 bits (576),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 150/249 (60%), Gaps = 15/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R + V+A   L      VI HD V PF QP P +VSQ  AV FKPQL I  GCHPYP
Sbjct  1    MNLRGLLVSAAVGLTAIYGAVIDHDTVVPFAQPTPTSVSQVAAVNFKPQLHITNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV  DG+ SGGL  +G     C GS  GSQIY RS W N VWAIMY+WYFPK   A+   
Sbjct  61   AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                 FGHRH+WE++VVW++NP + +  +L VS SA  GY+   P D  Y+DG S K+  
Sbjct  118  ----GFGHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPPDSDYLDGNSAKID-  172

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            YY+ LL N A ++T DTGE QDLI WDQL+  AR +L  TD     FG A   +P KD  
Sbjct  173  YYSVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTD-----FGDA--NVPFKDTN  225

Query  241  FEELLDKTW  249
            FE  L   W
Sbjct  226  FETKLANAW  234

>PHYSO_526071
Length=249

 Score = 226 bits (575),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 149/233 (64%), Gaps = 10/233 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+P  QP+P T S+KTAVK+KPQL I  GCHPYPAVQ DGS+S GLKWSG  +G+
Sbjct  24   INHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWANGK  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWI  139
            C GS LGSQ+Y+RS W    WAIMYAWYFPKGR       ++  +  GHRH W Y +VW 
Sbjct  84   CKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGR------QYVSKYRKGHRHFWSYAIVWT  137

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTG  198
            D+   +N+T+ GVSMSA +G+ K  P   KYV DG +VK   Y++       ++ T  TG
Sbjct  138  DSDKPDNSTIQGVSMSAGVGFRKATPPKSKYVIDGVTVKFDSYFSFWGSKVGIRTTTKTG  197

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            E QDLI W+QL+  AR  L + D+D   +    + MPL D  F + L K +PF
Sbjct  198  ESQDLITWEQLTDEARTGLTNADFD-VDWSYRKVVMPLSDEDFTDKLKKAYPF  249

>PHYSO_510888
Length=255

 Score = 225 bits (574),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 147/230 (64%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFPQPDPVT+S+K AVKFKPQ+ I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  40   IGHDEVKPFPQPDPVTISEKAAVKFKPQIDIVTGCVPYPAVNDAGETSGGLQTSGSPRGG  99

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W+N VWAIMY+WYFPK   ++         GHRH+WE+VVV+IDN
Sbjct  100  CRGSGHGSQVYGRSTWINGVWAIMYSWYFPKDAPSSK-------MGHRHDWEHVVVFIDN  152

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +LG S S   GY+K AP     +DGTSVKV Y ++  L N AL+ T   G FQ
Sbjct  153  PDVPEPKILGCSPSWHNGYNKYAPCPANVIDGTSVKVKYEHSWPL-NHALETTTKPGAFQ  211

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+Q++  AR +LN      T FG A    P+ D  F   ++K WPF
Sbjct  212  DLIMWNQMTDFARRALN-----DTKFGKA--NTPMNDWNFLPKVEKAWPF  254

>PPTG_15224
Length=246

 Score = 224 bits (572),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 147/230 (64%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF +  P T S+K AVK+KP++ +  GCHPYPAVQ DGS+S GLK +GP DGE
Sbjct  24   INHDQVQPFDELKPTTDSEKAAVKYKPKVYVSYGCHPYPAVQADGSVSAGLKGTGPIDGE  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS+W    WAIMYAWY PKG A   P         RH WE  VVWID+
Sbjct  84   CGGSDLGSQVYSRSSWYKGKWAIMYAWYLPKGWAYRSP--------RRHFWETAVVWIDD  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N+++LGV++++ +   K  P + +YVDG+SV++            L+ T  +GE Q
Sbjct  136  PSPTNSSILGVTLNSGLRRKKYVPVERQYVDGSSVQLESCKGRGRPRPMLRFTTISGESQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+QL+  ARY+L + ++D   F      MPLKD  FE+ L+  WPF
Sbjct  196  DLIMWEQLTDKARYALANAEFDTGFFKKKRRNMPLKDDRFEKGLEDAWPF  245

>PHYKE_5753
Length=238

 Score = 222 bits (566),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 139/229 (61%), Gaps = 14/229 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF Q    +++   A+KFKPQ+ I+ GCHPYPAV  +G  SGGLK SG +   
Sbjct  22   ISHDQVIPFAQSAATSITNTVALKFKPQIFINNGCHPYPAVNGNGDTSGGLKPSGSESAG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N+VWAIMY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  82   CKGSGYGSQVYGRSTWYNNVWAIMYSWYFPKDNPVT-------GMGHRHDWEHVVVWIDN  134

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN T+L V+ SA  GYS  AP D   VDG S KV Y  + ++ N  L  T   GEFQ
Sbjct  135  PAMENPTILAVTPSAHSGYSTYAPPDPSTVDGASAKVQYTSSWIVINHHLDTTSTAGEFQ  194

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
            DLI W  L+  AR +LN  D++          +P+KDG FE  L   +P
Sbjct  195  DLIMWGDLTDAARNALNTADFE-------AANVPMKDGNFESKLGNAYP  236

>PHYKE_4438
Length=339

 Score = 226 bits (575),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 143/234 (61%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H +V+PFPQP+P+T+S++ AVKFKPQL I  GCH YPAV   G  SGGLK +G   G+
Sbjct  124  ISHSEVQPFPQPEPITISERAAVKFKPQLHISNGCHAYPAVNGAGETSGGLKTTGAPSGK  183

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V++WI+N
Sbjct  184  CKGSGYGSQVYGRSGWHKDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIIWINN  236

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY----YNHLLGNTALQLTEDT  197
            P + +  +L V+ SA  GYS  AP     +DG + KV Y      NH LG     +T   
Sbjct  237  PEVADPKILAVTPSAHSGYSTYAPPPADSMDGVAAKVNYESFWPVNHALG-----MTTKG  291

Query  198  GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            G+FQDLI WDQL+  AR +LN  +W           +P+ DG F   LDK WPF
Sbjct  292  GDFQDLIMWDQLTDNARRALNEVNW-------GAANVPMNDGNFGGKLDKAWPF  338

>PPTG_15233
Length=235

 Score = 221 bits (564),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 140/228 (61%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF QP P +VSQ  A  FKPQL I  GCHPYPAV  DG+ SGGL  +G     
Sbjct  21   IDHDQVVPFAQPTPTSVSQIAAFNFKPQLHITNGCHPYPAVDTDGNTSGGLNPTGSSSAG  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY RS W N VWAIMY+WYFPK   A+        FGHRH+WE++VVW++N
Sbjct  81   CKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPASG-------FGHRHDWEHIVVWLNN  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + +  +L VS SA  GY+   P    Y+DG S K+  YY+ LL N + ++T D+GE Q
Sbjct  134  PAVTSPEILAVSTSAHSGYTVYYPPSSDYLDGNSAKID-YYSVLLINHSFRMTSDSGETQ  192

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQL+  AR +L  TD     FG A   +P KD  FE  L   W
Sbjct  193  DLIMWDQLTDAARTALEDTD-----FGDA--NVPFKDANFETKLANAW  233

>PPTG_06973
Length=165

 Score = 219 bits (557),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 128/166 (77%), Gaps = 3/166 (2%)

Query  86   RLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLE  145
            RL SQ+YAR+ WV D WAIMYAW+FPK RA   P   LRF GHRH WEY +VW+D P  +
Sbjct  3    RLDSQVYARTTWVKDKWAIMYAWFFPKARA---PFPVLRFLGHRHGWEYAIVWLDKPNAD  59

Query  146  NATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQ  205
            N+T+LGVS+SA+ G++K+AP   KY+DG S+KVAYYYNH+ GNTA++ T++TGEFQDLI 
Sbjct  60   NSTILGVSVSAAAGWAKEAPPPEKYLDGNSLKVAYYYNHIYGNTAVKYTDETGEFQDLIT  119

Query  206  WDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            W+QLS LAR  LN+TDWD+T    A LKMP+KDGVF + L   +PF
Sbjct  120  WNQLSDLARSYLNNTDWDETPLNAALLKMPMKDGVFMKKLKSAYPF  165

>PPTG_08017
Length=616

 Score = 232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 144/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V PF QP+PVT+++K A+KFKPQL I  GCH YPAV   G  SGGLK +G     
Sbjct  400  IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHITNGCHAYPAVNVGGQTSGGLKTTGAPSAG  459

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  460  CKGSGWGSQVYGRSTWHNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  512

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L V+ SA  GYS Q P D   VDG SVKV Y     + N AL+ T + G++Q
Sbjct  513  PEIAEPKILAVTPSAHSGYSAQVPPDANKVDGNSVKVKYLSKWPI-NHALESTGEAGDYQ  571

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+QL+  AR +L +T       G     +P+KDG F   LDK WPF
Sbjct  572  DLIMWEQLTDAARLALQNT-------GFGKANVPMKDGNFVSKLDKAWPF  614

>PPTG_17245
Length=257

 Score = 221 bits (562),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 158/237 (67%), Gaps = 11/237 (5%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF + +P T S+K+A+K+KPQL I  GC+PYPAVQ +G++SGGLKWSG  + +
Sbjct  24   INHDQVQPFEEMEPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C     GSQIY+RS W    WAIMYAWYFPKG  A     + R  GHRH W   +VW DN
Sbjct  84   CEKPVQGSQIYSRSDWYKGKWAIMYAWYFPKG--AFRASKYNR--GHRHFWSSAIVWTDN  139

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVD-GTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               +N+T+LGVSMS S GY K+     KY++ GT++K+  Y    L N AL+LT+ +G  
Sbjct  140  TNPDNSTILGVSMSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGT  199

Query  201  QDLIQWDQLSSLARYSLNHTDWD----QTLFGLAG--LKMPLKDGVFEELLDKTWPF  251
            QDL+ W+QL+  AR +L+  D+D      +F  +G  + MPL+DGVF  +L++++PF
Sbjct  200  QDLVTWEQLTDEARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  256

>PHYSO_468315
Length=255

 Score = 220 bits (561),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 142/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+ VT+S+K AVKFKPQL I  GCH YPAV + G  SGGLK  G     
Sbjct  39   IDHDQVKPFAQPESVTISEKAAVKFKPQLHITNGCHAYPAVDEAGQTSGGLKTKGAPSAG  98

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY WYFPK   ++         GHRH+WE+VVVWIDN
Sbjct  99   CKGSGWGSQVYGRSGWYQDVWAIMYCWYFPKDEPSS-------GIGHRHDWEHVVVWIDN  151

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +EN  +L  + SA  GY K AP +   VDG + KVA + +H   + AL  T + G+FQ
Sbjct  152  PDVENPKILAGTPSAHSGYHKYAPPNAGTVDGVTTKVA-FESHWPMDHALDSTTEGGDFQ  210

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQL+  AR +LN        FG A    P+ DG F+  L + WPF
Sbjct  211  DLIMWDQLTDNARRALN-----SVSFGSA--DTPMNDGNFQAELGRAWPF  253

>PHYSO_406265
Length=232

 Score = 219 bits (558),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 143/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V PF QP+PVT+S++ AVKFKPQL I  GCH YPAV + G  SGGLK +G    +
Sbjct  18   IGHDEVVPFKQPEPVTISERAAVKFKPQLHISNGCHAYPAVNELGETSGGLKKTGAPSSK  77

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   ++         GHRH+WE+V+VWIDN
Sbjct  78   CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSS-------GLGHRHDWEHVIVWIDN  130

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L V+ SA  GYS Q P D   VDG SVKV Y     + N AL+ T   G++Q
Sbjct  131  PDMPEPKILAVTPSAHSGYSAQVPPDADKVDGPSVKVNYESKWPI-NHALESTTKGGDYQ  189

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W Q++  AR +L     D T FG A   +P+  G F   L K WPF
Sbjct  190  DLIMWTQMTDAARQAL-----DNTNFGSA--NVPMNSGNFLGKLGKAWPF  232

>PHYCA_9358
Length=252

 Score = 219 bits (559),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 146/236 (62%), Gaps = 21/236 (9%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V PF QP+PVT+++K A+KFKPQL I  GCH YPAV   G  SGGLK +G     
Sbjct  31   IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHISNGCHAYPAVNIGGQTSGGLKTTGAPSAG  90

Query  82   CTGSRLGSQIYARSAW------VNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYV  135
            C GS  GSQ+Y RS W       N +WAIMY+WYFPK   +T         GHRH+WE+V
Sbjct  91   CKGSGWGSQVYGRSTWHNVPSPHNGIWAIMYSWYFPKDSPST-------GLGHRHDWEHV  143

Query  136  VVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTE  195
            +VWIDNP +    +L V+ SA  GYS Q P D   V+GTSVKV Y     + N AL  T 
Sbjct  144  IVWIDNPEIAEPKILAVTPSAHSGYSAQVPPDADKVEGTSVKVNYESKWPI-NHALGSTT  202

Query  196  DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              G++QDLI W+QL+  AR +L +TD     FG A   +P+KDG F   L+K WPF
Sbjct  203  KGGDYQDLIMWEQLTDAARLALENTD-----FGKA--NVPMKDGNFVGKLNKAWPF  251

>PPTG_07089
Length=255

 Score = 219 bits (558),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 148/230 (64%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H +V+PF +P PVT+S+K  VKFKPQ+ +  GC PYPAV +DG  SGGL+ SG   G 
Sbjct  39   ISHKEVKPFAEPKPVTISEKAGVKFKPQIAVKTGCVPYPAVNEDGETSGGLQTSGSPQGG  98

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N +WAIMY+WYFPK   ++         GHRH+WE++VV+IDN
Sbjct  99   CRGSGHGSQVYGRSTWFNGLWAIMYSWYFPKDAPSSR-------MGHRHDWEHIVVFIDN  151

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +LG S S   GY+K AP     +DG+SVKV Y ++  L N AL +T++ G+FQ
Sbjct  152  PEVPEPKILGCSPSWHSGYNKYAPCPADVIDGSSVKVKYEHSWPL-NHALDITKEAGDFQ  210

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ+S LAR +LN T      FG A    P+ D  F   ++K+WPF
Sbjct  211  DLIMWDQMSDLARRALNDTK-----FGKA--NTPMNDWNFLGKVEKSWPF  253

>PPTG_19330
Length=316

 Score = 221 bits (563),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 138/230 (60%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PFPQP PVT+S+K AVKFKPQL I  GCH YPAV + G  SGGLK  G     
Sbjct  102  IDHDQVKPFPQPQPVTISEKAAVKFKPQLHITNGCHSYPAVDEAGQTSGGLKTKGAPSAG  161

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS+W   VWAIMY WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  162  CKGSGWGSQVYGRSSWYQGVWAIMYCWYFPKDEPST-------GIGHRHDWEHVIVWIDN  214

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + N  +L V+ SA  GY K AP +   +DG + KVA Y +H   + AL  T + G+FQ
Sbjct  215  PEIANPKILAVTPSAHSGYHKYAPPNPDTIDGATTKVA-YESHWPMDHALGSTSEAGDFQ  273

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W QLS  A  +LN   W            P+ DG F   L K WPF
Sbjct  274  DLIMWGQLSENASRALNAVYW-------GNANTPMNDGNFLPKLAKAWPF  316

>PHYRA_71618
Length=243

 Score = 219 bits (557),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 153/235 (65%), Gaps = 20/235 (9%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QPDPVTVS+K AV+FKP L+ID+GCHPYPAV   G  S GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P F +  G RH+W  VVVW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVWLDN  136

Query  142  PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYY---NHLLGNTALQLTEDT  197
            P LE  T++GVS S+ +  YSK  P     ++GT+  + Y     NH  G  ++  T  T
Sbjct  137  PALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNH--GFHSVDTTWKT  194

Query  198  -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             GEFQDLI W+QL+  AR +LN TD     FG   L +P  D  F+  L+K WP+
Sbjct  195  GGEFQDLIMWEQLTDEARAALNDTD-----FGEHAL-VPFIDANFKANLEKAWPY  243

>PITG_22668
Length=519

 Score = 227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 140/230 (61%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF Q +PVT+S+K AVKFKPQL I  GCHPYPAV   G  SGGLK SG     
Sbjct  304  IDHDAVVPFKQTEPVTISEKAAVKFKPQLHITGGCHPYPAVNAIGQTSGGLKTSGAPSAG  363

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  364  CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  416

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P L    +L VS SA  GYS Q P D   V+GTSVKV Y     + N AL+ T + G++Q
Sbjct  417  PELAEPKILAVSPSAHGGYSAQVPPDANKVEGTSVKVKYLSKWPI-NHALESTGEGGDYQ  475

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W Q++  AR  L+ T       G     +P+ DG FE  L + WPF
Sbjct  476  DLIMWGQMTDAAREGLSRT-------GFGKANVPMNDGNFESKLGRAWPF  518

>PHYRA_71931
Length=239

 Score = 218 bits (555),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 141/228 (62%), Gaps = 15/228 (7%)

Query  24   HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
            HDQV+PF QP+P T+S+K  VKFKPQ+ I  GCHPYPAV  +G   GGLK +G     C 
Sbjct  25   HDQVQPFAQPEPATISEKAGVKFKPQIHITNGCHPYPAVNWNGDTGGGLKPTGAPSSSCK  84

Query  84   GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
            GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+VVVWI NP 
Sbjct  85   GSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVVVWITNPD  137

Query  144  LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
            +EN  +L VS SA  GYS         +DGT+VKV  Y +H   N AL +T + G+ QDL
Sbjct  138  VENPVILAVSPSAHSGYSYYVSPSADTIDGTAVKVN-YESHWPINHALDITTEGGDTQDL  196

Query  204  IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            I WDQ++  AR SLN        FG A   +P+ DG F+  L K WP+
Sbjct  197  IMWDQMTDAARNSLN-----TVSFGDA--NVPMNDGNFQNKLGKAWPW  237

>PYVX_22467
Length=236

 Score = 218 bits (554),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 150/249 (60%), Gaps = 15/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R +  AA+A LA A A VI HDQV PF QP   + S K AVKFKPQL I  GCHPYP
Sbjct  1    MNLRYLLAAAVALLAGACASVIDHDQVVPFAQPTATSTSHKAAVKFKPQLHISDGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV   G+ SGGLK SG     C GS  GSQIY RS W N VWAIMY+WYFPK   +T   
Sbjct  61   AVDSSGNTSGGLKPSGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPST---  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                  GHRH+WE+VVVWI NP +++ TV  VS SA  GYS   P    Y+DG S K+  
Sbjct  118  ----GLGHRHDWEHVVVWISNPAVDSPTVYAVSTSAHSGYSIYYPPSSSYMDGNSAKID-  172

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            Y+  ++ N A ++T   GE QDLI WDQ++  AR +L +TD     FG A   +P KDG 
Sbjct  173  YFKIVVINHAFRMTSSAGETQDLIMWDQMTDAARIALENTD-----FGDA--NVPFKDGN  225

Query  241  FEELLDKTW  249
            F   L   W
Sbjct  226  FMTKLASAW  234

>PHYSO_414520
Length=213

 Score = 217 bits (552),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 143/228 (63%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PFPQP+PVT+S+K A+KFKPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  1    INHDAVKPFPQPEPVTISEKAAIKFKPQIRIATGCVPYPAVNDVGETSGGLQTSGSPKGG  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y R+ W NDVWAIMY+WYFPK   ++         GHRH+WE+VVVWI+N
Sbjct  61   CRGSGHGSQVYGRAGWFNDVWAIMYSWYFPKDSPSS-------RMGHRHDWEHVVVWINN  113

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +LG+S SA  GY K +    + +DG SVKV Y +   + N AL  T+  G FQ
Sbjct  114  PDVPEPKILGISASAHSGYKKYSSPPPENLDGNSVKVNYEHAWPI-NHALDTTDKAGTFQ  172

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI W+Q++  AR +LN        FG A    P+ DG F   L++ W
Sbjct  173  DLIMWEQMTEDARRALN-----AVHFGKA--NTPMNDGNFRHKLERAW  213

>PHYKE_4946
Length=263

 Score = 218 bits (555),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 147/230 (64%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H  V+PF QP+P+T+S+K AVKFKPQL I +GC  YPAV   G  SGGL+ SG   G 
Sbjct  49   IPHKDVKPFIQPEPITISEKAAVKFKPQLAILSGCVSYPAVNDIGETSGGLQESGSPKGG  108

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W +DVWAIMY+WYFPK   ++         GHRH+WE+VVVWIDN
Sbjct  109  CRGSGHGSQVYGRSVWYSDVWAIMYSWYFPKDSPSS-------RLGHRHDWEHVVVWIDN  161

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L VS S   G+ K AP     +DGTSVKV Y ++  L N AL +T+  G+FQ
Sbjct  162  PEVLEPKILAVSPSYHSGHKKYAPPSADVIDGTSVKVKYEHSWPL-NHALDVTDKAGDFQ  220

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ++ LAR +LN     +T FG A +  P+ D  F   L++ WPF
Sbjct  221  DLIMWDQMTDLARVALN-----ETKFGKANV--PMNDHNFLRKLEQAWPF  263

>PHYRA_72345
Length=240

 Score = 216 bits (550),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 151/251 (60%), Gaps = 14/251 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN RA+    +ASLA  Q  VIGHDQV PFPQ  P +++   A+ FKPQ+ I+ GCHPYP
Sbjct  1    MNLRALTTVVLASLASVQGAVIGHDQVVPFPQSQPTSITNTAALLFKPQIWINNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
             V  +G   GGLK +G     C GS  GSQ+Y RSAW N VWAIMY+WYFPK      P 
Sbjct  61   VVNANGDTGGGLKTTGSSAAGCRGSGYGSQVYGRSAWYNGVWAIMYSWYFPKDE----PQ  116

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
            DF    GHRH+WE+VVVWIDNP   N  +L ++ SA  GYS  AP D   VDGTS KV Y
Sbjct  117  DFT---GHRHDWEHVVVWIDNPQNTNPKILAMTPSAHSGYSTYAPPDADMVDGTSCKVEY  173

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              + L  +  L+ T   GE QDLI W  ++  ARY+LN T+     FG A    P+ DG 
Sbjct  174  TSSWLFIDHHLEGTSTAGETQDLIMWGDMTDAARYALNTTN-----FGKA--NTPMNDGN  226

Query  241  FEELLDKTWPF  251
            F   L K +P+
Sbjct  227  FLPKLGKAYPW  237

>PPTG_12847
Length=331

 Score = 219 bits (558),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 144/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGL+ SG   G 
Sbjct  115  IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGG  174

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  175  CRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSS-------RMGHRHDWEHAIVFIDN  227

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L  S+S+  GY K +P     +DGTS+KV Y +   L N  L  T D G FQ
Sbjct  228  PEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  286

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ+S+ AR +LN        FG A    P  DG F   L+K WPF
Sbjct  287  DLIMWDQMSNDARRALNSVH-----FGKA--NTPFNDGNFRPKLEKAWPF  329

>PPTG_12853
Length=342

 Score = 219 bits (558),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 144/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGL+ SG   G 
Sbjct  126  IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGG  185

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  186  CRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSS-------RMGHRHDWEHAIVFIDN  238

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L  S+S+  GY K +P     +DGTS+KV Y +   L N  L  T D G FQ
Sbjct  239  PEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  297

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ+S+ AR +LN        FG A    P  DG F   L+K WPF
Sbjct  298  DLIMWDQMSNDARRALNSVH-----FGKA--NTPFNDGNFRPKLEKAWPF  340

>PYU1_G011231
Length=238

 Score = 215 bits (548),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 139/228 (61%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF +P P ++S+K A+KFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  24   ISHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  G+Q+Y RSAW N  WAIMY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  84   CKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFT-------GLGHRHDWEHVVVWIDN  136

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N T+L VS SA  GY K AP     VDGTS KV  Y + ++ N AL  T   GE Q
Sbjct  137  PANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             LI W+Q++  AR +L +T       G     +P+KDG F + L K +
Sbjct  196  PLIMWEQMTQAARTALENT-------GFGDANVPMKDGNFMDKLAKAY  236

>PHYRA_52423
Length=193

 Score = 213 bits (541),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 136/201 (68%), Gaps = 8/201 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF +P+P T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR    P  + R    RH WE  VVWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGR----PTKYQR----RHFWETAVVWIDD  112

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P L N+T+LGVS++      ++ P   +++DG+SVK+  Y  +      LQ T+  GEFQ
Sbjct  113  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSYRGYGFPKPRLQFTQIDGEFQ  172

Query  202  DLIQWDQLSSLARYSLNHTDW  222
            DLI W+QL+  AR +L+  D+
Sbjct  173  DLITWEQLTEEARDALSTADF  193

>PYU1_G011237
Length=235

 Score = 214 bits (545),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 139/228 (61%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF +P P ++S+K A+KFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  21   IDHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  G+Q+Y RSAW N  WAIMY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  81   CKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFT-------GLGHRHDWEHVVVWIDN  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N T+L VS SA  GY K AP     VDGTS KV Y    ++ N AL  T   GE Q
Sbjct  134  PANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVDYSSTIVI-NHALDSTTTAGEKQ  192

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             LI W+Q++  AR +L +TD     FG A   +P+KDG F   L   +
Sbjct  193  PLIMWEQMTQAARTALENTD-----FGDA--NVPMKDGNFMTKLANAY  233

>PPTG_08005
Length=759

 Score = 228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 144/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF QP+PVT+S+K A+KFKPQL I  GCH YPAV   G  SGGLK SG     
Sbjct  544  IDHDAVVPFKQPEPVTISEKAAIKFKPQLHITNGCHAYPAVNAIGETSGGLKTSGAPSAG  603

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  604  CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  656

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L V+ SA  GYS Q P D   VDGTSVKV Y     + N AL+ T + G++Q
Sbjct  657  PEIAEPKILAVTPSAHSGYSAQVPPDANKVDGTSVKVKYLSKWPI-NHALESTGEGGDYQ  715

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W Q++  AR +L+     +T FG A   +P+ DG FE  L K WPF
Sbjct  716  DLIMWGQMTDAAREALS-----RTSFGDA--NVPMNDGNFEPKLGKAWPF  758

>PHYRA_74617
Length=337

 Score = 217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 145/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+S K  VKFKPQ++I  GC+PYPAV + G + GGLK SG   G 
Sbjct  123  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKTSGKSRGN  182

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ VV+IDN
Sbjct  183  CAGSGHGSQVYGRSTWHNQVWAIMYSWYFPKDSPSP-------GMGHRHDWEHAVVFIDN  235

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +LG S+S+  GY K  P     +DGTS+KV Y ++  + N  L  T D G FQ
Sbjct  236  PDVPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGIFQ  294

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W Q++  AR +LN  +     FG A    P+ DG F   ++K+WPF
Sbjct  295  DLIMWGQMTDNARRALNEAN-----FGSA--NTPMNDGNFYSKVEKSWPF  337

>PHYCA_108409
Length=282

 Score = 215 bits (548),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 140/230 (61%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFP+P PVTVS+K  VKFKPQ++I  GC PYPAV + G  SGGLK +G   G 
Sbjct  68   IGHDEVKPFPEPKPVTVSEKAGVKFKPQIQIRTGCVPYPAVDETGQTSGGLKPTGNSKGG  127

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y R  W+  VW IMY+WYFPK   +T         GHRH+WE+ +V+IDN
Sbjct  128  CRGSGHGSQVYGRGTWIQGVWGIMYSWYFPKDSPST-------GMGHRHDWEHAIVFIDN  180

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L  S+S+  GY K  P     +DGTS+KV Y +   L N  L  T D G FQ
Sbjct  181  PDVPEPKILACSVSSHAGYKKYNPCPPWVIDGTSLKVRYKHGWPL-NHDLDTTGDAGTFQ  239

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ++  AR +LN        FG A    P  DG F+  L+K WPF
Sbjct  240  DLIMWDQMTEDARRALN-----SVHFGSA--NTPFNDGNFKPKLEKAWPF  282

>PHYSO_397673
Length=224

 Score = 213 bits (542),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 139/230 (60%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVT+S+K  VKFKPQ++I  GCHPYPAV + G  SGGLK +G  + +
Sbjct  10   IPHDKVQPFAQPEPVTISEKAGVKFKPQIRIINGCHPYPAVNEAGETSGGLKTTGGHNSK  69

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               S   SQ+Y RS W   VWAIMY+WYFPK   +          GHRH+WE+V+VWIDN
Sbjct  70   SKRSGWNSQVYGRSTWFRGVWAIMYSWYFPKDSPS-------HGLGHRHDWEHVIVWIDN  122

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P      +L V+ SA   Y K AP +   VDGTS KV  Y +H   N  L +T D+GEFQ
Sbjct  123  PDASEPKILAVTPSAHGDYQKYAPPNANTVDGTSAKVV-YESHWPMNHELSVTSDSGEFQ  181

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W Q+S  AR + N        FG A    P+ D  FE+ L K WPF
Sbjct  182  DLIMWSQMSENARRAFN-----SVSFGKA--NTPMNDWGFEDRLGKAWPF  224

>PPTG_18464
Length=247

 Score = 214 bits (544),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 152/233 (65%), Gaps = 12/233 (5%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+K+AVK+KPQL I  GCHPY AVQ DGS+SGGL  SG  +G+
Sbjct  24   INHDQVQPFSQPEPTTDSEKSAVKYKPQLHISYGCHPYAAVQADGSVSGGLNRSGWANGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA--ATVPPDFLRFFGHRHNWEYVVVWI  139
              GS LGSQ+Y+RS W    WAI+YAWY+PKG     T PP      G RH W Y+VVW 
Sbjct  84   RKGSDLGSQVYSRSDWYRGKWAIVYAWYYPKGPVFTETGPP------GQRHFWSYIVVWT  137

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTG  198
            D+P   ++T+ GV++   +GY  Q P    ++ +  +VKV  Y N    N A+QLT+++G
Sbjct  138  DSPKPNHSTIQGVTIPTEVGYEMQVPPKEDFIFEQATVKVESYLNS--ENQAVQLTDESG  195

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            E QDLI W+QL+  AR +L+  D++   +    + MPLKD VF  +L++ +PF
Sbjct  196  EIQDLITWEQLTDQARATLSEFDFN-IKWAYVDMVMPLKDDVFSTILEEAFPF  247

>PYIR_13251
Length=236

 Score = 213 bits (542),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 142/228 (62%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF QP PVT+ QK A+KFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  22   IAHDAVVPFAQPTPVTLEQKVALKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  G+Q+Y R+A   DV+A+MY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  82   CKGSGWGTQVYGRAAAYKDVYALMYSWYFPKDSPFT-------GLGHRHDWEHVVVWIDN  134

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + N T+L V+ SA  GY K AP     VDGTS KV  Y + ++ N AL  T D GE Q
Sbjct  135  PAVANPTILAVTPSAHSGYEKYAPPKAGTVDGTSAKVD-YTSKVVINHALDSTTDAGEKQ  193

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             LI WDQL++ AR +L +T+     FG A   +P+KDG F   L   +
Sbjct  194  PLIMWDQLTAAARSALENTN-----FGDA--NVPMKDGNFMTKLGNAY  234

>PPTG_12852
Length=331

 Score = 216 bits (550),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 143/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGLK SG   G 
Sbjct  117  IGHDDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETSGGLKTSGKSRGN  176

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WEYVVV+I+N
Sbjct  177  CGGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSP-------GMGHRHDWEYVVVFINN  229

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P ++   +L  S+++  GY K  P     +DGTS+KV Y +   + N  L  T D G FQ
Sbjct  230  PEVQEPKILACSVASHGGYKKFNPCPPWVIDGTSLKVRYKHAWPM-NHDLDTTGDGGSFQ  288

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ+++ AR +LN        FG A    P  DG F + L+  WPF
Sbjct  289  DLIMWDQMTNDARRALNSVS-----FGKA--NTPFIDGRFRKKLEDAWPF  331

>PPTG_13769
Length=349

 Score = 216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 145/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H  V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGL  SG   G+
Sbjct  134  IAHKDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEFGETSGGLHTSGKSRGK  193

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RSAW+  VW IMY+WYFPK   +          GHRH+WE  +V+IDN
Sbjct  194  CGGSGHGSQVYGRSAWLKGVWVIMYSWYFPKDSPS-------HGLGHRHDWEEAIVFIDN  246

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +LG S+S+  GY++ AP     +DGTS+KV Y ++    N  L +T D G+FQ
Sbjct  247  PDVSEPKILGCSVSSHGGYARHAPCPPWVIDGTSLKVRYKHS-WPKNHDLAITGDGGKFQ  305

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W Q+++ AR +LN        FG A    P KDG F++ ++K WPF
Sbjct  306  DLIMWGQMTNDARRALNAVS-----FGSA--NTPFKDGTFQDKIEKAWPF  348

>PHYCA_18373
Length=246

 Score = 213 bits (541),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 135/211 (64%), Gaps = 13/211 (6%)

Query  41   KTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVND  100
            K AVKFKPQL I  GCHPYPAVQ DG +S GLK +GP DGEC GS LGSQIYARS W   
Sbjct  49   KAAVKFKPQLHISYGCHPYPAVQADGVVSAGLKPTGPDDGECQGSSLGSQIYARSDWYKG  108

Query  101  VWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGY  160
            V+AIMY WY PKG A+            RH WE VVVWID+P   N+T+LGVS++  +  
Sbjct  109  VYAIMYTWYLPKGSAS------------RHFWESVVVWIDDPAASNSTILGVSLNYGLQL  156

Query  161  SKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHT  220
             K+   D KY+ G+S+K+  +    + N  L+LTE  GEFQDL+ +DQL+  A  +L+H 
Sbjct  157  KKETNIDPKYLSGSSLKLDSFPGFAINNPKLRLTELDGEFQDLVTFDQLTDAAGIALSHA  216

Query  221  DWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            ++ + L   A   MPL DGVF E L   WPF
Sbjct  217  EFSKGLIK-AKTPMPLIDGVFNERLKDAWPF  246

>PPTG_07660
Length=216

 Score = 211 bits (538),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 146/219 (67%), Gaps = 6/219 (3%)

Query  34   DPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYA  93
            +P T S+K+A+K+KPQL I  GCHPYPAVQ +GS+SGGLKWSG  +G+C    LGSQ+Y+
Sbjct  2    EPTTDSEKSAIKYKPQLHISYGCHPYPAVQANGSISGGLKWSGKTNGDCEQPNLGSQVYS  61

Query  94   RSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVS  153
            RS W    WAIMYAWY PK     +  D     GHRH W Y +VW D+P  +N+T+LGVS
Sbjct  62   RSDWYKGKWAIMYAWYLPKAAQFMLKFD----TGHRHFWLYSMVWTDSPNPDNSTILGVS  117

Query  154  MSASIGYSKQAPTDVKYVD-GTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSL  212
            MS S GY K+     KY++ GT++K+  Y    +G  AL+LT+ +GE QDL+ W+QL+  
Sbjct  118  MSGSRGYVKKPSPKTKYIEKGTTIKLESYVGFWMGVQALRLTKKSGETQDLVTWEQLTDE  177

Query  213  ARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            AR +L+  D++     ++ + MPLKD VF  +L  ++PF
Sbjct  178  ARDALSEFDFESDP-SISMVVMPLKDDVFRSILKDSYPF  215

>PHYRA_54327
Length=219

 Score = 211 bits (538),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 143/228 (63%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H  V+PFPQP+P+T+S+K  VKFKPQ++I  GC PYPAV + G  SGGL+ SG   G 
Sbjct  7    ISHKDVKPFPQPEPITISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGG  66

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   A+         GHRH+WE+VVV+IDN
Sbjct  67   CRGSGHGSQVYGRSTWYNQVWAIMYSWYFPKDSPAS-------GMGHRHDWEHVVVFIDN  119

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P L    +LG S+S+  GY K  P     +DGTSVKV Y ++  L N  L  T D G FQ
Sbjct  120  PDLPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSVKVRYKHSWPL-NHDLDTTGDGGTFQ  178

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI W+Q++  AR +LN     +T FG A    P+ D  F   ++K+W
Sbjct  179  DLIMWNQMTDNARRALN-----ETKFGKA--NTPMNDWNFHSKVEKSW  219

>PHYCA_69480
Length=213

 Score = 211 bits (537),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 142/228 (62%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  1    IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  61   CRGSGHGSQVYGRSTWIQGVWAIMYSWYFPKDSPSSR-------MGHRHDWEHAIVFIDN  113

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L  S+S+  GY K  P     +DGTS+K+ Y ++  + N  L  T D+G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKLRYKHSWPI-NHDLDTTGDSGTFQ  172

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQ++  AR +LN        FG A    P  DG F+  L+K W
Sbjct  173  DLIMWDQMTEDARRALNSVS-----FGKA--NTPFNDGSFKPKLEKAW  213

>PHALS_06162
Length=488

 Score = 219 bits (559),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 141/228 (62%), Gaps = 15/228 (7%)

Query  24   HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
            HD+V PF QP PVTV++  AVKFKPQ+ I  GCHPYPAV   G +SGGLK SG  D  C 
Sbjct  269  HDKVVPFKQPKPVTVAEHAAVKFKPQINIVNGCHPYPAVNATGEISGGLKASGSSDAGCK  328

Query  84   GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
            GS  GSQ+Y RS W   +WAIMY+WYFPK  A           GHRH+WE+++VWIDNP 
Sbjct  329  GSEYGSQVYGRSTWHRGLWAIMYSWYFPKDTA-------FPLLGHRHDWEHIIVWIDNPS  381

Query  144  LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
            L    +L V+ SA   Y+ Q+P     V+GTSVKV Y     L N AL  T  +GE+QDL
Sbjct  382  LYKPRILAVASSAHSWYTVQSPPHTDRVNGTSVKVKYAGIWPL-NHALTSTTKSGEYQDL  440

Query  204  IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            I W+QL+  AR SL      Q  FG+A   +P++DG F + LD  W F
Sbjct  441  IMWEQLTEAARQSL-----QQANFGMA--NVPMRDGNFLDKLDTAWSF  481

>PPTG_07277
Length=298

 Score = 214 bits (544),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 141/230 (61%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+++PFPQPDPVT+S+K  VKFKPQ++I  GC PYP V + G  SGGL+ SG   G 
Sbjct  84   IGHDEIKPFPQPDPVTISEKAGVKFKPQIQIRTGCVPYPVVNEFGETSGGLQTSGSPRGG  143

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RSAW+N  WAIMY+WYFPK   ++         GHRH+WE+ VV+IDN
Sbjct  144  CRGSVHGSQVYGRSAWINGFWAIMYSWYFPKDSPSSR-------MGHRHDWEFAVVFIDN  196

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            PG+    ++G S+S+  G  K  P     +DG S+KV Y +   + N  L +T D G FQ
Sbjct  197  PGIPEPKIIGCSVSSHDGRKKYNPCPSWVIDGNSLKVRYKHAWPM-NHDLDVTGDAGTFQ  255

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQ++  AR +LN        FG A    P  DG F   L+  W F
Sbjct  256  DLIMWDQMTDDARRALNSVS-----FGKA--NTPFNDGKFLPTLESAWAF  298

>PHYCA_118356
Length=252

 Score = 211 bits (537),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 142/231 (61%), Gaps = 9/231 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PF QP P    ++ AVK+KP+L +  GCHPYPAVQ +GS+S GL+ SGP DGE
Sbjct  24   MDHDKVKPFAQPIPTNSFEEAAVKYKPELFVSYGCHPYPAVQANGSVSAGLEGSGPDDGE  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GSRLGSQ+Y+RS W ND WAIMY WY PKGR+  +          RH WE  V+WID+
Sbjct  84   CKGSRLGSQVYSRSDWYNDKWAIMYTWYLPKGRSGKL--------QDRHFWETAVIWIDD  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSV-KVAYYYNHLLGNTALQLTEDTGEF  200
            P LE++ +LGVS++       +     ++++ + V K   Y         L+ TE  G+ 
Sbjct  136  PTLEDSKLLGVSLNYEDRRVSKIAIKGRHLNASKVLKFESYEAEKSPKPRLRFTEKAGKT  195

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI WDQL + AR  L+ T +  + FG    +MPLKD VF + L   WPF
Sbjct  196  QDLITWDQLPAKARKGLSTTKFYSSPFGSVKREMPLKDEVFLKRLKDAWPF  246

>PHYSO_254112
Length=224

 Score = 210 bits (534),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 141/228 (62%), Gaps = 30/228 (13%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+  AVKFKP L++  GC PYPAV  +GS+S  LKW+G  DG+
Sbjct  24   INHDQVQPFAQPEPATDSETAAVKFKPFLEVSYGCEPYPAVSANGSVSASLKWTGKNDGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG--RAATVPPDFLRFFGHRHNWEYVVVWI  139
            C GS LGSQ+Y+RS W  D WA+MYAWYFPKG   A+TV         HRH W + VVWI
Sbjct  84   CEGSALGSQVYSRSDWYKDKWAMMYAWYFPKGWQGASTV--------SHRHLWLHAVVWI  135

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            DNP L+N+T+L VS    +  S+                 ++ + +L    L+LT D GE
Sbjct  136  DNPALDNSTILAVSTPVKLDASR----------------GFWASKML----LKLTTDKGE  175

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
             QDLI WDQ++  AR +L+  ++D+ LF     K+P KDGVF + L K
Sbjct  176  SQDLITWDQMTEEARTALSEANFDKHLFKRKNTKVPFKDGVFTDKLKK  223

>PHYSO_527352
Length=245

 Score = 211 bits (536),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 146/230 (63%), Gaps = 13/230 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWS--GPQD  79
            IGHDQV+PF QP+P T S+K+AVK+KPQL I  GCHPYPAVQ DGS++GGLKW+     D
Sbjct  24   IGHDQVQPFAQPEPTTESEKSAVKYKPQLHISYGCHPYPAVQADGSVNGGLKWTFWSWAD  83

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVV  137
             +C GS LGSQ+Y+RS W    WAI+YAWYFPKGR      DF   F  GHRH W Y ++
Sbjct  84   SDCKGSGLGSQVYSRSDWHRGKWAIVYAWYFPKGR------DFEHSFKRGHRHYWLYAIL  137

Query  138  WIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT  197
            W D+P  + +T+LGVS+         AP     +DG ++K   Y +   G   L LTE T
Sbjct  138  WTDSPNPDTSTILGVSVPNGFRDKSAAPDAQFVIDGKTIKFDSYRSFTTGRQDLGLTEKT  197

Query  198  GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
            G+ QDLI W+QL+  AR +L++ ++D        + +P+KDG F E L +
Sbjct  198  GDTQDLITWEQLTEEARTALSNMNFDGP---RQKIVVPMKDGDFAERLAR  244

>PHYSO_259736
Length=231

 Score = 209 bits (533),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 138/230 (60%), Gaps = 22/230 (10%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF Q +PV  S K A+KFKP+L+I  GCHPYPAVQ DG++S GLKW G  DG+
Sbjct  24   INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W    WAI+                      HRH W Y+V+WIDN
Sbjct  84   CKGSGLGSQVYSRSDWYQGKWAII----------------------HRHLWLYLVLWIDN  121

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N  +LGV +  + G  ++ P D K++DG+S+KV YY +   G T +QLTE+ GEFQ
Sbjct  122  PEAANPAILGVWLRTAGGNEQRVPPDAKFIDGSSLKVEYYKSSWHGKTGIQLTENPGEFQ  181

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DL+ W+Q++  AR +L   ++D        L +P  DG F   L+K W F
Sbjct  182  DLVTWEQMTEEARIALTEANFDGHWQERKDLDVPFIDGEFTVNLEKAWIF  231

>PHYRA_46230
Length=212

 Score = 208 bits (529),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 141/227 (62%), Gaps = 15/227 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H +V+PF QP P T+S+K  VKFKPQ++I  GC PYPAV   G  SGGLK SG   G 
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGG  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RSAW+NDVWAIMY+WYFPK   ++         GHRH+WE+VVV+IDN
Sbjct  61   CRGSGHGSQVYGRSAWLNDVWAIMYSWYFPKDSPSS-------GMGHRHDWEHVVVFIDN  113

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    ++G S S+  GY K AP     +DGTSVKV Y ++  + N  L +T D G FQ
Sbjct  114  PDVAEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQ  172

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKT  248
            DLI WDQ++  AR +LN        FG A    P+ DG F   L+K 
Sbjct  173  DLIMWDQMTEDARRALNGVH-----FGDA--NTPMNDGNFIPKLEKA  212

>PHYSO_249751
Length=238

 Score = 209 bits (531),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 150/250 (60%), Gaps = 14/250 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN RA+     ASL   +A VIGHDQV PFPQ    + +   A+KFK Q+ I+ GCHPYP
Sbjct  1    MNLRAIAAVTAASLISVEAGVIGHDQVVPFPQSAATSAANIAALKFKLQIFINNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV   G  SGGLK SG  +  C GS  GSQ+Y RS   N+  AIMY+WYFPK    T   
Sbjct  61   AVNAAGDTSGGLKPSGSVNAGCKGSGYGSQVYGRSTLYNNKHAIMYSWYFPKDNPVT---  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                  GHRH+WE+V+VWIDNP   NAT+L ++ SA  GYS  AP     VDGTSVKV Y
Sbjct  118  ----GLGHRHDWEHVIVWIDNPASSNATILAMTPSAHSGYSTYAPPPATMVDGTSVKVEY  173

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              + ++ N  L+ T   GE Q+LI W+ ++  ARY+LN TD     FG A   +P+KDG 
Sbjct  174  TSSKVVINHHLEGTSTAGETQNLIMWEDMTDAARYALNTTD-----FGSA--NVPMKDGN  226

Query  241  FEELLDKTWP  250
            F   L K +P
Sbjct  227  FISKLGKAYP  236

>PHYKE_7564
Length=473

 Score = 216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 141/230 (61%), Gaps = 14/230 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PFPQ    +++   A+K+KPQ+ I+ GCHPYPAV  +G  SGGLK  G     
Sbjct  257  IDHDQVQPFPQSAATSLTNTAALKYKPQIFINNGCHPYPAVNANGDTSGGLKTHGSGSAG  316

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK          +   GHRH+WE+V+VWIDN
Sbjct  317  CRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDSP-------VSGMGHRHDWEHVIVWIDN  369

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N T+L ++ SA  GYS  AP     VDG SVKV Y   +L+ N  L+ T   GE Q
Sbjct  370  PENVNGTILAMTPSAHSGYSTYAPPPADMVDGASVKVEYTSTYLVINHHLEGTSTAGEMQ  429

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W  ++  ARY+LN TD     FG A   +P+KDG F   L+K +P+
Sbjct  430  DLIMWGDMTDAARYALNTTD-----FGNA--NVPMKDGNFLPKLEKAYPW  472

 Score = 204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 125/197 (63%), Gaps = 7/197 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PFPQ   ++++   A+KFKPQ+ I+ GCHPYPAV  +G  SGGLK  G     
Sbjct  22   INHDQVQPFPQSTAISLTNTAALKFKPQIWINNGCHPYPAVNANGDTSGGLKTHGSSSAG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK      P DF    GHRH+WE+VVVWIDN
Sbjct  82   CRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDE----PQDFT---GHRHDWEHVVVWIDN  134

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N  +L ++ SA  GYS  AP D   +DGTSVKV Y  + L  +  L+ T   GE Q
Sbjct  135  PQNVNPRILAMTPSAHSGYSTYAPPDADMIDGTSVKVEYTSSWLFIDHHLEGTSTAGEMQ  194

Query  202  DLIQWDQLSSLARYSLN  218
            DLI W  ++  AR SLN
Sbjct  195  DLIMWSDMTDAARNSLN  211

>PPTG_13736
Length=236

 Score = 209 bits (531),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 146/251 (58%), Gaps = 15/251 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN RA  V+ +A+LA      + HDQVRPF QP PV+VS+K AVKFKPQL I  GCHPYP
Sbjct  1    MNLRAFIVSIVAALAATDVIALSHDQVRPFGQPSPVSVSEKAAVKFKPQLHITNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV   G  SGGL  SG     C GS  GSQ+Y RS W    WAIMY+WYFPK   +T   
Sbjct  61   AVNAAGETSGGLAKSGAPSAGCKGSGWGSQVYGRSTWHKGRWAIMYSWYFPKDSPST---  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                  GHRH+WE+V+VWIDNP + N  +L V+ SA  GYSK AP     V G + K+  
Sbjct  118  ----GLGHRHDWEHVIVWIDNPDVANPKILAVTPSAHSGYSKYAPPKAGTVSGNTAKI-N  172

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            Y +H   N AL  T+  GE Q LI WDQ++  AR SLN        FG A   +P+ DG 
Sbjct  173  YESHWPVNHALDSTDKGGETQPLIMWDQMTDAARRSLN-----TVSFGDA--NVPMNDGN  225

Query  241  FEELLDKTWPF  251
            F   +    P+
Sbjct  226  FLRKIGNASPW  236

>HYAP_09243
Length=266

 Score = 209 bits (533),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 140/229 (61%), Gaps = 15/229 (7%)

Query  23   GHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGEC  82
            GHD + PF +P PVT+S+K  VKFKP L ++ GC PY AV  +G  SGGL+ SG  +  C
Sbjct  46   GHDAIVPFSEPKPVTISEKAGVKFKPLLDVNTGCAPYAAVNAEGETSGGLQTSGDPESGC  105

Query  83   TGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNP  142
             GS+ GSQ+Y RS W NDVWAIMYAWYFPK          +   GHRH+WE VVV+I++P
Sbjct  106  RGSKYGSQVYGRSTWYNDVWAIMYAWYFPKDSP-------MLLMGHRHDWENVVVFINDP  158

Query  143  GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                 T+LG S S   GY K AP     ++G+SV + Y ++  L N AL +T+D G +QD
Sbjct  159  DEVEPTILGCSTSWHSGYIKYAPCPTDSINGSSVMIKYEHSFPL-NHALNITKDAGAYQD  217

Query  203  LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            LI W Q+  LAR +LN TD+ + +        P+ D  F E ++  WPF
Sbjct  218  LIMWHQMPDLARRALNDTDFGKAI-------TPMNDLNFMEKIEAAWPF  259

>PHYCA_69477
Length=213

 Score = 207 bits (528),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 140/228 (61%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PF QP+PVT+S+K  VKFKPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  1    IGHDEVKPFAQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  61   CRGSGHGSQVYGRSTWMQGVWAIMYSWYFPKDSPSSR-------MGHRHDWEHAIVFIDN  113

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L  S+S+  GY K  P     +DGTS+KV Y ++  + N  L  T D G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDAGTFQ  172

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQ++  AR +LN   + + +        P  DG F+  L+K W
Sbjct  173  DLIMWDQMTEDARRALNSVSFGKAM-------TPFNDGSFKPKLEKAW  213

>PHYCA_119748
Length=261

 Score = 209 bits (532),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 139/234 (59%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHDQV+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G   GGLK +G   G 
Sbjct  47   IGHDQVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETGGGLKTTGKSRGN  106

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W   VWAIMY+WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  107  CGGSGYGSQVYGRSTWYQGVWAIMYSWYFPKDSPSPK-------MGHRHDWEHAIVFIDN  159

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY----YNHLLGNTALQLTEDT  197
            P +    +L  S+S+  GY+K  P     +DGTS+KV Y     YNH      L  T D 
Sbjct  160  PEVSEPKILACSVSSHSGYTKYNPCPPWVIDGTSLKVRYKHAWPYNH-----DLDATGDG  214

Query  198  GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            G+FQDLI W+QL+  AR +LN        FG A    P  D  F   ++  WPF
Sbjct  215  GKFQDLIMWNQLTEDARRALNSVS-----FGKA--NTPFSDDKFMPKIENAWPF  261

>PHYSO_334487
Length=258

 Score = 209 bits (531),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 145/251 (58%), Gaps = 14/251 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN RA+    +ASLA     +IGHDQV PFPQ  P T+S K A+KFKPQL I+ GCHPYP
Sbjct  1    MNLRALAADTLASLASVSGGIIGHDQVVPFPQSQPTTISNKAALKFKPQLWINNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
             V   G   GGLK  G     C  S  GSQ+Y RS W N VWAIMY WYFPK      P 
Sbjct  61   VVNAAGDTGGGLKTHGSSAAGCRCSGYGSQVYGRSTWYNGVWAIMYCWYFPKDE----PQ  116

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
            D     GHRH+WE+V+VWIDNP +EN  ++ ++ SA  GYS  A      VDGTS KV Y
Sbjct  117  DGT---GHRHDWEHVIVWIDNPDVENPKIMAMTPSAHSGYSTYALPPADMVDGTSCKVEY  173

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              + L  +  L+ T   GEFQDLI W  L+  AR +LN T      FG A    P+ DG 
Sbjct  174  TSSWLFIDHHLEGTSTAGEFQDLIMWSDLTDGARLALNTTS-----FGKA--NTPMNDGN  226

Query  241  FEELLDKTWPF  251
            F   + K +P+
Sbjct  227  FLPKIQKAYPW  237

>PHYRA_72475
Length=243

 Score = 208 bits (530),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 149/235 (63%), Gaps = 20/235 (9%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+K AV+FKP L+ID GCHPYPAV   G  SGGLK +G   G+
Sbjct  24   IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDTGCHPYPAVNAAGETSGGLKGTGMPSGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P F +  G RH+W  VVVW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDQ-----PTFSK--GKRHDWANVVVWLDN  136

Query  142  PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYY---NHLLGNTALQLTEDT  197
            P LE  T++GVS S+ +  YSK  P     + GT+  + Y     NH  G  ++  T  T
Sbjct  137  PALERPTIIGVSPSSYVTTYSKYTPPPADGLSGTTSMINYLADANNH--GFHSVDTTWKT  194

Query  198  -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             GEFQDLI W+QL+  AR + N TD+ +         +P  D  F+  L+K WP+
Sbjct  195  GGEFQDLIMWEQLTDEARGAFNDTDFGEH------APVPFIDPNFKANLEKAWPY  243

>PHYRA_72165
Length=240

 Score = 208 bits (529),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 145/234 (62%), Gaps = 22/234 (9%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+K AV+FKP L+ID GCHPYPAV   G  + GLK +GP  G+
Sbjct  23   IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGPSSGD  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P F    G RH+W  VVVW+DN
Sbjct  83   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFGE--GGRHDWANVVVWLDN  135

Query  142  PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT---  197
            P +E  T++GVS S+ +  Y K  P     + GT+  + Y  + +  N      + T   
Sbjct  136  PAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLADDM--NNGFHTVDTTWLP  193

Query  198  -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
             GEFQDLI W+QL+  AR +L+ TD+        G  +P  D  F+  L+K WP
Sbjct  194  GGEFQDLIMWEQLTDEARAALSDTDF--------GALVPFIDANFKANLEKAWP  239

>PYIR_13252
Length=236

 Score = 207 bits (528),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 149/249 (60%), Gaps = 15/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            M F+ +  +A+ +LA   A  I HD V+PF +P+P T + + A+KFKPQ+ I  GC PYP
Sbjct  1    MMFKVIIASALVALATVNAASIAHDAVKPFAEPNPTTTTHRVALKFKPQINISNGCSPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV   G+ SGGLK SG Q   C GS  G+Q+Y R+A   D + IMY+WYFPK        
Sbjct  61   AVDSAGNTSGGLKPSGSQSAGCKGSGWGTQVYGRAAQYKDAYGIMYSWYFPKDSP-----  115

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
              L   GHRH+WE+VVVWIDNP   N  +L VS SA  GYSK AP     VDGTS KV  
Sbjct  116  --LTGLGHRHDWEHVVVWIDNPNAANPKILAVSPSAHSGYSKYAPPKAGTVDGTSAKVD-  172

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            Y + ++ N AL  T D GE Q LI WDQL++ AR +L +T+     FG A   +P+KDG 
Sbjct  173  YTSKVVINHALDSTTDAGEQQPLIMWDQLTAAARSALENTN-----FGDA--NVPMKDGN  225

Query  241  FEELLDKTW  249
            F   L   +
Sbjct  226  FMNKLANAY  234

>PYU1_G011235
Length=238

 Score = 207 bits (528),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 137/228 (60%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF +P P + S+K AVKFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  24   INHDQVVPFAEPTPSSASEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  G+Q+Y R A   D WAIMY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  84   CKGSGWGTQVYGRVASYKDKWAIMYSWYFPKDSPIT-------GLGHRHDWEHVVVWIDN  136

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N  +L +S SA  GY K AP     VDGTS KV  Y + ++ N AL  T   GE Q
Sbjct  137  PKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             LI W+Q++  AR +L +TD     FG A +  P+KDG F   L K +
Sbjct  196  PLIMWEQMTDAARSALENTD-----FGKANV--PMKDGNFMNKLAKAY  236

>PHYRA_74630
Length=343

 Score = 211 bits (536),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 141/230 (61%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+S K  VKFKPQ++I  GC+PYPAV + G + GGLK +G   G+
Sbjct  129  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKPTGKSRGK  188

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W N VW IMY+WYFPK   +          GHRH+WE+ VV+IDN
Sbjct  189  CAGSGHGSQVYGRSTWHNSVWVIMYSWYFPKDSPSP-------GLGHRHDWEHAVVFIDN  241

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L  S+S+  GY K  P     +DGTS+KV Y ++  + N  L  T D G FQ
Sbjct  242  PDVPEPKILACSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGTFQ  300

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W Q++  AR +LN  +     FG A    P+ DG F   +   WPF
Sbjct  301  DLIMWGQMTDNARRALNEAN-----FGSA--NTPMNDGNFPNKVQAAWPF  343

>PITG_08522
Length=382

 Score = 211 bits (538),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 140/231 (61%), Gaps = 17/231 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD V+ FPQP+PVT+S+K  VKFKPQ++I  GC PYP V + G  SGGL+ SG   G 
Sbjct  126  IGHDDVKLFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPVVNELGETSGGLQTSGNSRGG  185

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDF-LRFFGHRHNWEYVVVWID  140
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK        DF     GHRH+WE+ +V+ID
Sbjct  186  CRGSGHGSQVYGRSTWMEGVWAIMYSWYFPK--------DFPSSRMGHRHDWEHAIVFID  237

Query  141  NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            NP +    +L  S+S+  GY K  P     +DGTS+KV Y +   L N  L  T D G F
Sbjct  238  NPEVAEPKILACSVSSHDGYKKYNPCPSYVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTF  296

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI WDQ+S+ AR +LN        FG A    P  DG F   L+K WPF
Sbjct  297  QDLIMWDQMSNDARRALNSVH-----FGKA--NTPFNDGNFRPKLEKAWPF  340

>PHYRA_71588
Length=242

 Score = 206 bits (525),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 144/233 (62%), Gaps = 16/233 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PF QPDPVT+S+KTAV+FKP L+ID GCH YPAV   G  + GLK +G   G+
Sbjct  23   IGHDKVQPFAQPDPVTISEKTAVRFKPILRIDNGCHSYPAVNAAGETNAGLKGTGRPSGD  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y RS W  D+WAIMYAWYFPK          +   G RH+W  VVVW+DN
Sbjct  83   CKGSSLGSQVYGRSVWHGDLWAIMYAWYFPKDMP-------ILGKGKRHDWANVVVWLDN  135

Query  142  PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHL-LGNTALQLT-EDTG  198
            P  E  T++GVS SA +  Y+K  P     + G +  ++Y  + L  G   L +  E  G
Sbjct  136  PAHERPTIIGVSPSAYVTTYAKYTPPPANRLTGLTSMISYLADDLNYGYHTLDMNWEAGG  195

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            EFQDL+ W+QL+  AR +LN TD     FG   L +P  D  F+  L+K WP+
Sbjct  196  EFQDLVMWEQLTDEARAALNDTD-----FGENAL-VPFIDANFKANLEKAWPY  242

>PYU1_G011233
Length=239

 Score = 206 bits (524),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 142/228 (62%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF +P P T+++K A+KFKPQ+ I+ GCHPYPAV   G++ GGLK  G Q   
Sbjct  24   IDHDQVKPFAEPAPTTLAEKLAIKFKPQIFINNGCHPYPAVDAAGNVGGGLKPDGSQSAG  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  G+Q+Y R+A  NDV+AIMY+WY PK          +   GHRH+WE VVVWIDN
Sbjct  84   CKGSGWGTQVYGRAAPYNDVYAIMYSWYMPKDTP-------IPGIGHRHDWENVVVWIDN  136

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N  +L VS SA  GY K AP     VDGTS KV Y   +L+ + +L  T   GE Q
Sbjct  137  PNAANPKILAVSPSAHSGYEKYAPPKAGTVDGTSAKVIYSTTNLVMDHSLDSTTHAGEQQ  196

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             LI W+QL+  AR +L   D+D   FG A   +P+KDG F + L K++
Sbjct  197  PLIMWEQLTDAARSTLQ--DYD---FGNA--NVPMKDGNFMDKLGKSY  237

>PPTG_07661
Length=223

 Score = 205 bits (521),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 149/225 (66%), Gaps = 11/225 (5%)

Query  34   DPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYA  93
            +P T S+K+A+K+KPQL I  GC+PYPAVQ +G++SGGLKWSG  + +C     GSQIY+
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  94   RSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVS  153
            RS W    WAIMYAWYFPKG  A     + R  GHRH W   +VW DN   +N+T+LGVS
Sbjct  62   RSDWYKGKWAIMYAWYFPKG--AFRASKYNR--GHRHFWSSAIVWTDNTNPDNSTILGVS  117

Query  154  MSASIGYSKQAPTDVKYVD-GTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSL  212
            MS S GY K+     KY++ GT++K+  Y    L N AL+LT+ +G  QDL+ W+QL+  
Sbjct  118  MSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDE  177

Query  213  ARYSLNHTDWD----QTLFGLAG--LKMPLKDGVFEELLDKTWPF  251
            AR +L+  D+D      +F  +G  + MPL+DGVF  +L++++PF
Sbjct  178  ARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  222

>PHYKE_5655
Length=243

 Score = 205 bits (522),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 148/235 (63%), Gaps = 18/235 (8%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFPQPDPVTVS+KTAVKFKP L+ID+GCH YPAV     +SGGLK +G  DG+
Sbjct  22   IGHDKVQPFPQPDPVTVSEKTAVKFKPSLRIDSGCHSYPAVNAACEISGGLKGTGSDDGD  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQ+Y R+ W ND+WAIMY+WYFPK     +   F +  G RH+W  VVVW+++
Sbjct  82   CTGSSLGSQVYGRAVWYNDLWAIMYSWYFPKDMPVAI---FKK--GRRHDWVNVVVWLND  136

Query  142  PGLENATVLG-VSMSASIGYSKQAPTDVKYVDGTSVKVAYY---YNHLLGNTALQLTEDT  197
            P  E   +LG    S    YSK  P  V  ++G S  + Y    Y+H  G   +  T + 
Sbjct  137  PAAEKPIMLGVSPSSYVSSYSKYTPPPVDGLNGMSCMINYLSNPYDH--GYHTVDTTRNR  194

Query  198  -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             GEFQDL+ W+QL+  AR SLN T + +T       ++P  D  F   L+K WP+
Sbjct  195  GGEFQDLVMWEQLTDAARISLNETAFGET------AQVPFIDENFVANLEKAWPY  243

>PHYRA_49009
Length=216

 Score = 204 bits (518),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 144/233 (62%), Gaps = 22/233 (9%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+K AV+FKP L+ID GCHPYPAV   G  + GLK +G   G+
Sbjct  1    IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGMPSGD  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +A       +   G RH+W  VVVW+DN
Sbjct  61   CKGSGLGSQVYARAVWHSDLWAIMYAWYFPKDKA-------IFGKGERHDWANVVVWLDN  113

Query  142  PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT---  197
            P +E  T++GVS S+ +  Y K  P     + GT+  + Y  N +  N      + T   
Sbjct  114  PAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLANDM--NNGFHTVDTTWKT  171

Query  198  -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             GEFQDLI W+QL+  AR +L++TD+        G  +P  D  F+  L+K W
Sbjct  172  GGEFQDLIMWEQLTDEARAALSNTDF--------GALVPFIDANFKANLEKAW  216

>PHYSO_334498
Length=229

 Score = 203 bits (517),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 131/218 (60%), Gaps = 17/218 (8%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF QP+PVT+S+K AVKFKPQL I  GCHPYPAV + G   GGL  +G   G+
Sbjct  25   ISHDQVAPFAQPEPVTISEKAAVKFKPQLHISNGCHPYPAVNEAGDTDGGLSNTGAPSGK  84

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF-FGHRHNWEYVVVWID  140
            C GS LGSQ+Y RS W  DVW IMYAWYFPK        D   F  GHRH+WE+ V+WID
Sbjct  85   CKGSGLGSQVYGRSGWHKDVWTIMYAWYFPK--------DMASFDLGHRHDWEHAVIWID  136

Query  141  NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            NP +    +LGVS S+  GY K        ++GTSV + Y     + +  L+ T   GE+
Sbjct  137  NPDVAEPKILGVSASSHAGYEKVTTIPAGSLNGTSVLLNYESTWPV-DHELRFTTKGGEY  195

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
            Q LI W QL+  AR SL+ TD+   L       MP+ D
Sbjct  196  QPLIMWTQLTDAARVSLSTTDFGSAL-------MPMTD  226

>PPTG_19506
Length=223

 Score = 203 bits (516),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 149/225 (66%), Gaps = 11/225 (5%)

Query  34   DPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYA  93
            +P T S+K+A+K+KPQL I  GC+PYPAVQ +G++SGGLKWSG  + +C     GSQIY+
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  94   RSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVS  153
            RS W    WAIMYAWYFPKG  A     + R  GHRH W   +VW DN   +N+T+LGVS
Sbjct  62   RSDWYKGKWAIMYAWYFPKG--AFRASKYNR--GHRHFWSSAIVWTDNTNPDNSTILGVS  117

Query  154  MSASIGYSKQAPTDVKYVD-GTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSL  212
            MS S GY K+     KY++ GT++K+  Y    L N AL+LT+ +G  QDL+ W+QL+  
Sbjct  118  MSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDE  177

Query  213  ARYSLNHTDWD----QTLFGLAG--LKMPLKDGVFEELLDKTWPF  251
            AR +L+  D+D      +F  +G  + +PL+DGVF  +L++++PF
Sbjct  178  ARDALSKFDFDADTSDAIFFSSGATVVIPLEDGVFTSILEESYPF  222

>PYU1_G011230
Length=238

 Score = 201 bits (511),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 134/228 (59%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF +P P +  +K AVKFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  24   ISHDQVVPFAEPTPSSAYEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  G+Q+Y R A  N V+ +MY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  84   CKGSGWGTQVYGRGAAYNGVYGLMYSWYFPKDSPIT-------GLGHRHDWEHVVVWIDN  136

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N  +L +S SA  GY K AP     VDGTS KV  Y + ++ N AL  T   GE Q
Sbjct  137  PKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  195

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             LI W+Q++  AR +L +T       G     +P+KDG F + L K +
Sbjct  196  PLIMWEQMTQAARTALENT-------GFGDANVPMKDGNFMDKLAKAY  236

>PHYKE_7566
Length=260

 Score = 201 bits (510),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 134/228 (59%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF QP   T  Q   +KFKPQ+ I  GCHPYPAV KDG+ SGGLK +G     
Sbjct  45   ISHDQVVPFAQPTATTTLQAAGIKFKPQIHISNGCHPYPAVNKDGNTSGGLKPTGSASAG  104

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY R      V+AIMY+WYFPK    T         GHRH+WE+V+VW+D+
Sbjct  105  CKGSGYGSQIYGRITTYQGVYAIMYSWYFPKDSPIT-------GLGHRHDWEHVIVWVDD  157

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              L N +++ VS SA  GY+   P     +DG S KV Y  ++L+ N AL  T D GE Q
Sbjct  158  ITLTNPSIVAVSPSAHSGYNIYYPPKSGTIDGYSAKVDYSSSYLVVNHALDSTSDAGETQ  217

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQL+  AR +L +TD     FG A   +P+KD  F+  L   +
Sbjct  218  DLIMWDQLTDAARTALENTD-----FGDA--NVPMKDANFQAKLGNAY  258

>PHYRA_86968
Length=239

 Score = 199 bits (507),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 138/232 (59%), Gaps = 16/232 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+K  VKFKPQL I AGC PYPAV   G  SGGLK +G  + +
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-DELD  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  S LGSQ+Y R+ W N VWAIMYAWYFPKG   TVP         RH+W   VVWIDN
Sbjct  81   CILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVP-------YWRHDWSNAVVWIDN  133

Query  142  PGLENATVLGVSMSASIGY--SKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            P LEN  +LG+S+S S     +   P   + ++  +    Y Y   L    L+L+   G 
Sbjct  134  PALENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRGP  193

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W QL+  AR +LN    DQ  FG     +P+ D  F +LL++ WPF
Sbjct  194  VQDLIMWGQLTDAARAALN----DQDNFGRT--DVPISDDHFPKLLEEAWPF  239

>PHYRA_43347
Length=220

 Score = 199 bits (506),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 137/205 (67%), Gaps = 17/205 (8%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QPDPVTVS+K AV+FKP L+ID+GCHPYPAV   G  S GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  82   CTGSRLGSQI---YARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVW  138
            C GS LGSQ+   YAR+ W +D+WAIMYAWYFPK +     P F +  G RH+W  VVVW
Sbjct  84   CKGSGLGSQVVLRYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVW  136

Query  139  IDNPGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYY---NHLLGNTALQLT  194
            +DNP LE  T++GVS S+ +  YSK  P     ++GT+  + Y     NH  G  ++  T
Sbjct  137  LDNPALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNH--GFHSVDTT  194

Query  195  EDT-GEFQDLIQWDQLSSLARYSLN  218
              T GEFQDLI W+QL+  AR +LN
Sbjct  195  WKTGGEFQDLIMWEQLTDEARAALN  219

>PHYCA_69479
Length=213

 Score = 198 bits (503),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 135/228 (59%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H  ++PFPQP PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGLK +G   G 
Sbjct  1    ISHHDIKPFPQPVPVTISEKAGVKFKPQIQIRTGCVPYPAVNEFGETSGGLKPTGNPRGG  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  61   CRGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDSPSP-------GLGHRHDWEHAIVFIDN  113

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L  S+S+  GY K  P     +DGTS+KV Y +   + N  L  T D G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHAWPM-NHDLDTTGDGGSFQ  172

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI W+Q++  AR +LN  +     FG A    P  DG F   L+  W
Sbjct  173  DLIMWNQMTEDARRALNSVN-----FGSA--NTPFNDGRFMPKLENAW  213

>PPTG_15231
Length=258

 Score = 199 bits (507),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 134/220 (61%), Gaps = 14/220 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF QP   T  QK  VKFKPQ+ I  GCHPYPAV  +G+ SGGLK +G     
Sbjct  43   ISHDAVVPFAQPTATTTEQKAGVKFKPQIHISNGCHPYPAVDANGNTSGGLKPTGSSSAG  102

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y R A  N V+AIMY+WYFPK    T         GHRH+WE+VVVW+D+
Sbjct  103  CKGSGYGSQVYGRVATYNGVYAIMYSWYFPKDSPVT-------GLGHRHDWEHVVVWVDD  155

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              L++ +++ VS SA  GY+   P +   +DG S KV Y  + ++ N AL  T D GE Q
Sbjct  156  IKLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVINHALDSTTDAGETQ  215

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
            DLI WDQL+  AR +L +TD     FG A   +P+KDG F
Sbjct  216  DLIMWDQLTDAARTALENTD-----FGDA--NVPMKDGNF  248

>PHYCA_6835
Length=210

 Score = 197 bits (500),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 128/212 (60%), Gaps = 15/212 (7%)

Query  40   QKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVN  99
            +++AVKFKPQL I  GCH YPAV + G   GGLK  G     C GS  GSQ+Y RS W  
Sbjct  13   RRSAVKFKPQLHITNGCHSYPAVDEAGETGGGLKTKGAPSAGCKGSGWGSQVYGRSGWYQ  72

Query  100  DVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG  159
            DVWAIMY WYFPK   ++         GHRH+WE+V+VWIDNP +EN  +L V+ SA  G
Sbjct  73   DVWAIMYCWYFPKDEPSS-------GIGHRHDWEHVIVWIDNPAVENPKILAVTPSAHSG  125

Query  160  YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNH  219
            Y K AP +   +DG + KVAY     + + AL  T + G+FQDLI WDQLS  AR +LN 
Sbjct  126  YHKYAPPNADTIDGVTTKVAYDSKWPM-DHALDSTSEAGDFQDLIMWDQLSENARRALNS  184

Query  220  TDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             +     FG A    P+ DG F+  L K WPF
Sbjct  185  VN-----FGKA--NTPMNDGNFQPKLAKAWPF  209

>PHYRA_52960
Length=223

 Score = 197 bits (500),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 135/228 (59%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD V PF QP P T  QK AVK KPQ+ I  GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  68

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GSRLGSQIY R A    V+A MY+WY PK +        L   G+RH+WE  VVWI N
Sbjct  69   CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQT-------LPGLGYRHDWEACVVWISN  121

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              LE   ++ +S+S    Y    P D  Y++G S K+ Y  + ++ + +L  T   GE Q
Sbjct  122  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  181

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQL++ AR +L  TD     FG  G ++P KD  F+E L K +
Sbjct  182  DLIMWDQLTAAARTALEDTD-----FG--GARVPFKDANFKEKLAKAY  222

>PHYRA_52955
Length=223

 Score = 197 bits (500),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 135/228 (59%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD V PF QP P T  QK AVK KPQ+ I  GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  68

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GSRLGSQIY R A    V+A MY+WY PK +        L   G+RH+WE  VVWI N
Sbjct  69   CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQT-------LPGLGYRHDWEACVVWISN  121

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              LE   ++ +S+S    Y    P D  Y++G S K+ Y  + ++ + +L  T   GE Q
Sbjct  122  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  181

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQL++ AR +L  TD     FG  G ++P KD  F+E L K +
Sbjct  182  DLIMWDQLTAAARTALEDTD-----FG--GARVPFKDANFKEKLAKAY  222

>PYU1_G011236
Length=237

 Score = 197 bits (500),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 133/228 (58%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF +P P T +QK  +KFKPQL I  GCHPYPAV   G+ SGGLK +G  D  
Sbjct  23   IAHDAVVPFVEPTPTTTAQKLGIKFKPQLHISNGCHPYPAVDAAGNTSGGLKPTGSSDAG  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  G+Q+Y R+A  N V+A+MY+WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  83   CKGSGYGTQVYGRAAAYNGVYALMYSWYFPKDSPST-------LLGHRHDWEHVVVWIDN  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   +  +L VS SA  GY+K  P     + G S K+ Y    +L N A  +T   GE Q
Sbjct  136  PDAASPKILAVSASAHSGYNKYHPPATTTLAGNSAKIDYKSIVVL-NHAFDMTTAAGETQ  194

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             LI WDQ++  AR +L  TD     FG A   +P+KDG F   L   +
Sbjct  195  PLIMWDQMTVAARTALETTD-----FGDA--NVPMKDGNFMTKLANAY  235

>PYIW_25259
Length=246

 Score = 197 bits (501),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 130/229 (57%), Gaps = 24/229 (10%)

Query  22   IGHDQVRPFPQPDPVTVSQK---------TAVKFKPQLKIDAGCHPYPAVQKDGSMSGGL  72
            I HD V PF QP PVT+ Q           A+KFKPQ+ I  GCHPYPAV   G+  GGL
Sbjct  23   IAHDAVVPFAQPAPVTLEQTPAPTSLSHTAALKFKPQIHISNGCHPYPAVDAAGNTGGGL  82

Query  73   KWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNW  132
            K SG Q   C GS  G+Q+Y RS W N  WAIMY+WYFPK    T         GHRH+W
Sbjct  83   KPSGSQSAGCKGSGWGTQVYGRSTWFNGKWAIMYSWYFPKDSPFT-------GLGHRHDW  135

Query  133  EYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQ  192
            E+VVVWIDNP   N  +L V+ SA  GY K AP     VDG S KV Y    ++ N AL 
Sbjct  136  EHVVVWIDNPANANPAILAVTPSAHSGYKKYAPPKSGTVDGNSAKVEYKAIIVI-NHALD  194

Query  193  LTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
             T   GE Q LI WDQL+  AR  L +TD     FG A   +P+KDG F
Sbjct  195  STTTGGEQQPLIMWDQLTDAARSGLENTD-----FGSA--NVPMKDGNF  236

>PITG_22734
Length=168

 Score = 194 bits (494),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 113/153 (74%), Gaps = 8/153 (5%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PF QP P+T SQK+AVK+KPQL I  GCHPYPAV+ +GS SGGL+WSGP DG+
Sbjct  24   VNHDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR            GHRH WEYVVVW D+
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWADS  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGT  174
                N+++ GVSMSA +G++K  P  +KY+ G+
Sbjct  136  STSTNSSIQGVSMSAGVGHAKATPPMLKYIHGS  168

>PHALS_06084
Length=260

 Score = 197 bits (501),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 136/230 (59%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +DQVR F QP P T+SQ+ A+ FKPQL I  GC PYPAV + G  SGGL      + +
Sbjct  45   IPYDQVRGFRQPKPTTISQQVALTFKPQLDIVTGCLPYPAVNRLGETSGGLPKDADTETK  104

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS+  SQ+Y RS W NDVW +M++WYFPK              GHRH+WE VV++ID+
Sbjct  105  CHGSQFNSQVYGRSTWFNDVWVMMFSWYFPKDSP-------FPLLGHRHDWENVVIFIDS  157

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +LG SMS    Y K AP      +GTSVKV Y  +  L N AL +TE  G FQ
Sbjct  158  PKVPLPKILGCSMSYHSEYIKFAPCPTFATNGTSVKVKYEDSFPL-NHALNVTEKEGTFQ  216

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI W+QL  + R SLN TD     FG A +  P+ D  F + +++ WPF
Sbjct  217  DLIMWNQLPPIVRKSLNDTD-----FGSANV--PMNDWNFLKKVEEAWPF  259

>PHYRA_83592
Length=237

 Score = 196 bits (497),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 134/230 (58%), Gaps = 14/230 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PFPQP PVT+S+K  VKFKP+L I  GC  YPAV   G  SGGLK +G  D  
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C    LGSQ+Y R+ W NDVWAIMYAWYFPKG     P         RH+W  VVVWIDN
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDKCP-------YWRHDWSNVVVWIDN  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +E + VLG+S+S S           + +   +  + Y Y    G+  L    D G+FQ
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  193

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLI WDQL+  AR +LN    DQ  FG    ++P+ D  F E L+K WPF
Sbjct  194  DLIMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPEHLEKAWPF  237

>PHYSO_329114
Length=236

 Score = 196 bits (497),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 120/202 (59%), Gaps = 9/202 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQVRPF QP P TVS+K AVKF PQ+ I  GCHPYPAV   G  SGGL+ +G     
Sbjct  23   INHDQVRPFAQPKPATVSEKAAVKFNPQIHITNGCHPYPAVNAAGETSGGLQTNGAPSAG  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W    WAIMY+WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  83   CKGSGWGSQVYGRSTWYKGRWAIMYSWYFPKDSPSTT-------LGHRHDWEHVVVWIDN  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P + N  +L V+ SA  GYSK AP     V G + KV  Y +H   N AL  T+  G+ Q
Sbjct  136  PAVANPKILAVTPSAHSGYSKYAPPKAGTVTGNTAKVN-YESHWPVNHALDSTDVGGDAQ  194

Query  202  DLIQWDQL-SSLARYSLNHTDW  222
            DLI W+Q    L R    H  W
Sbjct  195  DLIMWEQQHGKLRRRQCTHERW  216

>PYIR_13275
Length=237

 Score = 196 bits (497),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 130/220 (59%), Gaps = 15/220 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF QP  VT  QK  VKFKPQ+ I  GCHPYPAV   G+ SGGL  +G  D  
Sbjct  23   IAHDAVVPFVQPTAVTTEQKLGVKFKPQIHISNGCHPYPAVDAAGNTSGGLNPTGSSDAG  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  G+Q+Y R    N V+A+MY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  83   CKGSGYGTQVYGRGVAYNGVYALMYSWYFPKDSPFT-------GLGHRHDWEHVVVWIDN  135

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   +  +L +S SA  GY K AP     VDG S KV  Y + ++ N AL  T   GE Q
Sbjct  136  PDAASPVILAISPSAHSGYEKYAPPKTDTVDGNSAKVD-YKSIVVINHALDSTTTAGEQQ  194

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
             LI WDQL++ AR +L +TD     FG A   +P+KDG F
Sbjct  195  PLIMWDQLTAAARTALENTD-----FGDA--NVPMKDGNF  227

>PHYKE_4541
Length=147

 Score = 192 bits (488),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 107/147 (73%), Gaps = 0/147 (0%)

Query  105  MYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQA  164
            MYAWYFPKGR A     + RFFGHRHNWEY +VWIDNP L++  +LGVSMSA+  YSK+A
Sbjct  1    MYAWYFPKGREAVSMHPYARFFGHRHNWEYAIVWIDNPALDDPAILGVSMSAATSYSKRA  60

Query  165  PTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
            P   KY+DG S+KV YY N ++ +TAL+LT+  GEFQDL+ WDQL   AR +L  TDWD 
Sbjct  61   PPMAKYLDGDSLKVEYYSNAVVASTALRLTKTKGEFQDLVTWDQLPDAARNALIDTDWDT  120

Query  225  TLFGLAGLKMPLKDGVFEELLDKTWPF  251
            TLF  AG K PLKDGVF E L K +P 
Sbjct  121  TLFNTAGAKFPLKDGVFNETLAKAYPL  147

>PHYRA_41766
Length=209

 Score = 194 bits (493),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 137/227 (60%), Gaps = 18/227 (8%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H +V+PF QP P T+S+K  VKFKPQ++I  GC PYPAV   G  SGGLK SG   G 
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGG  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RSAW+NDVW    +WYFPK   ++         GHRH+WE+VVV+IDN
Sbjct  61   CRGSGHGSQVYGRSAWLNDVWX---SWYFPKDSPSS-------GMGHRHDWEHVVVFIDN  110

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    ++G S S+  GY K AP     +DGTSVKV Y ++  + N  L +T D G FQ
Sbjct  111  PDVAEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQ  169

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKT  248
            DLI WDQ++  AR +LN        FG A    P+ DG F   L+K 
Sbjct  170  DLIMWDQMTEDARRALN-----GVHFGDA--NTPMNDGNFIPKLEKA  209

>PPTG_22174
Length=771

 Score = 208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 148/231 (64%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF + +P T S+K+A+K+KPQL I  GCHPYP VQ DGS+S GLKWSG     
Sbjct  545  IDHDEVQPFEEMEPTTDSEKSAIKYKPQLHISDGCHPYPVVQADGSVSAGLKWSGRYRSG  604

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RSAW    WAIMYAWYFPKG      P  +   GHRH W + +VW D+
Sbjct  605  CKGSDLGSQVYSRSAWYKGKWAIMYAWYFPKG----ANPVSVFGSGHRHYWLHAIVWTDS  660

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P  +N+T+LG SM+ +    K +    KY+ +GTS+K+  +     G  AL+LT+ +GE 
Sbjct  661  PNPDNSTILGASMAGTTNNEKTSTVKSKYLANGTSLKLDSFVGLWTGIQALRLTKKSGET  720

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QL+  AR +L+     ++      + MPL+D  F+ LL  ++PF
Sbjct  721  QDLITWEQLTDEARDALSDFS-FESSESREWVVMPLRDSAFKVLLKNSYPF  770

>PHYSO_496064
Length=254

 Score = 196 bits (497),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 138/246 (56%), Gaps = 30/246 (12%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+P TVS+K AVKFKP ++I +GCHPYPAV   G  SGGLK SG  DG+
Sbjct  22   IDHDKVQPFAQPEPTTVSEKAAVKFKPSIRIRSGCHPYPAVNAAGETSGGLKPSGEPDGD  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  S LGSQ+Y R+ W  D+WAIMY WYFPK    T    F R  G RH W   +VW+DN
Sbjct  82   CKNSSLGSQVYGRAVWYKDLWAIMYTWYFPKDSYGT----FFR-SGQRHKWASFIVWLDN  136

Query  142  PGLENATVLGVSMS-------------ASIGYSKQAPTDVKYVDGTSVKVAY---YYNHL  185
            P LE   +L VS S              + G    +P    Y++GTS  +AY   +Y  +
Sbjct  137  PSLEKPKILAVSTSFQTGEYQILKNGPPACGRRSCSPPFTDYINGTSAMLAYLDTFYGSI  196

Query  186  LGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
            L  T  +     GE QDLI W+QL+  A+ +LN TD+ +        ++P  D      L
Sbjct  197  LEMTTAR---TGGELQDLIMWEQLTEEAQIALNETDFGEK------ARVPFIDANLNANL  247

Query  246  DKTWPF  251
            ++T  F
Sbjct  248  EQTRSF  253

>PHYRA_45457
Length=199

 Score = 193 bits (491),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 122/196 (62%), Gaps = 8/196 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF +P PVT+S+K  VKFKPQL I  GCH YPAV + G   GGLK SG    +
Sbjct  12   ISHDQVIPFAEPAPVTISEKAGVKFKPQLHISNGCHSYPAVNEAGDTGGGLKTSGAPSSK  71

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY RS W +DVWAIMYAWYFPK  A+T         GHRH+WE+ V+WIDN
Sbjct  72   CKGSGYGSQIYGRSGWHSDVWAIMYAWYFPKDMASTT-------LGHRHDWEHAVIWIDN  124

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +LGVS+S+  GY+K     V  + GT+V + Y     L +  L LT   G+ Q
Sbjct  125  PDVAEPKILGVSVSSHSGYAKTTTIPVGSLVGTTVLINYESFWPL-DHELSLTTKGGDLQ  183

Query  202  DLIQWDQLSSLARYSL  217
             LI W QL+  AR SL
Sbjct  184  PLIMWSQLTDAARNSL  199

>PHYRA_39489
Length=237

 Score = 194 bits (494),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 136/230 (59%), Gaps = 16/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+K  VKFKPQL I AGC PYPAV   G  SGGLK +G  + +
Sbjct  22   VDHDKVQPFPQPAPVTISEKAXVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-DELD  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  S LGSQ+Y R+ W N VWAIMYAWYFPKG   TVP         RH+W   VVWIDN
Sbjct  81   CILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVP-------YWRHDWSNAVVWIDN  133

Query  142  PGLENATVLGVSMSASIGY--SKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            P LEN  +LG+S+S S     +   P   + ++  +    Y Y   L    L+L+   G 
Sbjct  134  PALENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRGP  193

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             QDLI W QL+  AR +LN    DQ  FG     +P+ D  F +LL++ W
Sbjct  194  VQDLIMWGQLTDAARAALN----DQDNFGRT--DVPISDDHFPKLLEEAW  237

>PHYRA_72390
Length=237

 Score = 193 bits (490),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 133/230 (58%), Gaps = 14/230 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PFPQP PVT+S+K  VKFKP+L I  GC  YPAV   G  SGGLK +G  D  
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C    LGSQ+Y R+ W NDVWAIMYAWYFPKG     P         RH+W  VVVWIDN
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDKCP-------YWRHDWSNVVVWIDN  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +E + VLG+S+S S           + +   +  + Y Y    G+  L    D G+FQ
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  193

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             LI WDQL+  AR +LN    DQ  FG    ++P+ D  F E L+K WPF
Sbjct  194  GLIMWDQLADAARAALN----DQDNFGRT--EVPISDDHFPEHLEKAWPF  237

>PHYRA_72477
Length=238

 Score = 192 bits (489),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 136/231 (59%), Gaps = 15/231 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+K  VKFKP L I  GC  YPAV   G  SGGLK SG     
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTSG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C    LGSQ+Y R+ W NDVWAIMYAWYFPKG     P     F+  RH+W   VVWIDN
Sbjct  82   CALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASP-----FW--RHDWSNAVVWIDN  134

Query  142  PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P LEN   LG+S+S S   Y      +  + +G +  ++ Y   +   T L    D+GEF
Sbjct  135  PALENPKALGLSISRSENKYGSTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGEF  193

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI WDQL+  AR +LN    DQ  FG    ++P+ D  F + L++ WPF
Sbjct  194  QDLIMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPKRLEEAWPF  238

>PITG_22916
Length=248

 Score = 193 bits (490),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 137/230 (60%), Gaps = 5/230 (2%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQVRPF QP+  T  +K AVK+KPQL I+ GCHPYPAV++DG++S GL+WSG  +G 
Sbjct  23   IDHDQVRPFAQPNAATTKEKAAVKYKPQLYIEDGCHPYPAVEEDGTISAGLEWSGDHNGH  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  S  GSQ+Y+R     D +AIMYAWYFPKG+  +          HRH+WE+ ++W D 
Sbjct  83   CKKSPRGSQVYSRGGSYKDKYAIMYAWYFPKGKGHSRK----HHDEHRHDWEFGIIWFDR  138

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                ++++ GV+ +       + P    +V G+ +K+  Y         L+LT+  G+ Q
Sbjct  139  DSDTDSSIAGVTTNIGRDLHDEVPLQPVHVVGSHIKLESYSTFWSAKQGLRLTKKKGDIQ  198

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DLIQW+QL   A+ +LN  D+D T      + +P  D  F+E +  ++PF
Sbjct  199  DLIQWEQLPKAAQTALNDADFD-TDKAKTPVVVPFNDNYFQEKVAASYPF  247

>PHYCA_69457
Length=213

 Score = 191 bits (485),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 138/228 (61%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PFPQP+PVT+S+K  VKFKPQ+++  GC PYPAV + G  SGGLK +G   G 
Sbjct  1    INHDQVKPFPQPEPVTISEKAGVKFKPQIQVRTGCEPYPAVNEFGETSGGLKPTGNPRGG  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  61   CGGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDSPSP-------GLGHRHDWEHAIVFIDN  113

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P +    +L  S+S+  GY K  P     +DGTS+KV Y ++    N  L  T D G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHS-WPTNHDLDTTGDGGSFQ  172

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI W+Q++  AR +LN  +     FG A    P  DG F   L+  W
Sbjct  173  DLIMWNQMTEDARRALNSVN-----FGSA--NTPFNDGKFMPKLENAW  213

>PHYSO_526541
Length=239

 Score = 192 bits (487),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 133/232 (57%), Gaps = 17/232 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP P TVS+K AVKFKP L+I  GCHPYPAV   G  SGGLK +GP DG+
Sbjct  22   IDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPVDGK  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y RS W  D+WAIMY+WYFPK +        L + G RH W   VVW+DN
Sbjct  82   CKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDK-------HLGYKGQRHKWVDAVVWLDN  134

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY---YYNHLLGNTALQLTEDTG  198
            P  E   VL  ++     +        ++++ T+  ++Y   Y         +  T  TG
Sbjct  135  PAFETPKVLA-NVPQRCEHGSCGKAFAEFMNNTTPMISYRPFYMETSFHTLEMTSTRGTG  193

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
            E QDLI W+QLS  AR +L+ TD     FG A  K+P  D  FE  L+   P
Sbjct  194  ELQDLIMWEQLSPEARTALSETD-----FGEAA-KVPFIDANFETNLELARP  239

>PHYSO_336498
Length=238

 Score = 191 bits (485),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 113/253 (45%), Positives = 139/253 (55%), Gaps = 17/253 (7%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R   V   A+     A  I HD+V PFPQPDPVT+S+K AVKFKPQL I+ GC  +P
Sbjct  1    MNVRGFLVILAAAFIAVDAGKIDHDKVEPFPQPDPVTISEKAAVKFKPQLLIEDGCVSFP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV   G  SGGLK     +  C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG       
Sbjct  61   AVNAAGETSGGLK-GNSGNSACDSAPLGSQVYGRAMWYKDVWAIMYAWYFPKGF------  113

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-IGYSKQAPT-DVKYVDGTSVKV  178
             F+     R +W   VVWIDNP      +LG+S S S   Y  + P  D   +DGT+  +
Sbjct  114  -FVGVASRRFDWSSAVVWIDNPDFAAPKILGISTSTSDDDYETKTPAPDYAILDGTTTLL  172

Query  179  AYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
                +   G   L  +  TG+ Q LI W+QL   AR +LN TD     FGLA   +P+ D
Sbjct  173  FRSTSREAGQPKLYYSSRTGDSQPLIMWEQLPEAARLALNTTD-----FGLA--YVPIND  225

Query  239  GVFEELLDKTWPF  251
              FE+ L K WPF
Sbjct  226  DTFEKKLKKAWPF  238

>PITG_16866
Length=238

 Score = 190 bits (482),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 132/221 (60%), Gaps = 15/221 (7%)

Query  22   IGHDQVRPFPQPDPVTV-SQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
            I HD V PF QP   T   QK  +KFKPQ+ I  GCHPYPAV  DG+ SGGL  +G    
Sbjct  22   ISHDAVIPFAQPTTTTTTEQKAGIKFKPQIHISNGCHPYPAVDADGNTSGGLNPTGSSSA  81

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C GS  GSQIY R A  N V+AIMY+WYFPK          L   GHRH+WE+VVVW+D
Sbjct  82   GCKGSGYGSQIYGRVATYNGVFAIMYSWYFPKDSP-------LTGLGHRHDWEHVVVWVD  134

Query  141  NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            +  L + +V+ VS SA  GY+   P +   +DG S KV Y  + L+ N AL  T D GE 
Sbjct  135  DIKLNSPSVIAVSPSAHSGYNIYHPPESNTIDGYSTKVDYSSSWLVINHALDSTTDAGET  194

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
            Q+LI WDQL+  AR +L +TD     FG A   +P+KDG F
Sbjct  195  QNLIMWDQLTDAARTALENTD-----FGDA--NVPMKDGNF  228

>PPTG_00460
Length=259

 Score = 190 bits (482),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 136/225 (60%), Gaps = 14/225 (6%)

Query  24   HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
            HD+V+PF QP+P+T ++K AVKFKP L + AGCHPYPAV   G  S GLK +G  DGEC 
Sbjct  22   HDKVQPFAQPEPITDAEKAAVKFKPSLAVKAGCHPYPAVNAAGDTSAGLKGTGAPDGECE  81

Query  84   GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
            GS LGSQ+Y+RS W  D WAIMYAWYFPK          L   G RH+W  +VVW+DNP 
Sbjct  82   GSPLGSQVYSRSKWYEDKWAIMYAWYFPKDMQNI----GLIKKGVRHDWVNLVVWLDNPA  137

Query  144  LENATVLGVSMSA-SIGYS-KQAPTDVKYVDGTSVKVAYYYNHLLG-NTALQLTEDTGEF  200
            L   T+L  S S    GY   + P     ++GT+ KV Y  ++  G +T  Q  E+ GE+
Sbjct  138  LAEPTILATSASTYGTGYEISKPPKRSDIINGTTPKVRYDEDNREGWHTIFQFHEE-GEY  196

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
            QDLIQW+QL++  R +L +TD     FG     +P  D  FE  L
Sbjct  197  QDLIQWNQLTNATRKALENTD-----FGDFA-NVPFNDAYFETNL  235

>PHYRA_44405
Length=232

 Score = 188 bits (478),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/229 (45%), Positives = 139/229 (61%), Gaps = 16/229 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVT+S+K AV+FKP+L+I  GCHPYPAV   G  S GLK +G  DG+
Sbjct  16   IDHDKVQPFAQPEPVTISEKAAVQFKPRLQIFGGCHPYPAVNAAGETSAGLKGTGTHDGD  75

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  SRLGSQ+Y RS W  D+W IMYAWYFPK +     P + +  GHRH W  VVVW+DN
Sbjct  76   CMRSRLGSQVYGRSVWYGDLWGIMYAWYFPKDK-----PKYRK--GHRHEWANVVVWLDN  128

Query  142  PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHLLG--NTALQLTEDTG  198
            P  E  T++G+S S  +  Y+K         DG +  + Y  + L    ++   + E  G
Sbjct  129  PAHERPTMIGMSTSWFVTTYAKYKFVPTNGFDGKTYTINYKDDVLNDGFHSVDVIWEIGG  188

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
            EFQDLI W+QL+  AR +L+ TD+ +         +P  D  F+  L+K
Sbjct  189  EFQDLIMWEQLTDEARAALSDTDFGED------APVPFIDANFKANLEK  231

>PHYSO_490000
Length=241

 Score = 188 bits (478),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 140/232 (60%), Gaps = 16/232 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PFPQ  P T++ K A+K KP+L I+ GCH +PAV  +G  SGGLK  G  +G 
Sbjct  23   IDHDQVVPFPQSQPTTITNKAALKLKPRLFINNGCHLHPAVNANGDTSGGLKPKGSPEGG  82

Query  82   CTGSRLGSQIY--ARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
            C GS  GSQ+Y   RS W N VWAIMYAWYFPK      P DF    GHRH+WE+V+V I
Sbjct  83   CRGSGSGSQVYRYGRSTWYNGVWAIMYAWYFPKDE----PTDF---DGHRHDWEHVIVRI  135

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            +NP LEN T+L ++ SA  GYS  AP     V GTS KV Y  + +  +  L+ T   GE
Sbjct  136  NNPVLENPTILAMTPSAHSGYSTYAPPPADMVSGTSCKVEYTSSWIFIDHHLEGTSTAGE  195

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W  L+  ARY+L+ T+     FG A    P+ +G F   L K WP+
Sbjct  196  TQDLIMWSDLTDAARYALSTTN-----FGKA--DTPMNNGTFNWKLSKAWPW  240

>HYAP_06628
Length=245

 Score = 188 bits (477),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 132/231 (57%), Gaps = 15/231 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I H +V+ F QP+PVT+S+K AV+  P L +  GC PYPAV + G  SGGLK +G  +G 
Sbjct  29   IPHHEVKAFAQPEPVTISEKAAVRLNPTLLVTYGCQPYPAVNEFGQTSGGLKPTGDHNGH  88

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+YARSAW  D WAIM+A+YFPK +         R    RH+WE+ VVWI N
Sbjct  89   CKGSGHGSQVYARSAWFGDKWAIMFAYYFPKSQPR-------RSVSVRHSWEFAVVWIAN  141

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTE-DTGEF  200
            P     T+   + S + GY K    D   +DG  VK+  Y+ H   +  L+LT  D G  
Sbjct  142  PEAPEKTLALTTRSFAYGYFKYTSFDASEMDGERVKLR-YWQHADSDLYLELTSLDGGVT  200

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            + LI W+QL   AR +LN   W+       G K PL D  FE LL+ +WPF
Sbjct  201  RPLIMWEQLPEKARCALNEATWN------GGFKCPLSDEAFEPLLNASWPF  245

>PHYSO_330015
Length=241

 Score = 187 bits (476),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 129/229 (56%), Gaps = 13/229 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PFPQP PVTVS+K AVK+KP L I   CHPYPAV   G  SGGLK +G +DG 
Sbjct  24   IDHDKVQPFPQPGPVTVSEKAAVKYKPNLLILDACHPYPAVNAAGETSGGLKGTGKRDGA  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y R+ W +D+WAIMYAWYFPK              G RHNW   VVW+DN
Sbjct  84   CKGSGLGSQVYGRAGWHDDMWAIMYAWYFPKD---VYYRGTFSDKGFRHNWVNAVVWLDN  140

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P LE        +    GY + +P    Y +GTS  + Y  N    +   Q T   GE Q
Sbjct  141  PALETPRYSPCRLR---GYQECSPPFTGYFNGTSAMLVYEANGEEPSALSQNTLGGGELQ  197

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
            DLI W+QL+  AR +L+ TD+ +T       K+P  D  F   L    P
Sbjct  198  DLIMWEQLTVEARDALSTTDFGET-------KVPFIDANFNANLKAARP  239

>PPTG_17295
Length=238

 Score = 187 bits (476),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 147/253 (58%), Gaps = 17/253 (7%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MNFR + +   A+LA   A+ + HD++ P PQPDPVT+S+K A+KFKPQL I  GC  +P
Sbjct  1    MNFRGLVIIIAATLAAVTARRVDHDKLGPIPQPDPVTISEKAAIKFKPQLNIADGCVSFP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV   G  SGGLK S   +  C  + +GSQ+Y R+AW ND WAIMYAW+FPKG       
Sbjct  61   AVNDGGDFSGGLKGSN-GNSACDDAPMGSQVYGRAAWYNDKWAIMYAWFFPKGF------  113

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPT-DVKYVDGTSVKV  178
             F+     R++W   VVWIDNP      VLG+S S S   Y +++P  D   ++G +  +
Sbjct  114  -FMGVASRRYDWSSAVVWIDNPDFATPAVLGLSTSTSDDEYQRKSPAPDFGILNGVTPLL  172

Query  179  AYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
                + + G   L  +  TG+FQ LI W+QL+  AR +LN  D     FG A  ++P  D
Sbjct  173  YRSISEVAGQPMLDYSSRTGDFQPLIMWEQLTDAARETLNTFD-----FGNA--QVPFND  225

Query  239  GVFEELLDKTWPF  251
              FEE L K +PF
Sbjct  226  ANFEEKLKKAYPF  238

>PHYSO_255972
Length=215

 Score = 186 bits (473),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 128/229 (56%), Gaps = 35/229 (15%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP P TVS+K AVKFKP L+I  GCHPYPAV   G  SGGLK +GP DG+
Sbjct  22   IDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPVDGK  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y RS W  D+WAIMY+WYFPK +        L + G RH W   VVW+DN
Sbjct  82   CKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDK-------HLGYKGQRHKWVDAVVWLDN  134

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P  E   VL VS  +  G                    Y   H L  T+   T  TGE Q
Sbjct  135  PAFETPKVLAVSTWSWGG-------------------GYTSFHTLEMTS---TRGTGELQ  172

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
            DLI W+QLS  AR +L+ TD     FG A  K+P  D  FE  L+   P
Sbjct  173  DLIMWEQLSPEARTALSETD-----FGEAA-KVPFIDANFETNLELARP  215

>PHYRA_84273
Length=237

 Score = 187 bits (474),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 138/231 (60%), Gaps = 16/231 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+K  VKFKPQL I  GC  YPAV   G  SGGLK SG   G 
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPQLHITTGCTSYPAVNAAGETSGGLKGSGGTSG-  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C    LGSQ+Y R+ W NDV+AIMYAWYFPKG     P     F+  RH+W   VVWIDN
Sbjct  81   CMLPPLGSQVYGRAGWHNDVYAIMYAWYFPKGFWDASP-----FW--RHDWSNAVVWIDN  133

Query  142  PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P  +   +LG+S+S S   Y K    +  + +G +  ++ Y   +   T L    D+GEF
Sbjct  134  PAHKTPKILGLSLSTSENKYGKTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGEF  192

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI WDQL+  AR +LN    DQ  FG    ++P+ D  F + L++ WPF
Sbjct  193  QDLIMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPKRLEEAWPF  237

>PITG_23228
Length=254

 Score = 187 bits (474),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 144/247 (58%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
            I HD+V+PF QP PVT+S+K A+ FKPQL    + C P+PA    G ++GGLK S   D 
Sbjct  22   IDHDKVQPFSQPTPVTISEKAAITFKPQLYTPKSVCVPFPAANAYGEITGGLKGSNGNDA  81

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C    LGSQ+Y R  W  DVWAIMYAWYFPKG        ++ F   RH+W+ VVVWID
Sbjct  82   -CVFPPLGSQVYGRVGWFRDVWAIMYAWYFPKGF-------WMGFVSRRHDWKNVVVWID  133

Query  141  NPGLENATVLGVSMSAS-IGYSKQA---PT------------DVKYVDGTSVKVAYYYNH  184
            NPGLE   +LGVSMS S   Y+K+    P+            D  Y+ G +  + +YY+ 
Sbjct  134  NPGLEEPKILGVSMSKSETKYTKERRLWPSNFAGFYRMGRRYDRSYIYGFNTFLRFYYHF  193

Query  185  LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
             +G   L L+E  GE+QDLI W+QL+ +AR +LN ++          +++P+ D  FE  
Sbjct  194  DVGTPNLYLSEWEGEYQDLIMWEQLTDVARAALNGSN------NFEEVEVPISDEHFETR  247

Query  245  LDKTWPF  251
            LD+ W F
Sbjct  248  LDEAWLF  254

>PPTG_07991
Length=276

 Score = 187 bits (476),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 136/233 (58%), Gaps = 30/233 (13%)

Query  22   IGHDQVRPF--PQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79
            I +DQV PF   QP   TV++K A+KF+P+L +  GCHPYPAV   G +S GL+ +   D
Sbjct  70   IAYDQVEPFEMAQPSDATVTEKAAIKFRPKLHVVNGCHPYPAVNAAGQVSKGLQKADATD  129

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
             EC+GS+LG+Q+Y RSAW   VWAIMYAWYFP      V PD          WE+V+VW 
Sbjct  130  AECSGSKLGTQVYGRSAWFGRVWAIMYAWYFPD-----VSPD----------WEHVIVWT  174

Query  140  DNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
            +NP + N  +L V+ S S G YS Q P D   + G SVK+AY       N AL+ T   G
Sbjct  175  NNPNVTNQVILAVTTSDSTGKYSSQVPPDASMISGKSVKIAY------NNNALESTTKEG  228

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              Q+L+ W QL+  A+ +LN    D   FG  G+++P+ D  F   L K WPF
Sbjct  229  GAQNLVLWHQLTPEAQEALN----DDQSFG--GVQVPVNDDYFLLNLGKAWPF  275

>PHYKE_7568
Length=372

 Score = 190 bits (483),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/249 (43%), Positives = 144/249 (58%), Gaps = 14/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            M+ R +   A+A+L   QA VI HDQV PF QP P T  Q+ A+KFKPQ+ I+ GCHPYP
Sbjct  136  MHLRYIAPTALAALTFTQATVISHDQVVPFSQPTPTTTIQEVAIKFKPQIYINNGCHPYP  195

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV +DG+ SGGL  +G +   C GS  GSQIY R+     V+A MY+WY PK        
Sbjct  196  AVDEDGNTSGGLAPTGSESAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDET-----  250

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
              L   GHRH+WE  VVW+D+  L+   ++ +S SA  GY+   P    Y+DG S K+ Y
Sbjct  251  --LPGLGHRHDWEACVVWLDDITLDEPNIVALSASAHSGYNVYYPPSSSYLDGDSAKIEY  308

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              ++++ + +L  T   GE QDLI WDQL+  AR +L  TD     FG A   +P K+  
Sbjct  309  SSSYIVIDHSLSATSTAGETQDLIMWDQLTDAARAALEDTD-----FGSA--NVPFKEAN  361

Query  241  FEELLDKTW  249
            F+  L   +
Sbjct  362  FQTKLGNAY  370

 Score = 117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 84/141 (60%), Gaps = 15/141 (11%)

Query  105  MYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQA  164
            MY+WYFPK          L  FGHRH+WE++VVW++NP + +  +L VS SA  GY+   
Sbjct  1    MYSWYFPKDSP-------LTGFGHRHDWEHIVVWLNNPAITSPEILAVSTSAHSGYTVYY  53

Query  165  PTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
            P D  Y+DG S K+  YY+ LL N A ++T D GE QDLI WDQL+  A+ +L  TD   
Sbjct  54   PPDSDYLDGNSAKID-YYSVLLINHAFRMTSDAGETQDLIMWDQLTDAAQTALEDTD---  109

Query  225  TLFGLAGLKMPLKDGVFEELL  245
              FG A   +P KD  FE  L
Sbjct  110  --FGDA--NVPFKDANFETKL  126

>HYAP_08306
Length=286

 Score = 187 bits (476),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 132/232 (57%), Gaps = 17/232 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            +GHD ++PFPQP PVT     A+K KP+L I  GCHPYPAV   G  S GLK SG  DG 
Sbjct  58   VGHDTLQPFPQPKPVTRLDVVAIKLKPELFIVHGCHPYPAVNATGHTSNGLKTSGDADGH  117

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y R+ W    WAIMYAWYFPK       PD     G RH+WE+ +VWI+N
Sbjct  118  CKGSGHGSQVYGRATWFRGKWAIMYAWYFPKDA-----PD--EESGQRHDWEHAIVWINN  170

Query  142  PGLENATVLGVSMSAS--IGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            P ++   +L VS+S     GY K+        DGT +K++Y  +H   +  L LT + GE
Sbjct  171  PKVKQPKILAVSVSCGKFFGYLKKVAPGPAVFDGTRLKLSYGADHKHEHR-LDLTAEKGE  229

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W+QL+  AR + +   W   +       MPL D  ++  L + WPF
Sbjct  230  DQDLIMWEQLTDEARCAFDTILWTNDM-------MPLNDAWYKHELTRAWPF  274

>PHYRA_84277
Length=240

 Score = 185 bits (469),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 134/233 (58%), Gaps = 17/233 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+K  VKFKP L I  GC  YPAV   G  SGGLK SG     
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTSG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C    LGSQ+Y R+ W NDVWAIMYAWYFPKG     P     F+  RH+W   VVWIDN
Sbjct  82   CALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASP-----FW--RHDWSNAVVWIDN  134

Query  142  PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTE--DTG  198
            P LEN   LG+S+S S   Y      D  +  GT+  ++ Y   +    AL  +   +  
Sbjct  135  PALENPKALGLSISRSENKYGSTYTDDSVFEYGTTPSLSRYLPPMQ-TAALSTSSFPNDF  193

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            E QDLI WDQL+  AR +LN    DQ  FG     +P+ D  F +LL++ WPF
Sbjct  194  ELQDLIMWDQLTDAARAALN----DQDNFGRT--DVPISDDHFPKLLEEAWPF  240

>PHYRA_76657
Length=239

 Score = 185 bits (469),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 134/232 (58%), Gaps = 16/232 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
            I HD+V+PFPQPDPVT+++K+ VKFKP+LKID   GC  YPAV   G  SGGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELKIDTEHGCVSYPAVNSAGETSGGLKGTKGTS  81

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
              CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG        + R    RH+W   VVWI
Sbjct  82   A-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKGF-------WNRRAYWRHDWSNAVVWI  133

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            D+P LEN  VLG+S+S S           + +   +    Y         AL L   +G+
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSLYRMMPTYKCAALALYYASGD  193

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L+K WPF
Sbjct  194  VQDLIMWGQLTDAARAALN----DQDNFGRT--EVPINDDHFLKHLEKAWPF  239

>PHYCA_132529
Length=232

 Score = 184 bits (468),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 138/235 (59%), Gaps = 27/235 (11%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + + +++PF QP+P+TVS K AV+FKPQL+I  GCHPYPAV + G +S G   SG  D  
Sbjct  12   VDYQEIKPFAQPEPITVSDKVAVRFKPQLRIKDGCHPYPAVNEAGDISSGAD-SGWGDSS  70

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C+GS +GSQ+Y RSAW   VW +MYAWYFPK                 H WE VVVWID+
Sbjct  71   CSGSDVGSQVYGRSAWCGGVWGMMYAWYFPKDETT-------------HRWENVVVWIDD  117

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVK--YVDGTSVKVAYYYNHLLGNTALQLTEDT--  197
            P +EN T+LGVS S+  GY + AP D      DG +V++ Y  + ++  T +    DT  
Sbjct  118  PAVENPTILGVSTSSDGGYIRYAPLDDNDWARDGDNVQIQYRLDDVMATTRVFHHLDTSW  177

Query  198  --GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
              G+ Q L+ W+QL+  AR +L + D+ ++       K+PLK+  F   LD   P
Sbjct  178  RGGDIQGLVTWEQLTEEARNTLENGDFGES-------KVPLKNSTFTANLDFAIP  225

>PPTG_14652
Length=257

 Score = 185 bits (470),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 136/229 (59%), Gaps = 14/229 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PF QP+P+T+++K AVKFKP L + +GCHPYP V   G  S GL+ +GP DG 
Sbjct  20   INHDMVKPFAQPEPITIAEKAAVKFKPSLAVKSGCHPYPIVNAAGDTSTGLEGTGPPDGG  79

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C G  LGSQ+Y+RS W  D WAIMYAWYFPK     +    L   G RH+W  +VVW+DN
Sbjct  80   CEGPELGSQVYSRSTWCEDKWAIMYAWYFPKD----IQNRGLVKTGVRHDWVNLVVWLDN  135

Query  142  PGLENATVLGVSMS--ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLG-NTALQLTEDTG  198
            P L    +L  S S   ++    + P     ++GT+ K+ Y  +     +T  Q  E+ G
Sbjct  136  PALVKPAMLATSASTYGNLYVISKPPKTSDVINGTTPKLRYDEDGYEAWHTVFQFHEE-G  194

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
            E+QDLIQW+QL+  AR +L +TD     FG+ G  +P  D  FE  L +
Sbjct  195  EYQDLIQWNQLTDAAREALTNTD-----FGVFG-HVPFIDAFFETNLKE  237

>PHYRA_72385
Length=237

 Score = 184 bits (468),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 150/249 (60%), Gaps = 14/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R  FVAA  SLA AQA VI HDQV PF QP P T  Q   +KFKPQ+ I  GCHPYP
Sbjct  1    MNLRDFFVAAAVSLAFAQADVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV + G+ SGGLK +G     C GS  GSQIY R      V+A+MY+WYFPK    T   
Sbjct  61   AVDEAGNTSGGLKPTGSSSAGCKGSGYGSQIYGRITTYEGVYALMYSWYFPKDSPVT---  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                  GHRH+WE+VVVW+D+  L++ +++ VS SA  GY+   P +   +DG S KV Y
Sbjct  118  ----GLGHRHDWEHVVVWVDDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDY  173

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              + ++ N AL  T D+GE QDLI WDQL+  AR +L +TD     FG A   +P+KDG 
Sbjct  174  SSSWVVVNHALDSTSDSGESQDLIMWDQLTDAARTALENTD-----FGDA--NVPMKDGN  226

Query  241  FEELLDKTW  249
            F   L   +
Sbjct  227  FLTKLGNAY  235

>PHYSO_254223
Length=227

 Score = 184 bits (467),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 135/230 (59%), Gaps = 33/230 (14%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+ FPQP+PVT  +K AVK+KPQL I  GCHPYPAVQ D                
Sbjct  24   IDHDQVQSFPQPEPVTDFEKFAVKYKPQLHISNGCHPYPAVQAD----------------  67

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                     +Y+RS W    W IMYAWYFPKGRA     DF    GHRH WE VVVW+DN
Sbjct  68   ---------VYSRSDWYRGKWTIMYAWYFPKGRACK--DDFKT--GHRHFWEDVVVWVDN  114

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P  +N+T+LGV M A   + K  P D KY+ DG +VK   Y +  LG   + LTED GE 
Sbjct  115  PNPDNSTLLGVPMYAGHRHIKVVPVDEKYLKDGKTVKFGSYKS--LGAQVVGLTEDYGEI  172

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
            QDLI W+QL+  AR +L+  ++     G+  + +P+KDG FE+ L+  +P
Sbjct  173  QDLITWEQLTVEARTALSEANF-HVDGGVREVVVPIKDGQFEKTLESAYP  221

>PHYRA_71307
Length=237

 Score = 184 bits (466),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 141/241 (59%), Gaps = 14/241 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN +A+   A+A+LA AQA VI HDQV PF QP P T  Q  AV FKPQ+ I+ GCHPYP
Sbjct  1    MNLQAIAAVALATLAGAQAAVIDHDQVVPFAQPTPNTTVQSVAVNFKPQIYINNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV +DG+ SGGLK +G Q   C GS  GSQIY R+     V+A MY+WY PK        
Sbjct  61   AVDEDGNTSGGLKPTGSQSAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDET-----  115

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
              L   GHRH+WE  VVW+D+  L+   ++ +S S    Y    P D  Y+DG S K+ Y
Sbjct  116  --LPGLGHRHDWENCVVWLDDITLDEPNIVALSASYHSTYLYYYPPDSDYLDGNSAKIEY  173

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              + ++ + +L  T  +GE QDLI W QL+  AR +L  TD     FG A   +P K+G 
Sbjct  174  STSWVILDHSLSATSTSGETQDLIMWGQLTDAARTALEDTD-----FGSA--NVPFKEGN  226

Query  241  F  241
            F
Sbjct  227  F  227

>PPTG_17453
Length=254

 Score = 184 bits (466),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 142/247 (57%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
            + HD++ PFPQP+P T+S+K AVKFKPQL   ++ C PYPAV   G ++GGLK +   D 
Sbjct  22   VDHDKIEPFPQPEPATISEKAAVKFKPQLYTPNSVCVPYPAVNVAGEVAGGLKGTNGNDA  81

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C  +  GSQIY R+ W ND+WAIMYAWYFPKG     P         RH+W+ VVVWID
Sbjct  82   -CKYAPKGSQIYGRAGWYNDLWAIMYAWYFPKGFWMDSP-------SRRHDWKSVVVWID  133

Query  141  NPGLENATVLGVSMSAS-IGYSKQAPT---------------DVKYVDGTSVKVAYYYNH  184
            NP  +   ++GVSMS S   Y+K+  T                  Y+ G++  + + Y  
Sbjct  134  NPESQTPKIVGVSMSKSDTRYNKETKTWPSNFAGYRMEGRRYHRTYIYGSNTSLRFQYQS  193

Query  185  LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
             LG+  L   +  GE+QDLI W+QL+  AR +LN    D   FG A  ++P  D  +E+ 
Sbjct  194  DLGSPYLNFGDWEGEYQDLIMWEQLTDAARAALN----DGNNFGDA--EVPFSDEHYEKH  247

Query  245  LDKTWPF  251
            LDK WPF
Sbjct  248  LDKAWPF  254

>PHYCA_123797
Length=241

 Score = 182 bits (463),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 135/233 (58%), Gaps = 30/233 (13%)

Query  22   IGHDQVRPFP--QPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79
            I +D+V PFP  QP   TV++K A+KF+P+LK+  GCHPYPAV   G +S GL+ + P  
Sbjct  35   IAYDKVVPFPMAQPSESTVTEKAAIKFRPKLKVVNGCHPYPAVNAAGQVSNGLEVADPTG  94

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
              C GS+LG+Q+Y RSAW   VWAIMYAWYFP   A               +WE+V+VW 
Sbjct  95   AACKGSKLGTQVYGRSAWFGRVWAIMYAWYFPDVTA---------------DWEHVIVWT  139

Query  140  DNPGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
            +NP + N  VL V+ S S  GY+ Q P D   + G SVKV+Y       N  L+ T + G
Sbjct  140  NNPNVTNQVVLAVTTSNSKGGYTSQVPPDATMMSGKSVKVSY------NNNGLESTTEEG  193

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              Q+LI W QL++ A+ +LN    DQ      G+++P+ D  F   L K WPF
Sbjct  194  GAQNLILWHQLTAAAQEALND---DQ---NFDGVQVPVNDDYFLLNLGKAWPF  240

>PPTG_11469
Length=253

 Score = 182 bits (462),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 137/247 (55%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
            + HD+++PFPQP+PVT+S+K A+KFKPQL I  G C  YPAV   G  +GGLK S   D 
Sbjct  21   VDHDKIQPFPQPEPVTISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTGGLKGSNGNDA  80

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG     P         RH+W+ VVVWID
Sbjct  81   -CKSAPLGSQVYGRAGWYKDVWAIMYAWYFPKGFWVGFPT-------RRHDWKSVVVWID  132

Query  141  NPGLENATVLGVSMSAS-IGYSKQAPTDVK---------------YVDGTSVKVAYYYNH  184
            NP LE   ++GVSMS S   Y K+                     Y  G++  + + Y  
Sbjct  133  NPDLEVPKIVGVSMSKSDTKYDKRLELFASDFAGFQMMGQGRFRTYTYGSNTSLRFGYQM  192

Query  185  LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
             LG+  L      GE+QDLI W+QL+  AR +LN    D   F  A  ++P  D  +E+ 
Sbjct  193  ELGSPYLNFGVRDGEYQDLIMWEQLTDAARAALN----DDNNFEKA--EVPFSDEHYEDH  246

Query  245  LDKTWPF  251
            LDK WP 
Sbjct  247  LDKAWPL  253

>PHYCA_12462
Length=177

 Score = 180 bits (456),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 112/161 (70%), Gaps = 11/161 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+P T S+K+AVK+KPQL+I        AVQ DGS+S GLKW+G  DG+
Sbjct  24   INHDKVQPFTQPEPTTNSEKSAVKYKPQLRIST------AVQADGSVSAGLKWTGWSDGD  77

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR           FGHRH W Y +VW+D+
Sbjct  78   CKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISK----YRFGHRHYWSYAIVWMDS  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYY  181
               +N+T+LGVSMSA +GYSK+     KY VDGT+VK   Y
Sbjct  134  DVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESY  174

>PHYSO_423056
Length=233

 Score = 182 bits (461),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 130/219 (59%), Gaps = 20/219 (9%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+KTAVKFKP L+ID GCHPYPAV   G  S GLK SGP DG+
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIDGGCHPYPAVNAAGETSAGLKGSGPDDGK  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +        +   G RH W   VVW+DN
Sbjct  61   CKGSGLGSQVYGRAIWYKDLWAIVYGWYFPKDKGF----GGILAKGQRHKWVSAVVWLDN  116

Query  142  PGLENATVLGVSM-SASIGYS--KQAPTDV----------KYVDGTSVKVAY--YYNHLL  186
            P +E   +L +S  +   GY   K  P +           +Y++ T+  ++Y  Y+    
Sbjct  117  PAVETPKILAISTWNLEGGYVILKNEPPECSRHGCDPKFAEYINMTTPMLSYEPYFQRDS  176

Query  187  GNTALQLT-EDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
             +T    T   TGE QDL+ W+QLS  AR +L   D+ +
Sbjct  177  FHTLRPTTARGTGELQDLVMWEQLSEEARIALGEADFGE  215

>PHYRA_83851
Length=239

 Score = 181 bits (460),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 135/234 (58%), Gaps = 20/234 (9%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PFPQPDPVT+S+K  VKFKPQL  + GC  YPAV   G  SGGLK +G   G 
Sbjct  22   IAHDEVQPFPQPDPVTISEKAGVKFKPQLHFEGGCAAYPAVNAAGETSGGLKGNGDISG-  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVWID  140
            C  S LGSQ+Y RS W NDVWAIMYAWYFPKG        F     H RH+W   V+WID
Sbjct  81   CEISLLGSQVYGRSEWYNDVWAIMYAWYFPKG--------FWDADPHWRHDWSNAVLWID  132

Query  141  NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG--  198
            NP LEN  +LG+S+S S        T    ++ T+  +       + + AL  ++  G  
Sbjct  133  NPALENPKILGLSLSTSENKYHTKNTYSPTINSTAPALCRDLPS-VASAALVSSDVCGRP  191

Query  199  -EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             E QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L++ WP 
Sbjct  192  LETQDLIMWGQLTDAARAALN----DQDNFGRT--EVPISDDHFPKHLEEAWPL  239

>PHYSO_365942
Length=233

 Score = 181 bits (460),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 128/223 (57%), Gaps = 28/223 (13%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+KTAVKFKP L+I  GCHPYPAV   G  S GLK  GP+DGE
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIVGGCHPYPAVNAAGETSAGLKGRGPKDGE  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +        +   G RH W   VVW+DN
Sbjct  61   CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDKGY----GSILAKGQRHKWVSAVVWLDN  116

Query  142  PGLENATVLGVSM-SASIGYS--KQAPTDV----------KYVDGTSVKVAY-------Y  181
            P LE   +L +S  +   GY   K  P             +Y++ T+  ++Y        
Sbjct  117  PALETPKILAISTWNVEGGYDILKNEPPQCYRYSCDAKFAEYINMTTPMLSYERCRPEPS  176

Query  182  YNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
            Y+ L   TA      TGE QDL+ W+QLS  AR +L   D+ +
Sbjct  177  YHTLRPTTA----RGTGELQDLVMWEQLSEEARIALGEADFGE  215

>PPTG_04799
Length=245

 Score = 181 bits (460),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 138/241 (57%), Gaps = 28/241 (12%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQL--KIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79
            I HD++ PFPQP PVT+S+K A+KFKPQL   I   C P+PAV   G ++GGLK +   D
Sbjct  22   IDHDKIEPFPQPKPVTMSEKAAIKFKPQLFTSIKTVCAPFPAVNAAGDVTGGLKGTNGND  81

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
              C  +R GSQ+Y R+ W  D+WAIMYAWYFPKG        ++ F   RH+W+ VVVWI
Sbjct  82   A-CRFARKGSQVYGRAGWHKDMWAIMYAWYFPKGF-------WMDFPTRRHDWKNVVVWI  133

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTD---------VKYVDGTSVKVAYYYNHLLGNTA  190
            DNP LE+  ++ VSMS S G S                   D TS++  ++Y   LG+  
Sbjct  134  DNPDLESPKIVAVSMSKS-GRSYHTEDQSGGLISRSFFNGFDRTSLR--FHYQTDLGSPY  190

Query  191  LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
            L      GE+QDLI W+QL+  AR +LN       ++     ++P  D  FE+ LDK WP
Sbjct  191  LNFAWWGGEYQDLIMWEQLTDPARVALND------IYNFGDAEVPFSDNNFEDYLDKAWP  244

Query  251  F  251
            F
Sbjct  245  F  245

>PITG_23211
Length=245

 Score = 181 bits (460),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 130/227 (57%), Gaps = 20/227 (9%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PF QP+P T ++KTAVKFKP L + AGCHPYP V   G    GLK +G  DGE
Sbjct  6    IDHDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGE  65

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQ+Y+RS    + WAIMYAWYFPK          L   G RH+W  +VVW+DN
Sbjct  66   CTGSPLGSQVYSRSTLYENKWAIMYAWYFPKNMQNI----GLIKKGVRHDWVNLVVWLDN  121

Query  142  PGLENATVLGVSMSASIGYSKQ-----APTDVKYVDGTSVKVAYYYNHLLG-NTALQLTE  195
            P L   T+L  S S    Y  Q      P     ++GT+ KV Y  +   G +T  Q  E
Sbjct  122  PTLAKPTILATSAST---YGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFHE  178

Query  196  DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
            + GE+QDLIQW QL+  AR +L +TD     FG     +P  D  FE
Sbjct  179  E-GEYQDLIQWTQLTDAAREALENTD-----FGDFA-NVPFNDAYFE  218

>PHYRA_71310
Length=237

 Score = 181 bits (459),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 149/249 (60%), Gaps = 14/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R  FVAA  SLA AQA VI HDQV PF QP P T  Q   +KFKPQ+ I  GCHPYP
Sbjct  1    MNLRDFFVAAAVSLAFAQADVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV + G+ SGGLK +G     C GS  GSQIY R      V+A+MY+WYFPK    T   
Sbjct  61   AVDEAGNTSGGLKPTGSSSAGCKGSGYGSQIYGRITTYEGVYALMYSWYFPKDSPVT---  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                  GHRH+WE+VVVW+D+  L++ +++ VS SA  GY+   P +   +DG S KV Y
Sbjct  118  ----GLGHRHDWEHVVVWVDDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDY  173

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              + ++ N AL  T D+GE QDLI W QL+  AR +L +TD     FG A   +P+KDG 
Sbjct  174  SSSWVVVNHALDSTSDSGESQDLIMWGQLTDAARTALGNTD-----FGDA--HVPMKDGN  226

Query  241  FEELLDKTW  249
            F   L   +
Sbjct  227  FLTKLGNAY  235

>PPTG_15234
Length=235

 Score = 181 bits (458),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 129/220 (59%), Gaps = 16/220 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF QP P T  Q  AV+FKPQ+ I+ GCHPYPAV +DG+ SGGLK +G +   
Sbjct  22   IDHDQVVPFAQPTPNTTVQSVAVQFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSESAG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY R+   + V+A MY+WY PK          L   GHRH+WE  VVW+D+
Sbjct  82   CKGSGYGSQIYGRAVEYDGVYAFMYSWYMPKDET-------LDGLGHRHDWENCVVWLDS  134

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              L+N +++ +S S    Y    P D  Y+DG S K+ Y  + ++ + +L  T   GE Q
Sbjct  135  --LDNPSIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVILDHSLSATSTVGETQ  192

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
            DLI WDQL+  AR +L  TD     FG A   +P K+  F
Sbjct  193  DLIMWDQLTDAARTALEDTD-----FGDA--NVPFKETNF  225

>PHYRA_72531
Length=236

 Score = 180 bits (457),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 131/230 (57%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFPQP+ VT+++K+ VKFKPQL I+ GC PYPAV   G  S GL+ +G  D  
Sbjct  22   IGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEYGCSPYPAVNAAGETSEGLETNGVFD--  79

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C    L SQ+Y R+ W NDVWAIMYAWYFPKG     P         RH+W   VVWIDN
Sbjct  80   CIIPSLSSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTP-------WWRHDWSNAVVWIDN  132

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P  E   VLG+S+S S           + ++  +          + + AL    + GEFQ
Sbjct  133  PAHEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLSRNVLPMRSAALGPAVNPGEFQ  192

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            DL+ WDQL+  AR +LN    DQ  FG    ++P+ D  F + L K WPF
Sbjct  193  DLVMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPKHLKKAWPF  236

>PHYRA_52260
Length=234

 Score = 180 bits (457),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 141/249 (57%), Gaps = 15/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R +F+    + +  +A  + +D+V+PFPQPDPVT ++K+ VKFKPQL I+ GC  YP
Sbjct  1    MNIRQIFIVVAVAFSSVEALSVDYDKVQPFPQPDPVTTTEKSGVKFKPQLDIEYGCSSYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV   G ++GGL  SG  D  C  +  GSQ+Y R+ W NDVWAIMYAWYFPKG     P 
Sbjct  61   AVNAAGDINGGLPTSGIAD--CQFALGGSQVYGRAEWYNDVWAIMYAWYFPKGFWDAAP-  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                    RH+W   VVWIDNP LEN  +LG+S+S S           + ++  +     
Sbjct  118  ------YWRHDWSNAVVWIDNPALENPKILGLSLSTSENKYGNTYVPAEAIENGTTPTLN  171

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                +     L+ + + GEFQDLI W QL+  AR +LN    DQ  FG    ++P+ D  
Sbjct  172  RNLPVFRAAELRPSTNRGEFQDLIMWGQLTDAARAALN----DQDTFGRT--EVPISDDH  225

Query  241  FEELLDKTW  249
            F + L++ W
Sbjct  226  FPKRLEEAW  234

>PHYSO_527850
Length=195

 Score = 179 bits (453),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 112/176 (64%), Gaps = 9/176 (5%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PFP+ +PV  S+K AVKFKPQL+I  G H YPAV++DG++S GLKW G  DGE
Sbjct  20   INHDEVQPFPELEPVGASEKAAVKFKPQLQISYGFHTYPAVRRDGAVSNGLKWGGKPDGE  79

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQ+Y RS W    WAIMYAWYFPK               HRH W Y+VVWIDN
Sbjct  80   CKGSAWGSQVYTRSDWYQGKWAIMYAWYFPKAWQEN------DLISHRHLWLYIVVWIDN  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT  197
            P   N  VLGV +  + G  ++AP D K+ +G+S+K  YY +   G T LQ T+  
Sbjct  134  PEAVNPAVLGVYVRTAGGSERRAPPDAKFFEGSSLKSEYYKS---GKTGLQRTDKA  186

>PHYCA_544885
Length=256

 Score = 181 bits (459),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 150/269 (56%), Gaps = 31/269 (12%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPY  59
            MN R +     A+LA   +  + HDQ+ PFPQP+PVTVS+K A+KFKPQL      C P+
Sbjct  1    MNLRLLVATVFAALAANASATVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKIVCVPF  60

Query  60   PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
            PAV   G ++GGLK +   DG C  +  G+QIY R+ W  D+WAIMY+WYFPKG      
Sbjct  61   PAVNAAGEVTGGLKGTNGNDG-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDS  119

Query  120  PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-IGYSKQAPTDVKYVDG--TSV  176
            P        RH+W+ VVVWIDNP LE   ++GV+MS S   YSK+      Y  G  T  
Sbjct  120  PT------RRHDWKNVVVWIDNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEG  173

Query  177  KVAYYYNHLLGNTALQLTEDT--------------GEFQDLIQWDQLSSLARYSLNHTDW  222
            + +    +L  NT+L+   DT              GE+QDLI W+QL+  AR +LN    
Sbjct  174  RFSSRVEYLGSNTSLRFEYDTSDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALN----  229

Query  223  DQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            D   FG A  ++P  D  +E+ L K WPF
Sbjct  230  DGKSFGKA--EVPFNDEHYEDHLGKAWPF  256

>PHYCA_123205
Length=177

 Score = 178 bits (451),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 111/161 (69%), Gaps = 11/161 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+P T S+ +AVK+KPQL+I        AVQ DGS+S GLKW+G  DG+
Sbjct  24   INHDKVQPFTQPEPTTNSENSAVKYKPQLRIST------AVQADGSVSAGLKWAGWSDGD  77

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR           FGHRH W Y +VW+D+
Sbjct  78   CKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISK----YRFGHRHYWSYAIVWMDS  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYY  181
               +N+T+LGVSMSA +GYSK+     KY VDGT+VK   Y
Sbjct  134  DVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESY  174

>PHYSO_504553
Length=257

 Score = 180 bits (457),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 130/221 (59%), Gaps = 27/221 (12%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+KTAVKFKP L I  GCHPYPAV   G  S GLK SG  DG+
Sbjct  24   IDHDKVQPFAQPEPVTVSEKTAVKFKPSLHIVDGCHPYPAVNAAGETSAGLKGSGRIDGK  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +      DFL   G RH W   VVW+DN
Sbjct  84   CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDKV-----DFLN-KGQRHKWVSAVVWLDN  137

Query  142  PGLENATVLGVSM-SASIGYS--KQAPTD----------VKYVDGTSVKVAYYYN-----  183
            P +E   +L +S  +   GY   K  P +          V+Y++ T+  ++Y  +     
Sbjct  138  PAVETPKILAISTWNVKGGYDILKNEPPECYRYGCDPKFVEYINMTTPMLSYVRSLEEPV  197

Query  184  HLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
            H L  T  +    TGE QDL+ W+QLS  AR +L   D+ +
Sbjct  198  HTLRPTTAR---GTGELQDLVMWEQLSEEARIALGEADFGE  235

>PPTG_08703
Length=254

 Score = 180 bits (456),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/247 (41%), Positives = 139/247 (56%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
            + HD++ P PQP+PVT+SQK A+KFKPQL   +  C  +PAV   G ++GGLK +   D 
Sbjct  22   VDHDKIEPIPQPEPVTISQKAAIKFKPQLYTSEIACVSFPAVNAAGEVTGGLKGTNGNDA  81

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C  +  GSQ+Y R+ W  D+WAIMYAWYFPKG        ++ F   RH+W+ VVVWID
Sbjct  82   -CKYAPKGSQVYGRAGWYKDLWAIMYAWYFPKGF-------WMDFPTRRHDWKNVVVWID  133

Query  141  NPGLENATVLGVSMSAS---------------IGYSKQAPTDVK-YVDGTSVKVAYYYNH  184
            NP LE   ++GVSMS S                GY  +     + Y+ G++  + + Y  
Sbjct  134  NPDLETPKIVGVSMSKSDKKYFKETKIWASNFAGYRMEGRRYHRTYIYGSNTSLRFQYQT  193

Query  185  LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
             LG+  +      GE+QDLI W+QL+ + R +LN    D   FG A  ++P  D  FE+ 
Sbjct  194  TLGSPYMNFARWDGEYQDLIMWEQLTDVVRVALN----DSKNFGKA--EVPFSDEHFEDH  247

Query  245  LDKTWPF  251
            LDK WP 
Sbjct  248  LDKAWPL  254

>PITG_23051
Length=280

 Score = 180 bits (457),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 136/244 (56%), Gaps = 33/244 (14%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLK-WSGPQD  79
            + HD+V PFPQP+PVT+S+K A+KFK QL I  G C  YPAV   G + GGL  W    D
Sbjct  22   VDHDKVEPFPQPEPVTISEKAAIKFKTQLVIPQGVCVSYPAVNAAGEVGGGLNDWDNGND  81

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF-GHRHNWEYVVVW  138
              C  + LGSQ+Y R+ W  D WAIMYAWYFPK        DF   F  HRH+W+ VVVW
Sbjct  82   A-CLSAALGSQVYGRAGWHKDRWAIMYAWYFPK--------DFWTGFPTHRHDWKSVVVW  132

Query  139  IDNPGLENATVLGVSMSAS-----------IGYSKQAPTDVKYVDGTSVKVAYYYNHLLG  187
            IDNP LE   + GVSMS S             Y   APT     +G++  + + Y    G
Sbjct  133  IDNPALEIPKIEGVSMSKSDTKYKKKLKLKESYFSGAPT-----NGSNTSLRFEYEAGFG  187

Query  188  NTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
            +T +  T   GE+Q+LI W+QL+  AR +LN    D   FG     +P  D  FE+ LD+
Sbjct  188  STFMGFTRWDGEYQNLIMWEQLTDAARATLN----DGNNFGKEA-SVPFSDEHFEDRLDE  242

Query  248  TWPF  251
             WPF
Sbjct  243  AWPF  246

>PITG_22981
Length=259

 Score = 179 bits (455),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 130/228 (57%), Gaps = 20/228 (9%)

Query  24   HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
            HD V+PF QP+P T ++KTAVKFKP L + AGCHPYP V   G    GLK +G  DGECT
Sbjct  22   HDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGECT  81

Query  84   GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
            GS LGSQ+Y+RS    + WAIMYAWYFPK          L   G RH+W  +VVW+DNP 
Sbjct  82   GSPLGSQVYSRSTLYENKWAIMYAWYFPKDMQDI----GLIKKGVRHDWVNLVVWLDNPT  137

Query  144  LENATVLGVSMSASIGYSKQ-----APTDVKYVDGTSVKVAYYYNHLLG-NTALQLTEDT  197
            L   T+L  S S    Y  Q      P     ++GT+ KV Y  +   G +T  Q  E+ 
Sbjct  138  LAKPTILATSAST---YGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFLEE-  193

Query  198  GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
            GE+QDLIQW QL+  AR +L +TD     FG     +P  D  FE  L
Sbjct  194  GEYQDLIQWTQLTDAAREALENTD-----FGDFA-NVPFNDAYFETNL  235

>PHYRA_72403
Length=239

 Score = 179 bits (453),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 131/233 (56%), Gaps = 18/233 (8%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
            I HD+V+PFPQPDPVT+++K+ VKFKP+L ID   GC  YPAV   G  SGGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGTKGTS  81

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVW  138
              CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG        F     + RH+W   VVW
Sbjct  82   A-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKG--------FWDSRAYWRHDWSNAVVW  132

Query  139  IDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
            ID+P LEN  VLG+S+S S           + +   +    Y          L     +G
Sbjct  133  IDDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSLYRMMPTYECAELVPYYASG  192

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            E QDLI WDQL+  AR +LN    DQ  FG    ++P+ D  F + L+K WP 
Sbjct  193  EVQDLIMWDQLTDAARAALN----DQDNFGRT--EVPINDDHFLKHLEKAWPL  239

>PITG_23076
Length=276

 Score = 180 bits (456),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 141/270 (52%), Gaps = 55/270 (20%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QPDPVT+S+K AVKFKPQL ID GC  +P V   G +SGGLK +   DG 
Sbjct  22   IDHDKVQPFAQPDPVTISEKAAVKFKPQLHIDRGCVSFPVVNAAGEISGGLKGTKGTDG-  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  S LGSQ Y+RSAW  D WAI++AWYFPKG AA  P         RH W  +V+WIDN
Sbjct  81   CRESPLGSQTYSRSAWYQDRWAIVFAWYFPKGFAAGQP-------RIRHYWSSMVLWIDN  133

Query  142  PGLENATVLGVSMSASI----------------------------GYSKQAPTDVKYVDG  173
            P L+  T+LGVS+S  +                            G+     T V  ++G
Sbjct  134  PALDTPTILGVSLSQQLLKPAKFLIGLFTAELQEPYNKQTSIPPAGFVGAQATVVSQING  193

Query  174  ------------TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
                         S++V++ Y +     AL      GE+ DL+ WDQL+  AR +LN  D
Sbjct  194  WSNPSNYSGGSNVSIRVSHTYTNKDDWLALTFATQDGEYHDLVTWDQLTEEARAALNSAD  253

Query  222  WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            + ++       K+P  D  F+  L+ +W F
Sbjct  254  FGES-------KVPFSDQNFQRTLELSWLF  276

>PHYKE_208
Length=187

 Score = 176 bits (447),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 113/172 (66%), Gaps = 7/172 (4%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R   V A+A++A  +A VI HDQV PF QP+  T+S+K AVKFKPQ+ +  GCHPYP
Sbjct  1    MNLRTFVVTAVAAIAAVEADVISHDQVVPFAQPEATTISEKAAVKFKPQIHVTNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV   G  SGGLK +G   G C GS  GSQ+Y RS W +  WAIMY+WYFPK   +T   
Sbjct  61   AVNSAGDTSGGLKPTGAPSGSCKGSGYGSQVYGRSTWYSGRWAIMYSWYFPKDSPST---  117

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVD  172
                  GHRH+WE+VVVWIDNP +EN T+LGVS SA  GYSK  P     VD
Sbjct  118  ----GLGHRHDWEHVVVWIDNPDVENPTILGVSPSAHSGYSKYVPPSSDTVD  165

>PPTG_13026
Length=238

 Score = 177 bits (450),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 132/231 (57%), Gaps = 15/231 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            +  ++V P  QP P T +QK A+KFKP+L I  GC  +PAV   G  S GL+        
Sbjct  22   VDFNKVVPIAQPSPSTSAQKAAIKFKPRLSITNGCVSFPAVNSAGETSSGLQEGYRGSSG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CT + LGSQ+Y R+ W N  +AI+Y WYFPKG        +  +   RH+W   VVWIDN
Sbjct  82   CTNAPLGSQVYGRTTWYNGTFAILYTWYFPKGF-------WNEYATRRHDWASAVVWIDN  134

Query  142  PGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P L + ++LG+S+S A   +   AP      DGT+ ++A+  N   G   L  T+  G+F
Sbjct  135  PELASPSILGLSVSTADWKFKTFAPASSGITDGTTPRLAHVLNVEKGYPYLTTTDTVGDF  194

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            Q+LI WDQL++ AR +LN TD     FG+A  K+P+ D  F+  L K WPF
Sbjct  195  QELIMWDQLTTAARTALNTTD-----FGVA--KVPVSDAAFDTKLKKAWPF  238

>PHYRA_52426
Length=152

 Score = 175 bits (443),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 111/160 (69%), Gaps = 8/160 (5%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +++++PF +P+P T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  1    IDNEKIQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY WY PKG     P  + R    RH WE  VVWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKG----CPTKYQR----RHFWETAVVWIDD  112

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY  181
            P L N+T+LGVS++      ++ P   +++DG+SVK+  Y
Sbjct  113  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSY  152

>PHYRA_75425
Length=237

 Score = 177 bits (449),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 131/228 (57%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF QP P T  Q  AVKFKPQ+ I+ GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  22   IDHDAVVPFAQPTPTTTLQTLAVKFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSQSSG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQIY R+     V+A MY+WY PK          L   GHRH+WE  VVW+D+
Sbjct  82   CTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDET-------LDGVGHRHDWENCVVWLDD  134

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              L+   ++ +S S    Y    P D  Y+DG S K+ Y  + +L + +L  T  +GE Q
Sbjct  135  ITLDEPNIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVLLDHSLSATSTSGETQ  194

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQL+  AR +L  TD     FG A   +P K+  FE  L   +
Sbjct  195  DLIMWDQLTDAARTALEDTD-----FGDA--NVPFKEANFETKLANAY  235

>PHYCA_576423
Length=234

 Score = 177 bits (449),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 129/228 (57%), Gaps = 16/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF QP P T  Q  A++FKPQ+ I+ GCHPYPAV  DG+ SGGLK +G Q   
Sbjct  21   IDHDQVIPFAQPMPNTTLQSVAIQFKPQIYINNGCHPYPAVDADGNTSGGLKPTGSQSAG  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  VVW+D+
Sbjct  81   CKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDET-------LDGQGHRHDWENCVVWLDS  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              L+  +++ +S S    Y+   P    Y+DG S K+ Y  + ++ + +L  T   GE Q
Sbjct  134  --LDRPSIVALSASYHSTYNYYYPPSSSYLDGNSAKIQYSTSWIVLDHSLSATSTAGEIQ  191

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQL+  AR +L  TD     FG A   +P K+  F   L K +
Sbjct  192  DLIMWDQLTDAARTALEDTD-----FGSA--NVPFKEDNFIAKLAKAY  232

>PPTG_00471
Length=239

 Score = 177 bits (449),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 129/224 (58%), Gaps = 13/224 (6%)

Query  24   HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
            HD+V+PF QP+P+T ++K A+K+KP L + AGCHPYPAV   G  S GLK +G  DGEC 
Sbjct  22   HDKVQPFAQPEPITDAEKAAIKYKPSLAVKAGCHPYPAVNAAGETSAGLKGTGAPDGECE  81

Query  84   GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
            GS LGSQ+Y+RS W    WAIMYAWYFPK     +    L   G RH+W  +VVW+DNP 
Sbjct  82   GSPLGSQVYSRSTWYEGKWAIMYAWYFPK----DIKDVGLIKKGLRHDWVNLVVWLDNPA  137

Query  144  LENATVLGVSMSASIGYSKQAP--TDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            L    +L  + S    Y K +      + ++G + KV Y  +   G   +    + GE+Q
Sbjct  138  LAKPKILATATSTFGAYYKISKPFKRSEVINGITPKVCYDNDDYKGWHTIFPFHEEGEYQ  197

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
            DLIQW+QL+  AR +  + D     FG A +  P  D  FE  L
Sbjct  198  DLIQWNQLTDAAREAFENGD-----FGEANV--PFNDAYFETNL  234

>PHYSO_560790
Length=237

 Score = 177 bits (449),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 138/244 (57%), Gaps = 18/244 (7%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R   +A +AS A   A VI HDQV PF QP P T  Q+ AVK+KPQ+ I  GCHPYP
Sbjct  1    MNLRPALLATLASFAYVSASVINHDQVVPFTQPTPTTALQQAAVKYKPQIHISNGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV  +G+ SGGL  +G +   C GS  G+QIY R+     V+A MY+WY PK        
Sbjct  61   AVDNNGNTSGGLNPTGSESAGCKGSGYGTQIYGRAVKYQGVYAFMYSWYMPKDET-----  115

Query  121  DFLRFFGHRHNWEY--VVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKV  178
              L   GHRH+WE    VVW+D+  L+N +++ +S S    Y    P D  Y+DG S K+
Sbjct  116  --LTGLGHRHDWEACNCVVWLDS--LDNPSIVALSASYHSTYLYYYPPDSDYLDGNSAKI  171

Query  179  AYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
             Y  + ++ + +L  T   GE QDLI WDQL+  AR +L  TD     FG A   +P K+
Sbjct  172  EYSTSWVILDHSLSATSTAGETQDLIMWDQLTDAARTALEDTD-----FGDA--NVPFKE  224

Query  239  GVFE  242
              FE
Sbjct  225  ANFE  228

>PHYSO_254099
Length=235

 Score = 177 bits (448),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 127/228 (56%), Gaps = 18/228 (8%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF Q +    S+K A+KFKPQL+I  GCHPYPAVQ DG++S GLKW G  DG+
Sbjct  24   INHDQVHPFAQVEAANASEKAAIKFKPQLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              GS LGSQ+Y+               Y  + + + +             W Y+V+WIDN
Sbjct  84   YQGSGLGSQVYSARPGTR---------YERREQVSAIAT---------CGWLYMVIWIDN  125

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P   N  +LGV +    G  ++ P D K++DG+S+K+ YY       T LQLT+D GEFQ
Sbjct  126  PEAINPAILGVCVRTEGGNEQRVPPDAKFLDGSSLKLDYYKRTWHRKTGLQLTKDKGEFQ  185

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DL+ W+Q++  AR +L   D+D        L +P  DG F   L+K W
Sbjct  186  DLVTWEQMTEEARITLTEADFDDHWQERNDLDVPFIDGEFTVNLEKAW  233

>PHYSO_516261
Length=227

 Score = 176 bits (447),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 128/231 (55%), Gaps = 26/231 (11%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V+PF QP+PVTVS+K AVKF+P L +++GC P+PAV   G  SGGLK +G   G 
Sbjct  22   IDHDAVQPFAQPNPVTVSEKAAVKFQPLLFVESGCVPFPAVNSAGETSGGLKGTGGTSGC  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                  GSQ+Y R+ W  D WAIMYAWYFPKG        + R+    H+W  +VVWIDN
Sbjct  82   KEAGATGSQVYGRAVWYKDDWAIMYAWYFPKGF-------WSRWASRHHDWASIVVWIDN  134

Query  142  PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P LE   ++G+S S     Y    P DV           Y     L     QL +  G+ 
Sbjct  135  PALETPKMIGISTSEGDNDYRTAGPDDV-----------YETTPRLRRVLAQLFKILGDT  183

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            Q LI W+QL+  AR +LN TD     FG A  K+P+ D  F+  L+K WPF
Sbjct  184  QPLIMWEQLTDEARITLNTTD-----FGKA--KVPMSDANFQGKLEKAWPF  227

>PHYSO_482931
Length=254

 Score = 177 bits (449),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 124/247 (50%), Gaps = 36/247 (15%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP PVT+S+K AVKFKP L I   CHPYPAV   G  S GLK  G  + +
Sbjct  24   IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y R+ W   +WAIMYAWYFPK        D +  FG RH W   VVW+DN
Sbjct  84   CRGSELGSQVYGRATWHKGMWAIMYAWYFPK--------DSVSKFGQRHKWNAAVVWLDN  135

Query  142  PGLENATVLGVSMSASIG-------------YSKQA-----PTDVKYVDGTSVKVAYYYN  183
            P +    +L VS     G             Y  ++     P  V  ++GT+  + Y   
Sbjct  136  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  195

Query  184  HLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
             +            GEFQDLI W+QL+  AR +L   D     FG      P  DG F+ 
Sbjct  196  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAAD-----FG-----APFVDGAFKS  245

Query  244  LLDKTWP  250
             LD   P
Sbjct  246  NLDSARP  252

>PHYRA_76603
Length=239

 Score = 177 bits (448),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 130/232 (56%), Gaps = 16/232 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
            I HD+V+PFPQPDPVT+++K+ VKFKP+L ID   GC  YPAV   G  SGGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCVSYPAVNSAGETSGGLKGTKGTS  81

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
              CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG        + R    RH+W   VVWI
Sbjct  82   A-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKGF-------WDRRAYWRHDWSNAVVWI  133

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            D+P LEN  VLG+S+S S           + +   +    Y          L     +GE
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSLYRMMPTYKCAELVPYYASGE  193

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L+K WP 
Sbjct  194  VQDLIMWGQLTDAARAALN----DQGNFGRT--EVPINDDHFLKHLEKAWPL  239

>PYVX_22469
Length=474

 Score = 182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 112/251 (45%), Positives = 146/251 (58%), Gaps = 15/251 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN + V V+ +A L++AQA VI HD V  F QP P T S++ A+ +KPQL I  GCHPYP
Sbjct  1    MNIKTVLVSLLAPLSIAQAAVINHDAVAAFAQPSPTTTSEEIAITYKPQLYIANGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV  DG+ SGGLK +G QD +C GS LG+QIY R+   N V+AIMY+WY PK        
Sbjct  61   AVDADGNTSGGLKPTGAQDSDCKGSALGTQIYGRATEYNGVYAIMYSWYMPKDSP-----  115

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
              L   GHRH WE VVVW+D+    + +++ VS SA   Y    P     V+GTS KV  
Sbjct  116  --LSGLGHRHEWENVVVWLDSATASSPSIVAVSPSAHGNYHIYNPPSSSNVNGTSAKVK-  172

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            Y + ++ N +L +T  +GE Q LI ++QLS  AR +L  TD     FG A   +P K+  
Sbjct  173  YESQVVINHSLDITTVSGETQPLILYEQLSEAARQALETTD-----FGSA--TVPFKNTT  225

Query  241  FEELLDKTWPF  251
            F   L    P 
Sbjct  226  FTANLALASPI  236

 Score = 170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 127/228 (56%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V PF QP P T  Q  AVKFKP L ID GCHPYPAV +DG+ SGGLK +G   G 
Sbjct  259  IDHDAVVPFAQPTPNTTEQSAAVKFKPTLYIDNGCHPYPAVDEDGNTSGGLKPTGSTTGG  318

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CTGS LGSQIY R    + VWAIMY+WY PK   +        + GHRH+WE  V+W+D+
Sbjct  319  CTGSSLGSQIYGRVMEYDGVWAIMYSWYMPKDEPS-------PYIGHRHDWENAVIWVDD  371

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                + +++ +S S   GY    P    Y  G + K+ Y     L +  L  T   GE Q
Sbjct  372  ITSASPSIVAISASEHSGYKVYYPPSADYYSGYTAKIKYESVFFLVDHCLYATSTAGETQ  431

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQL++ A+ +L  TD     FG A   +P K+  F   + K +
Sbjct  432  DLIMWDQLTAAAQTALEDTD-----FGSA--NVPFKEANFATKVAKAY  472

>PHYRA_72541
Length=239

 Score = 176 bits (446),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 131/232 (56%), Gaps = 16/232 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
            I HD+V+PFPQPDPVT+++K+ VKFKP+L ID   GC  YPAV   G  SGGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGTKGTS  81

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
              CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG       D   ++  RH+W   VVWI
Sbjct  82   A-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGFW-----DSRAYW--RHDWSNAVVWI  133

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            D+P LEN  VLG+S+S S           + +   +    Y          L     +GE
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSLYRMMPTYKCAELVPYYASGE  193

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L+K WP 
Sbjct  194  VQDLIMWGQLTDAARAALN----DQGNFGRT--EVPINDDHFLKHLEKAWPL  239

>PHYCA_124462
Length=280

 Score = 177 bits (449),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 141/275 (51%), Gaps = 65/275 (24%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHDQV+PFPQP+PVT+S+K AVK+KP L I  GC  +PAV   G ++GGLK  G +D E
Sbjct  26   IGHDQVKPFPQPEPVTISEKAAVKYKPLLSIGNGCVSFPAVNAAGEITGGLK--GTKDTE  83

Query  82   -CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH----RHNWEYVV  136
             CT + LG+Q+Y RS W  D WA+MY+WYFPK            F GH    RH+W  VV
Sbjct  84   DCTEAPLGTQVYGRSTWFQDKWAMMYSWYFPK-----------NFCGHKAADRHDWANVV  132

Query  137  VWIDNPGLENATVLGVSMSA-----------SIGYSKQAPTDV-------------KYVD  172
            +WIDNP LENAT LG S+S            ++   K+ P                + V 
Sbjct  133  IWIDNPALENATFLGASLSQQTLEPKKFVFLTVAKRKEEPYQKQKAIPMMAFAGTEQIVT  192

Query  173  GTSVKVAYYYNHLLG-NTALQ---------------LTEDTGEFQDLIQWDQLSSLARYS  216
            G   + +Y Y ++ G NT ++                    GE QDLI W+QL+  AR +
Sbjct  193  GRVSRHSYTYKYVGGSNTTMRFIHKYPEKSAWIGMSFANSDGESQDLIMWNQLTDKARAA  252

Query  217  LNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            L   D+  T       ++P  D  FE  L   WPF
Sbjct  253  LESADFGNT-------QVPFTDKNFETNLQAAWPF  280

>PITG_00957
Length=298

 Score = 176 bits (447),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 130/229 (57%), Gaps = 18/229 (8%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP P+T  +K AVKFKP L + +GCHPYPAV   G  S GLK +G  DG 
Sbjct  58   IDHDKVQPFAQPQPITDVEKAAVKFKPSLAVMSGCHPYPAVNAAGETSAGLKGTGEPDGG  117

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W    WAIMYAWYFPK     +    L   G RH+W  VVVW++N
Sbjct  118  CEGSELGSQVYSRSTWYEGRWAIMYAWYFPK----DIQNGGLAKKGIRHDWVNVVVWLNN  173

Query  142  PGLENATVLGVSMS--ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLG---NTALQLTED  196
            P +   T+L  S S   +     + P     +DG + K+   Y+   G   +T  Q   +
Sbjct  174  PAVAAPTILATSASTYGTRYVISKPPKSSDIIDGITAKLR--YDEEGGEEWHTIFQFYGE  231

Query  197  TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
             GEFQDLIQWDQL+  AR +L +TD+         + +P  D  FE  L
Sbjct  232  -GEFQDLIQWDQLTDAAREALQNTDFGDY------VNVPFNDAYFETNL  273

>PHYRA_47241
Length=176

 Score = 172 bits (437),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 109/160 (68%), Gaps = 8/160 (5%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVT S+K AV+FKP L+I +GCHPYPAV   G  S GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPEPVTDSEKAAVRFKPSLQIFSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P F +  G RH+W  VVVW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWVNVVVWLDN  136

Query  142  PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAY  180
            P LE  T++GVS S+ +  Y K  P     + GT+  + Y
Sbjct  137  PALERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTSMINY  176

>HYAP_07436
Length=267

 Score = 175 bits (444),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 132/230 (57%), Gaps = 14/230 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+++PF + +P T ++K  V+FKPQ+K   GCH Y AV   G  SGGLK  G  +G+
Sbjct  48   LPHDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGK  107

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY RSA   + WAIMYA YFPK          +   G+RH +E+V+VWID+
Sbjct  108  CKGSGFGSQIYGRSAPFGNKWAIMYALYFPKDMK-------VLNRGYRHAFEHVIVWIDD  160

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              L++  +L V+   +  Y K    D + +DG SVK+ Y    L G   L  +   GEFQ
Sbjct  161  IALKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQ  220

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             LI W+QL++ AR +L   +W +        KMPL D  F E L++ WPF
Sbjct  221  PLIMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  263

>HYAP_07925
Length=267

 Score = 175 bits (443),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 132/230 (57%), Gaps = 14/230 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD+++PF + +P T ++K  V+FKPQ+K   GCH Y AV   G  SGGLK  G  +G+
Sbjct  48   LPHDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGK  107

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY RSA   + WAIMYA YFPK          +   G+RH +E+V+VWID+
Sbjct  108  CKGSGFGSQIYGRSAPFGNKWAIMYALYFPKDMK-------VLNRGYRHAFEHVIVWIDD  160

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              L++  +L V+   +  Y K    D + +DG SVK+ Y    L G   L  +   GEFQ
Sbjct  161  IALKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQ  220

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             LI W+QL++ AR +L   +W +        KMPL D  F E L++ WPF
Sbjct  221  PLIMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  263

>PHALS_12600
Length=267

 Score = 175 bits (443),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 140/231 (61%), Gaps = 15/231 (6%)

Query  25   DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84
            D+V+PF Q  P T+SQ++A+K+KP+L +D GCHPYP VQ++GS+S G++W       C G
Sbjct  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107

Query  85   SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWIDNP  142
            S  GSQIY+RS W    WA++Y WY P    +T       +F  GHRH W +VV+W D+P
Sbjct  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTA------WFVDGHRHFWLWVVIWTDSP  161

Query  143  GLENATVLGVSMSA-SIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
              +++T+L  SMS       K AP   KY +   ++KV    + +     L+LT+  GEF
Sbjct  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QLS  AR +L++      L   A    P++D +F E+L+K++PF
Sbjct  222  QDLITWEQLSDEARAALSNF---HRLEKRAN--PPIQDKLFYEVLEKSYPF  267

>PHYSO_480321
Length=254

 Score = 174 bits (441),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 123/247 (50%), Gaps = 36/247 (15%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP PVT+S+K AVKFKP L I   CHPYPAV   G  S GLK  G  + +
Sbjct  24   IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  83

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y R+ W   +WAIMYAWYFPK        D +  FG RH W   VVW+DN
Sbjct  84   CRGSELGSQVYGRATWHKGMWAIMYAWYFPK--------DSVSKFGQRHKWNAAVVWLDN  135

Query  142  PGLENATVLGVSMSASIG-------------YSKQA-----PTDVKYVDGTSVKVAYYYN  183
            P +    +L VS     G             Y  ++     P  V  ++GT+  + Y   
Sbjct  136  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  195

Query  184  HLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
             +            GEFQDLI W+QL+  AR +L   D     FG      P  D  F+ 
Sbjct  196  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAAD-----FG-----APFVDEAFKS  245

Query  244  LLDKTWP  250
             LD   P
Sbjct  246  NLDSARP  252

>PHYCA_129892
Length=234

 Score = 172 bits (437),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 132/228 (58%), Gaps = 16/228 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV PF QP P T  Q  AV++KPQ+ I  GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  21   IDHDQVVPFAQPTPTTTLQTLAVQYKPQIYIANGCHPYPAVDEDGNTSGGLKPTGSQSAG  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY R+     V+A MY+WY PK    T+P       GHRH+WE  VVW+D+
Sbjct  81   CKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE--TLPG-----LGHRHDWEACVVWLDS  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              LEN  V+ +S S    Y    P D  Y+DG S K+ Y  + ++ + +L  T  +GE Q
Sbjct  134  --LENPNVVALSASYHSTYLTYYPPDSGYLDGNSAKIEYSTSWVILDHSLSATSTSGETQ  191

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            DLI WDQL+  AR +L  TD     FG A   +P KD  FE  L   +
Sbjct  192  DLIMWDQLTDAARTALEDTD-----FGDA--NVPFKDANFETKLANAY  232

>PHYSO_253029
Length=252

 Score = 173 bits (438),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 131/232 (56%), Gaps = 16/232 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
            I  ++V PF QP   T +QK AVKFKP+L I +G C  +PAV   G  S GL   G    
Sbjct  22   IDLNKVAPFAQPTASTSAQKAAVKFKPRLSIGSGACVSFPAVNSAGDTSSGLSEEGKGST  81

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
            +CT + LGSQ+Y R+AW N  +AI+YAWYFPKG     P         RH+W   VVWID
Sbjct  82   DCTNAPLGSQVYGRAAWYNTRFAILYAWYFPKGFWNDYPT-------RRHDWASAVVWID  134

Query  141  NPGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            NP      +LG+S+S A   YS QAP      DGT+ K+++  +   G+  L  T+ +G+
Sbjct  135  NPDSNTPKILGLSLSTADWEYSTQAPATSGISDGTTPKLSHELSVECGDPYLTTTDGSGD  194

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            FQ LI W+QL++ AR +LN  D     FG A  K+P  D  FE  L   WPF
Sbjct  195  FQPLIMWEQLTTAARTALNSAD-----FGNA--KVPTSDVNFEMKLKSAWPF  239

>PHYCA_109163
Length=247

 Score = 173 bits (438),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 139/241 (58%), Gaps = 26/241 (11%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
            + HDQ+ PFPQP+PVTVS+K A+KFKPQL      C P+PAV   G ++GGLK +   +G
Sbjct  22   VDHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPGNLCAPFPAVNAAGEVTGGLKGTN-GNG  80

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C  +  G+Q+Y R+ W  DVWAIMY+WYFPKG       ++L F   RH+W+ VVVWID
Sbjct  81   ACKHATKGAQVYGRAGWYKDVWAIMYSWYFPKGF------NWLGFPTRRHDWKNVVVWID  134

Query  141  NPGLENATVLGVSMSAS-IGYSKQAPTDVKYVDGTSVKV---------AYYYNHLLGNTA  190
            NP LE   ++GV++S S   Y K       Y  G+ ++           ++YN  +  + 
Sbjct  135  NPALETPKIVGVALSKSDTKYRKVREVWPPYFVGSEIRYDSSPASSTNIHFYN--VAGSD  192

Query  191  LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
            L      GE+ DLI W+QL+  AR +LN+++     FG A  ++P  D  +E  LD+  P
Sbjct  193  LDFARWDGEYHDLIMWEQLTDAARVALNNSE----FFGDA--EVPFSDEHYENHLDRACP  246

Query  251  F  251
             
Sbjct  247  L  247

>PHYCA_109162
Length=257

 Score = 173 bits (438),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/247 (40%), Positives = 133/247 (54%), Gaps = 28/247 (11%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
            + HD++ PFPQP+PVTVS+K A+KFKPQL      C P+PAV   G ++GGL  +   D 
Sbjct  22   VDHDKIEPFPQPEPVTVSEKAAIKFKPQLYTHKQLCAPFPAVNAAGEVTGGLSGANGNDA  81

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C  +  G+Q+Y R+ W  DVWAIMY+WYFPKG       ++L F   RH+W+ VVVWID
Sbjct  82   -CKYALKGAQVYGRAGWYKDVWAIMYSWYFPKGF------NWLGFPTRRHDWKNVVVWID  134

Query  141  NPGLENATVLGVSMSAS-IGYSKQAPTDVKYVDGTSVKVAYYYNHLL-------------  186
            NP LE   ++GV+M+ S   Y ++         G+ V+V                     
Sbjct  135  NPELETPKIIGVAMAGSDTKYRREREMYNSNFVGSQVQVTRRDRRYYRSDSPGSSTNLRF  194

Query  187  --GNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
              G T L      G++QDLI W+QL+  AR +LN    D   FG +  ++P  D  FE  
Sbjct  195  ENGATHLDFARQDGDYQDLIMWEQLTDAARIALN----DNGSFGYSYAEVPFSDEHFEAN  250

Query  245  LDKTWPF  251
             DK WP 
Sbjct  251  RDKAWPL  257

>PPTG_13004
Length=255

 Score = 173 bits (438),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 139/249 (56%), Gaps = 34/249 (14%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            +  D V+PF QP+PVTV +K A+KFKP L ID GC  +PAV + G++S GL+     DG 
Sbjct  22   VDCDFVKPFAQPEPVTVLEKVALKFKPTLLIDGGCVSFPAVNEAGAISSGLRPLNGNDG-  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  +  GSQ+Y RS    D WAIM+AWYFPKG  + +P         RH+W  +VVWID+
Sbjct  81   CIKAPQGSQVYGRSTQFQDKWAIMFAWYFPKGFWSGMP-------SRRHDWASMVVWIDD  133

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVK-----------------YVDG--TSVKVAYYY  182
            P  E   +LGVS+S S     +A   +                  YV+G  TS+++++  
Sbjct  134  PDFETPKLLGVSLSKSKKRYTKATAPLSEVYFAGFQEYGRRGYKTYVNGSSTSIRISHSS  193

Query  183  NHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
                G  +L L+   G++QDLI W QL+  AR +LN  ++ +++       +P  D  FE
Sbjct  194  GFFFGPASLDLSTRDGDYQDLIMWKQLTEEARKALNSANFGKSV-------VPFNDDNFE  246

Query  243  ELLDKTWPF  251
            ++L+K WPF
Sbjct  247  DMLEKAWPF  255

>HYAP_14846
Length=221

 Score = 172 bits (435),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 131/237 (55%), Gaps = 29/237 (12%)

Query  22   IGHDQVRPFPQ----PDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGP  77
            I HDQV+PF Q      P  V+   A+KFKPQL I +GCH YPAV   G  SGGLK +G 
Sbjct  4    IKHDQVQPFQQVVGDDSPTAVA---ALKFKPQLHISSGCHSYPAVNTVGEFSGGLKPTGH  60

Query  78   QDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVV  137
             +G+C GS  GSQ+Y RSAW  D WAIMY WYFPK                RH+WE++VV
Sbjct  61   DNGKCKGSGYGSQVYGRSAWHQDKWAIMYVWYFPKDNRDD----------DRHDWEHIVV  110

Query  138  WIDNPGLENATVLGVSM---SASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLT  194
            W+DNP + N  +L VS+     S  ++   P  V +VDG+SVK+ Y   +    T L LT
Sbjct  111  WLDNPAVANQKLLAVSLWNGRKSDYWTLAIPGPV-FVDGSSVKLDYGKANKDERT-LSLT  168

Query  195  EDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               GEFQ LI W Q+S  AR + N   W +         MPL D  FE+ L K + F
Sbjct  169  HLAGEFQPLIMWGQMSEKARTTFNTVLWRKEF-------MPLSDSCFEQHLKKAYDF  218

>PHYSO_328418
Length=219

 Score = 171 bits (434),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 115/213 (54%), Gaps = 21/213 (10%)

Query  40   QKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVN  99
            QK AVKFKPQLK+   CHPY AV   G +SGGL         C GS LG+QIYARSAW +
Sbjct  27   QKAAVKFKPQLKLSNTCHPYAAVDAHGYISGGLNSELHIRNNCGGSDLGAQIYARSAWHS  86

Query  100  DVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG  159
            DVWA +YAWYFPK       P        R  W Y ++W+  PG+    V+G ++     
Sbjct  87   DVWATVYAWYFPKNSNNGGGP--------RSLWMYAIIWVGGPGVGAPEVVGATLKTDDD  138

Query  160  YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNH  219
              K AP D  Y+DGTS +  + YN       L  T+ TG +QDLI W+QL  +AR     
Sbjct  139  TEKHAPVDADYIDGTSFECKFTYNFWTTKAKLTATKKTGGYQDLITWEQLPEVART----  194

Query  220  TDWDQTLFGLAGLK-MPLKDGVFEELLDKTWPF  251
                    GLAG   MPL +G FEELL   WPF
Sbjct  195  --------GLAGYADMPLLNGTFEELLTNGWPF  219

>PHYKE_8391
Length=778

 Score = 183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 108/144 (75%), Gaps = 4/144 (3%)

Query  105  MYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQA  164
            MYAWYFPKGR  T         GHRHNWEY +VWIDNP L+N+T+LGVSMSAS GYSK +
Sbjct  1    MYAWYFPKGRKITGGAGL----GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSS  56

Query  165  PTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
            P   K+VDG+SVK+ YYY+ + GNTAL+ TED GE QDLI WDQL  +A+ +LN+TDWD 
Sbjct  57   PPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116

Query  225  TLFGLAGLKMPLKDGVFEELLDKT  248
            TL+ +  +KMPLKDG F + L +T
Sbjct  117  TLWNMCDVKMPLKDGEFTKNLAET  140

>PHYCA_69122
Length=249

 Score = 172 bits (436),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 138/246 (56%), Gaps = 31/246 (13%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
            + HDQ+ PFPQP+PVTVS+K A+KFKPQL      C P+PAV   G ++GGLK +   DG
Sbjct  17   VNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKLVCVPFPAVNTAGEITGGLKGTNGNDG  76

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C  +  G+QIY R+ W  D+WAIMY+WYFPKG      P        RH+W+ +VVWID
Sbjct  77   -CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDSPT------RRHDWKNIVVWID  129

Query  141  NPGLENATVLGVSMSAS-IGYSKQAPTDVKYVDG--TSVKVAYYYNHLLGNTALQLTEDT  197
            NP LE   ++GV+MS S   YSK+      Y  G  T  + +    +L  NT+L+   DT
Sbjct  130  NPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYLGSNTSLRFEYDT  189

Query  198  --------------GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
                          GE+QDLI W+QL+  AR +LN    D   F  A  ++P  D  +E+
Sbjct  190  SDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALN----DGKSFEKA--EVPFSDEHYED  243

Query  244  LLDKTW  249
             L K W
Sbjct  244  HLGKAW  249

>PHYSO_521124
Length=254

 Score = 172 bits (436),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 137/242 (57%), Gaps = 27/242 (11%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +D+V+PFP+ +P T+S+K A+K+KP L I  GCH Y AV   G  SGG+    P  G 
Sbjct  11   IDYDKVQPFPELEPKTISEKAAIKYKPSLAIWDGCHSYAAVNAAGDTSGGMDPKAPDGGT  70

Query  82   ---------CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA---ATVPPDFLRFFGHR  129
                     C GS LGSQ+Y+RS W  DVWAIMYAWYFP+  +    + PP        R
Sbjct  71   QVQNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWYEESSPP-------VR  123

Query  130  HNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGN  188
            H+W   +VW+DNP LEN ++LGVS S     Y    PT   Y++GT  K+ YY   ++G 
Sbjct  124  HDWINTIVWLDNPALENPSLLGVSASREGAVYVTYPPTVKGYMNGTHPKMEYYLGFIVGG  183

Query  189  -TALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
               + ++ + G+FQDL+ W QL+  AR +L   D     FG+    +P  D  FE+ L++
Sbjct  184  YHTIDVSLEAGDFQDLVHWSQLTDQARKALETAD-----FGVV-TPVPFNDVNFEKNLER  237

Query  248  TW  249
             W
Sbjct  238  GW  239

>PHALS_13513
Length=240

 Score = 171 bits (434),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 133/236 (56%), Gaps = 24/236 (10%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I  + V+PFP+  P T S+++A+K+KP L +  GCHPYPAVQ++GS+S G +W       
Sbjct  23   IDANSVQPFPEQKPQTDSERSALKYKPHLHVSEGCHPYPAVQQNGSVSAGFEWDEDYSQP  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPK-----GRAATVPPDFLRFFGHRHNWEYVV  136
            C  S  GSQIY+RS+W    WAIMYAWYFPK     GR  +         G RH W + +
Sbjct  83   CGRSPQGSQIYSRSSWYKGKWAIMYAWYFPKAAVHIGRGVS---------GRRHYWLHAI  133

Query  137  VWIDNPGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTE  195
            VW D     N+++LGV+MSA IG  K+      Y + GT++K+  Y +      AL+ T 
Sbjct  134  VWTDEENPNNSSILGVTMSAGIGLLKRTKIKSHYIIGGTTLKLMSYVSFWGRRLALKFTV  193

Query  196  DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              GE QDLI W+QLS  AR +L   D+            PL+D  F+ L+ + +PF
Sbjct  194  KLGETQDLITWEQLSHEARKALA-LDYKS--------DTPLQDYRFDGLIKEAYPF  240

>PPTG_16647
Length=254

 Score = 172 bits (435),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 137/247 (55%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
            + HD+V PFPQP PVT+S+K A+KFKPQL      C P+P V   G ++GGLK +   D 
Sbjct  22   VDHDKVEPFPQPVPVTISEKAAIKFKPQLYTPYNICVPFPGVNAVGEVTGGLKGTNGNDA  81

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C  +  GSQIY R  W  D+WAIMYA Y PKG    +P         RH+ + VVVWI+
Sbjct  82   -CKYAPKGSQIYGRGGWYKDIWAIMYACYLPKGFWMDLP-------SRRHDGKSVVVWIN  133

Query  141  NPGLENATVLGVSMSAS---------------IGYSKQA-PTDVKYVDGTSVKVAYYYNH  184
            NPG E   ++GVSMS S                GY K+   ++  Y+ G++  + + Y  
Sbjct  134  NPGFETPKIVGVSMSKSDTKYYKETKIGPFAFAGYRKEGRRSERAYIYGSNTSLRFQYES  193

Query  185  LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
             LG++ L   +  GE+QDLI W+QL+  AR +LN    D   FG A  ++P  D  +++ 
Sbjct  194  GLGSSYLSFADCDGEYQDLIMWEQLTDAARAALN----DGNNFGDA--EVPFSDEHYKQH  247

Query  245  LDKTWPF  251
            LDK WP 
Sbjct  248  LDKAWPL  254

>PHYCA_114913
Length=224

 Score = 171 bits (432),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 124/227 (55%), Gaps = 26/227 (11%)

Query  25   DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84
            D+V PFP+ +P T+SQK AV+ KPQL I  GCHPY AV   G ++ G+  +  +D +C+G
Sbjct  21   DKVEPFPELEPTTISQKAAVRLKPQLHISKGCHPYAAVNAAGEITAGI--TTTRDPDCSG  78

Query  85   SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGL  144
              +GSQ+Y RS W  DVWAIMYAWYFP                  H+W+ +VVWIDNP L
Sbjct  79   RGIGSQVYVRSTWYKDVWAIMYAWYFPSSLI--------------HDWKNIVVWIDNPSL  124

Query  145  ENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLI  204
                VLGVS     GY +    +    DG S K+ Y Y        L  T   GEFQ+LI
Sbjct  125  AVPRVLGVSAQVDGGYLRYNKFNWDKFDGASPKIKYDYPD------LDWTSKRGEFQNLI  178

Query  205  QWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             WDQL+  AR +LN+T++     G     +P  D  F+  LD   P+
Sbjct  179  MWDQLTEAARTALNNTNFK----GNGDATVPFIDANFKANLDFAIPY  221

>PHYRA_72430
Length=238

 Score = 171 bits (433),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 127/231 (55%), Gaps = 15/231 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I   +V P  QP P T ++K  VKFKPQL I  GC  +PAV   G  + GLK        
Sbjct  22   IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C+ + LGSQ+Y RSAW N  +AI+YAWYFPKG  A V          RH+W   VVWID 
Sbjct  82   CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWANVAT-------RRHDWASAVVWIDR  134

Query  142  PGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P   + ++LG+S+S A   Y  QAP       GT+ ++++      G   L  T+ TG  
Sbjct  135  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  194

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QLSS AR +L+ TD     FG A  K+P+ D  F+  L K WPF
Sbjct  195  QDLIMWEQLSSAARTALSTTD-----FGNA--KVPMSDANFQTKLKKAWPF  238

>PHYRA_72306
Length=238

 Score = 171 bits (433),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 127/231 (55%), Gaps = 15/231 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I   +V P  QP P T ++K  VKFKPQL I  GC  +PAV   G  + GLK        
Sbjct  22   IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  81

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C+ + LGSQ+Y RSAW N  +AI+YAWYFPKG  A V          RH+W   VVWID 
Sbjct  82   CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWANVAT-------RRHDWASAVVWIDR  134

Query  142  PGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P   + ++LG+S+S A   Y  QAP       GT+ ++++      G   L  T+ TG  
Sbjct  135  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  194

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QLSS AR +L+ TD     FG A  K+P+ D  F+  L K WPF
Sbjct  195  QDLIMWEQLSSAARTALSTTD-----FGNA--KVPMSDANFQTKLKKAWPF  238

>PHYRA_52427
Length=124

 Score = 167 bits (422),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 94/132 (71%), Gaps = 8/132 (6%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF +P+P T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR+             RH WE  VVWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRSTR--------HQRRHFWETAVVWIDD  112

Query  142  PGLENATVLGVS  153
            P L N+T+LGVS
Sbjct  113  PALANSTILGVS  124

>PHYCA_553546
Length=280

 Score = 171 bits (434),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 137/271 (51%), Gaps = 57/271 (21%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PFPQP+PVT+S+K AVK+KPQL+I  GC  +PAV   G ++GGLK  G +D E
Sbjct  26   IDHDQVKPFPQPEPVTISEKAAVKYKPQLEIGDGCVSFPAVNAAGEITGGLK--GTKDTE  83

Query  82   -CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             CT + LGSQ+Y RS W  D WA+MY+WYFPK   A            RH+W  VV+WID
Sbjct  84   ACTEAPLGSQVYGRSTWFQDKWAMMYSWYFPKNFCAYKA-------AGRHDWANVVIWID  136

Query  141  NPGLENATVLGVSMSAS-----------IGYSKQAPTD----------------------  167
            NP  EN T LG S+S             +G   + P                        
Sbjct  137  NPAAENVTFLGASLSQQTLEPIKLAILPMGTRNEEPYQNQKAIPMMAFAGAERITTGRVG  196

Query  168  -----VKYVDG--TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHT  220
                  KYV G  T+++ ++ Y    G   +   +  GE QDLI W+QL+  AR +L   
Sbjct  197  RWSYTYKYVAGSNTTMRFSHSYPGTWGWIDMTFADSDGESQDLIMWNQLTDKARAALESA  256

Query  221  DWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            D+  T       ++P  D  F+  L   WPF
Sbjct  257  DFGDT-------QVPFTDKNFDTNLQAAWPF  280

>PHYSO_514298
Length=264

 Score = 171 bits (433),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 137/242 (57%), Gaps = 27/242 (11%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +D+V+PFP+ +P T+S+K A+K+KP L I  GC  Y AV   G  SGG+    P  G 
Sbjct  22   IDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDPMAPDGGT  81

Query  82   ---------CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA---ATVPPDFLRFFGHR  129
                     C GS LGSQ+Y+RS W  DVWAIMYAWYFP+  +   A+ PP        R
Sbjct  82   VEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWYEASYPP-------VR  134

Query  130  HNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGN  188
            H+W   +VW++NP LEN ++LGVS S     Y    PT  ++++GT  K+ Y+    +G 
Sbjct  135  HDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFYVGG  194

Query  189  -TALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
               + ++ D G+FQDL+ W QL+  AR +L   D     FG+    +P  D  FE+ L++
Sbjct  195  YHTIDVSLDAGDFQDLVHWSQLTDQARKALETAD-----FGVV-TPVPFNDVNFEKNLER  248

Query  248  TW  249
             W
Sbjct  249  GW  250

>PHYRA_47103
Length=226

 Score = 169 bits (429),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 124/220 (56%), Gaps = 15/220 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PFPQP+ VT+++K+ VKFKPQL I+ GC PYPA    G  S GL+ +G  D  
Sbjct  22   IGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEXGCSPYPAANAAGETSEGLETNGAFD--  79

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C    LGSQ+Y R+ W NDVWAIMYAWYFPKG     P         RH+W   VVWIDN
Sbjct  80   CIIPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTP-------WWRHDWSNAVVWIDN  132

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
            P  E   VLG+S+S S           + ++  +          + + AL    + GEFQ
Sbjct  133  PAHEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLSRNVLPMRSAALGPAVNPGEFQ  192

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
            DL+ W QL+  AR +LN    DQ  FG    ++P+ D  F
Sbjct  193  DLVMWTQLTDAARAALN----DQDNFGRT--EVPISDDHF  226

>PHYSO_365377
Length=220

 Score = 169 bits (428),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 131/232 (56%), Gaps = 20/232 (9%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +DQV PFP+  P T+S+K A+KFKP L I  GCHPY AV   G  SGGL      D E
Sbjct  1    IDYDQVEPFPELGPKTISEKAAIKFKPTLFIKDGCHPYAAVNAAGDTSGGLD-PKASDDE  59

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS W  + WA MYAWYFPK          L   G RH+W   +VW+DN
Sbjct  60   CKGSTLGSQVYSRSTWYRNTWATMYAWYFPKDTN-------LYLRGVRHDWVSAIVWLDN  112

Query  142  PGLENATVLGVSMS---ASIG--YSKQAPTDVKYVDGTSVKVAYY-YNHLLGNTALQLTE  195
            P L N T++GVS S   AS G  +  ++     YVDGT  K+ Y   +   G   +  +E
Sbjct  113  PALANQTLIGVSFSSGGASYGGFHLDRSRMWDGYVDGTHPKMEYSAADTRSGYHTIDASE  172

Query  196  DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
            D G+FQDLI W QL+  AR +L   D     FG +   +P  +  F++ L++
Sbjct  173  DVGDFQDLIHWSQLTEEARNALETGD-----FG-SDTPVPFNNANFKKNLER  218

>PHALS_14425
Length=302

 Score = 171 bits (434),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 132/230 (57%), Gaps = 10/230 (4%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            +G D V PFP+    T SQK+A+ F+PQL I+ GCHPYPAVQ +GS++ GL++   +D  
Sbjct  81   LGADSVHPFPRTKARTSSQKSALMFQPQLYIEDGCHPYPAVQSNGSLNAGLEYELFRDPT  140

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS LGSQ+Y+RS+W    WA +Y WYFP       P       GHRH W + +VW  +
Sbjct  141  CEGSPLGSQVYSRSSWYQMKWATIYTWYFPVAYDHASP----FSTGHRHYWLWAIVWTTD  196

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P       L VSMS + G S      +K+ V+GT+V +  + + +    AL LTE +GE 
Sbjct  197  PNPAEGHFLAVSMSGNFGISSYTLPHIKHLVNGTTVLLKSHKSLMSARLALDLTEKSGEK  256

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
            +DLI W++L+  AR +L+     +     A    PL+D  F  LL+K +P
Sbjct  257  EDLITWEELTPEARAALSSVKRTE-----ATANSPLQDNKFFSLLEKAYP  301

>PPTG_00542
Length=238

 Score = 169 bits (427),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 145/255 (57%), Gaps = 21/255 (8%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPY  59
            MNFR   +    +L   +A  I HD+  P PQP+PVTVS+K AVKFKP+L I  G C  +
Sbjct  1    MNFRRFIITITVALLSVEAISINHDKAEPIPQPEPVTVSEKAAVKFKPELTIGKGTCASF  60

Query  60   PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
            PAV   G  SGGLK      G C  S LGSQ+Y R+ W NDVWAIMYAWYFPKG     P
Sbjct  61   PAVNTAGETSGGLK-GSGGTGGCKVSLLGSQVYGRAQWYNDVWAIMYAWYFPKGFWDASP  119

Query  120  PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKV  178
                 F+  RH+W   VVW+DNP  EN  VLG+S+S +S  Y+K+ P   +  +G +  V
Sbjct  120  -----FW--RHDWANAVVWVDNPAAENPKVLGISLSKSSDRYNKEVPA--RLANGNT-PV  169

Query  179  AYYYNHLLGNTALQLTEDTGEFQ--DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPL  236
              YYN  L   AL  +  +      DLI W+QL+ +AR SLN    D+  FG + +  P 
Sbjct  170  VTYYNRGLNTAALMSSSTSSGESPLDLIMWEQLTDVARASLN----DKENFGRSDV--PF  223

Query  237  KDGVFEELLDKTWPF  251
             D  F   L+K WPF
Sbjct  224  SDENFPGRLEKAWPF  238

>PHYSO_334500
Length=235

 Score = 169 bits (427),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/249 (44%), Positives = 143/249 (57%), Gaps = 16/249 (6%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN RA+    + SLA+    VI HD V PF QP P T  Q  AVKFKPQ+ I  GCHPYP
Sbjct  1    MNLRAIVATTVGSLALVSGAVIDHDTVVPFAQPTPTTTLQTLAVKFKPQIYIANGCHPYP  60

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV +DG+ SGGLK +G +    TGS LGSQIY R+     V+A MY+WY PK    T+P 
Sbjct  61   AVDEDGNTSGGLKPTGSESSGYTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDE--TLPG  118

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                  GHRH+WE  VVW+D+  L++ +++ +S S    Y    P D  Y+DG S K+ Y
Sbjct  119  -----LGHRHDWEACVVWLDS--LDDPSIVALSASYHSTYLTYYPPDSDYLDGNSAKIEY  171

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              + ++ + +L  T   GE QDLI WDQL+  AR +L  TD     FG A   +P K+  
Sbjct  172  STSWVILDHSLSATSTAGETQDLIMWDQLTDAARTALEDTD-----FGSA--NVPFKEAN  224

Query  241  FEELLDKTW  249
            F   + K +
Sbjct  225  FATKVAKAY  233

>PPTG_18463
Length=254

 Score = 169 bits (428),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 144/270 (53%), Gaps = 35/270 (13%)

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MNF A  V  + +L       I  D V+PF QP PVT+S+K A+KFKPQL I  GC  +P
Sbjct  1    MNFFAAIVVCLVALQSVYCATINRDLVQPFAQPGPVTISEKAAIKFKPQLFILDGCVSFP  60

Query  61   AVQKDGSMSGGLKWSGPQDGE-CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
            AV   G  +GGL  +G Q GE C+ + LGSQ+Y RS W  D WA+M+AWY PK   A + 
Sbjct  61   AVNAAGDTTGGL--NGTQGGEGCSKAPLGSQVYGRSTWYQDKWAMMFAWYIPKSYMAAIT  118

Query  120  PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASI----------------GYSKQ  163
                     RH+W  +VVWI+NP LE   +LGVS+S S                 GY  +
Sbjct  119  -------SRRHDWASMVVWIENPSLEIPEILGVSLSNSANGYLRYTGNIYDWNFSGYVAR  171

Query  164  APTDVKYVDG--TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
            +    + + G  TS++V +       +  L L +  G++QDLI W QL+  AR +LN TD
Sbjct  172  SRRRDRDIPGSSTSLRVEHTVRKDFRSAFLNLAQTDGDYQDLIMWGQLTEEARMALNTTD  231

Query  222  WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            + ++       K+P  DG F   L + +PF
Sbjct  232  FGRS-------KVPFNDGNFLIKLRQAYPF  254

>PHYSO_246397
Length=264

 Score = 169 bits (428),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 137/242 (57%), Gaps = 27/242 (11%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I +D+V+PFP+ +P T+S+K A+K+KP L I  GC  Y AV   G  SGG+    P  G 
Sbjct  22   IDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDPMAPDGGT  81

Query  82   ---------CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA---ATVPPDFLRFFGHR  129
                     C GS LGSQ+Y+RS W  DVWAIMYAWYFP+  +   A+ PP        R
Sbjct  82   VEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWDEASYPP-------VR  134

Query  130  HNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGN  188
            H+W   +VW++NP LEN ++LGVS S     Y    PT  ++++GT  K+ Y+    +G 
Sbjct  135  HDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFYVGG  194

Query  189  -TALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
               + ++ + G+FQDL+ W QL+  AR +L   D     FG+    +P  D  FE+ L++
Sbjct  195  YHTIDVSLEAGDFQDLVHWSQLTDQARKALETAD-----FGVV-TPVPFNDVNFEKNLER  248

Query  248  TW  249
             W
Sbjct  249  GW  250

>PHYCA_124383
Length=280

 Score = 169 bits (429),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 132/270 (49%), Gaps = 55/270 (20%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+K AVK+KP L I  GC  +PAV   G ++GGLK       +
Sbjct  26   IDHDQVKPFRQPEPVTISEKAAVKYKPLLSIGDGCVSFPAVNTAGEITGGLK-GTKNTKD  84

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            CT + LGSQ+Y RSAW  D WA+MY WYFPK   A            RH+W  VVVWIDN
Sbjct  85   CTEAPLGSQVYGRSAWYQDKWAMMYTWYFPKNFCAYKA-------AGRHDWANVVVWIDN  137

Query  142  PGLENATVLGVSMSA-----------SIGYSKQAPTD-----------------------  167
            P LENAT LG S+S            ++   K+ P +                       
Sbjct  138  PALENATFLGASLSQQTLEPIKLVFLALAQRKEEPYENQKEIPMMAFAGTEQIATAMVGR  197

Query  168  ----VKYVDG--TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
                 KYV G  T+++  + Y        +      GE QDLI W+QL+  AR +L   D
Sbjct  198  WSYIYKYVGGSNTTMRFIHKYPQKFAWIGMSFAYSDGESQDLIMWNQLTDKARAALESAD  257

Query  222  WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            +  T       ++P  D  FE  L   WPF
Sbjct  258  FGNT-------QVPFTDKNFETNLQAAWPF  280

>PHYRA_52296
Length=237

 Score = 168 bits (425),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 126/231 (55%), Gaps = 18/231 (8%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PFPQPDPVT+S+K  VKFK  L I  GC  YPAV   G  SGGLK SG   G 
Sbjct  22   IAHDEVQPFPQPDPVTISEKAGVKFKIPLNIQEGCASYPAVNAAGETSGGLKGSGGISG-  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  S LGSQ+Y R+ W NDVWAIMYAWYFPKG   + P         RH+W   ++WIDN
Sbjct  81   CELSLLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDSTP-------WWRHDWSNAILWIDN  133

Query  142  PGLENATVLGVSMSAS---IGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
            P  EN  +LG+S+S S    G     P            +A      + +  +  T    
Sbjct  134  PAHENPKILGLSLSTSENKYGNKNTYPPAENSTXSPLSPIAVRRKCCISDLHVCGTPPP-  192

Query  199  EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
            E QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L++ W
Sbjct  193  ENQDLIMWSQLTDAARAALN----DQDNFGRT--EVPISDDHFPKHLEEAW  237

>PPTG_03796
Length=255

 Score = 168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 136/249 (55%), Gaps = 34/249 (14%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQL---KIDAGCHPYPAVQKDGSMSGGLKWSGPQ  78
            + HD+V PFPQPDP T+S+K A+KFKPQL   K++  C  +PAV   G ++GGLK +   
Sbjct  22   VDHDKVEPFPQPDPATISEKAAIKFKPQLYSAKLEY-CVSFPAVNAVGEVTGGLKGTNGN  80

Query  79   DGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVW  138
            D  C  + LGSQIY R+ W ND WAIMYAWYFPKG    +P         RH+W+ VVVW
Sbjct  81   DA-CRLAPLGSQIYGRAGWHNDRWAIMYAWYFPKGFYMGLP-------TRRHDWKSVVVW  132

Query  139  IDNPGLENATVLGVSMSAS---------------IGYSKQAPT-DVKYVDGTSVKVAYYY  182
            IDN  LE   +LGVS S S                GY  Q P      V G++  + +  
Sbjct  133  IDNAELETPKILGVSTSVSDTRYKRDLVIFPRNFAGYQLQGPRFHHTEVFGSNTSLRFKI  192

Query  183  NHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
               L    +   +  GE+QDLI W+QL+  AR +LN    D   FG A  ++P  D  ++
Sbjct  193  WPTLFVPYMGFADFDGEYQDLIMWEQLTDAARAALN----DDNNFGRA--EVPFSDTHYK  246

Query  243  ELLDKTWPF  251
            E L+  WPF
Sbjct  247  EHLENAWPF  255

>PHYCA_109089
Length=277

 Score = 168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 136/272 (50%), Gaps = 60/272 (22%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+K AVKFKPQ+ I  GC P+PAV   G +SGGL  +   DG 
Sbjct  24   INHDQVQPFAQPEPVTISEKAAVKFKPQIHITDGCVPFPAVNAAGEVSGGLNPTKYTDG-  82

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVWID  140
            CT S +GSQ+Y R++W  D WAIMYAWYFPK        +F  FF   RH W  +V+W+D
Sbjct  83   CTESPMGSQVYGRASWYRDHWAIMYAWYFPK--------NFRAFFARGRHGWANMVLWLD  134

Query  141  NPGLENATVLGVSMSASIGYSKQ---APTDVK----------------------------  169
            NP LEN  +LG S+S     +++    P D +                            
Sbjct  135  NPALENQKLLGASLSQQTLKAEKILFIPLDEREKEPYQKFNGIPPMGFVGMQEIRHTQLS  194

Query  170  -------YVDGTSVKVAYYYNHLLGN---TALQLTEDTGEFQDLIQWDQLSSLARYSLNH  219
                   Y  G++V       H++       L      GE+QDLI W+QL+  AR  LN 
Sbjct  195  RWSWNYTYEGGSNVSTRVI--HMMDKFDWIHLSFLGRDGEYQDLIMWEQLTDEARAGLNS  252

Query  220  TDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             D+  T         P  D  F+  L+K WPF
Sbjct  253  ADFGDTF-------APFTDDNFKTALEKAWPF  277

>PHYCA_109192
Length=278

 Score = 168 bits (425),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 135/275 (49%), Gaps = 63/275 (23%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QPDPVTVS+K AVK+KPQL I +GC  +PAV   G ++GGLK +   DG 
Sbjct  22   IDHDKVQPFKQPDPVTVSEKAAVKYKPQLVIGSGCVSFPAVNAAGDITGGLKGTKSTDG-  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG----HRHNWEYVVV  137
            CT + LGSQ+Y RS W  D WA+M+AWYFPK            F+G     RH W  +VV
Sbjct  81   CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPK-----------NFWGGEGESRHLWSNMVV  129

Query  138  WIDNPGLENATVLGVSMS------------------ASIGYSKQAPTDVKYVDGTSV---  176
            WIDNP LE   +LG S+S                    + Y K    D  +  G      
Sbjct  130  WIDNPALETPKILGASLSRQTLDPPKALFLFSLADRQKVPYKKVTGIDPMHFVGMQAIQT  189

Query  177  ----KVAYYYNHLLGNT----------------ALQLTEDTGEFQDLIQWDQLSSLARYS  216
                +  Y YN+  G+                  L+     GE+QDLI W+QL+  AR +
Sbjct  190  GRIGRYRYTYNYTGGSNTSTRVYHGFPDSSAWIGLEFVNVNGEYQDLIMWNQLTDQARAT  249

Query  217  LNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            L   D+ +        K+P  D  FE  L + WPF
Sbjct  250  LESADFGEK------TKVPFNDKNFEAALAQAWPF  278

>PHALS_14423
Length=379

 Score = 170 bits (431),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 135/236 (57%), Gaps = 19/236 (8%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            +  ++V+PF Q  P T SQK+A+K++P+L +   C+PYPAVQ DGS+S GL W       
Sbjct  157  VNVNEVQPFKQRKPTTDSQKSAIKYQPRLYVLGACYPYPAVQADGSLSEGLPWKIFFQSR  216

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C GS  GSQIY+RS W    WAIMYAWY P+     +  +     GH H W +VVVW D+
Sbjct  217  CNGSPRGSQIYSRSDWYRGKWAIMYAWYLPRA----LDQNIWDVDGHSHFWTFVVVWTDS  272

Query  142  PGLENATVLGVSMSASIG--YSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTG  198
            P  + +T+L  S S  +G    K +P   KY ++  S+KV  + NH    T L+LTE  G
Sbjct  273  PDPDVSTILAASTSG-VGNRIKKYSPLKSKYLLNHKSLKVKLHENHFWDKTGLKLTEKVG  331

Query  199  EFQDLIQWDQLSSLARYSL---NHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            E Q LI W+QL+  AR +L   +++DW         ++ P++D  F  +L   +PF
Sbjct  332  ELQTLITWEQLTDEARAALSSVHYSDWR--------MESPIQDKWFRPMLSSAYPF  379

>PHYCA_109174
Length=277

 Score = 167 bits (424),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/274 (38%), Positives = 141/274 (51%), Gaps = 62/274 (23%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            IGHD+V+PF QPDPVTVS+K AVK+KPQL+I   C  +PAV   G ++GGLK +   DG 
Sbjct  22   IGHDKVQPFAQPDPVTVSEKAAVKYKPQLQISDSCVSFPAVNAAGEITGGLKGTKGTDG-  80

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG----HRHNWEYVVV  137
            CT + LGSQ+Y RS W  D WA+M+AWYFPK            F+G     RH W  +V+
Sbjct  81   CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPK-----------NFWGGGAKSRHLWANMVL  129

Query  138  WIDNPGLENATVLGVSMSA-----------SIGYSKQAPTD-------VKYVDGTSVKVA  179
            WIDNP LE   +LG S+S            S+G  ++ P         + +V   +++ +
Sbjct  130  WIDNPALETPKILGASLSRQTLEVPKAVFLSMGEQQKDPYSKVTAIPPMGFVGMQAIQTS  189

Query  180  ------YYYNHLLGN----------------TALQLTEDTGEFQDLIQWDQLSSLARYSL  217
                  Y YN+  G+                 +L      GE+QDLI W+QL+  AR +L
Sbjct  190  RISRFRYTYNYTGGSDISTRVSQGYPDNSAWISLTFAGTDGEYQDLIMWNQLTDQARAAL  249

Query  218  NHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               D+ +        K+P  D  FE  L + WPF
Sbjct  250  ESADFGED------TKVPFNDKNFEAALAQAWPF  277

>PPTG_10591
Length=254

 Score = 166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 132/247 (53%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
            I HD+V+ FPQP+PVT S+KTA+KFKP+L      C PYPAV   G +SGGLK +   D 
Sbjct  22   IDHDKVQAFPQPEPVTASEKTAIKFKPRLYTPRHVCVPYPAVNAAGEVSGGLKGTNGNDA  81

Query  81   ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C  S  GSQ+Y R+ W  D+WAIMY WYFPKG        F  F   RH+W+ VVVWI+
Sbjct  82   -CKYSIQGSQVYGRAGWYRDLWAIMYTWYFPKGF-------FADFASKRHDWQNVVVWIN  133

Query  141  NPGLENATVLGVSMSAS---------------IGYSKQAPTDVKY-VDGTSVKVAYYYNH  184
            NP LE   ++GVSMS                  GY  +     +  + G++  + + Y  
Sbjct  134  NPDLEWPKIVGVSMSNVDSEYTTKLEMMAYYFSGYRMEGTRGYRRSIYGSATSLRFAYEM  193

Query  185  LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
            +L +  L   ++ GE+Q LI W+QL+  AR +LN +            ++P  D  + + 
Sbjct  194  ILTSPYLDFADEDGEYQSLIMWEQLTDAARAALNDSS------NFEEREIPFSDEHYMDH  247

Query  245  LDKTWPF  251
            L+  WP 
Sbjct  248  LEMAWPL  254

>PPTG_15262
Length=233

 Score = 165 bits (418),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 125/226 (55%), Gaps = 15/226 (7%)

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + +D + PF QP PVT+++K AV+FKPQ+  + GC+PYP V  DG+    L  SGP    
Sbjct  20   VRYDDIVPFAQPVPVTITEKRAVEFKPQVHTNGGCYPYPVVDTDGNTGDCLASSGPDSKS  79

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C G  +GSQ+Y R+    D WAIMYAWY PK                RH W   +VW+D+
Sbjct  80   CNGPSVGSQVYGRAKRFTDKWAIMYAWYLPKISNG-------WGIESRHLWLETIVWLDS  132

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              LE+ T+L V+      Y K  P+    ++GTSVK+    N L     L +T   GE Q
Sbjct  133  FVLESPTILAVTTWHQGKYQKYLPSLADTLNGTSVKLD-CTNTLEYGYMLDVTNRIGETQ  191

Query  202  DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
            DLI W+QL+  AR +L  TD++       GL  P+ DG FEELL+K
Sbjct  192  DLIMWNQLTDAARSALQWTDFN-------GLSAPISDGRFEELLEK  230

Lambda      K        H        a         alpha
   0.321    0.138    0.454    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13825374792

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40