Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_811001475634934917720.0
PHYSO_4715231475634834915940.0
PPTG_171271475635135115330.0
PITG_184561475635135115250.0
PHYCA_5561621475635135115150.0
PHALS_064781475634534914050.0
PHYKE_83931475632635112881e-178
PYU1_G001735147563423529383e-125
PYIR_13451147563593649272e-123
PYAP_17762147563483578942e-118
PYIW_19971147563483628308e-109
PYVX_18171147562943388074e-106
PYAR_13570147563223257504e-97
CCA18899147563433356561e-82
CCI45123147563013045033e-60
SPRG_06336147563353345054e-60
SDRG_01781147563353344891e-57
H257_06294147563583554412e-50
H310_09223147563333404183e-47
CCI451271609872021972635e-26
PYAR_23286161286071231501e-09
HYAP_086451612815141161458e-09
PHYRA_849161612815411151431e-08
PYU1_G0063471612810951151422e-08
PHYSO_3617471612815231161412e-08
PYIW_17381161289521291369e-08
PPTG_188981612815591071361e-07
PITG_205621612815591071351e-07
PYIR_215891612815681211323e-07
PHYKE_19901612814991151323e-07
PYVX_204381612813461341314e-07
SDRG_1276312510913171111306e-07
SPRG_0605912510913121081271e-06
PYAP_169971612810181181261e-06
CCI447521612815261191261e-06
H310_002311612814951221262e-06
H257_067221612814821181252e-06
SPRG_060581612812581301243e-06
PHYKE_247914459171531173e-06
CCA188751612815141421234e-06
PYU1_G00106314459783351225e-06
PYIR_17453951126191271216e-06
PYIR_1530914459937361216e-06
PYIW_1317214459939351216e-06
PYAP_1729014459835361217e-06
PYIW_21108951125931301209e-06
PYAR_1991414459788351172e-05
CCI4122514459981351172e-05
PYVX_1357414459950351172e-05
H257_067211251091238401162e-05
H310_0023012510912481221163e-05
PHALS_0653314459930561153e-05
PHYCA_503112152926214341105e-05
CCA1648714459975351145e-05
PITG_1806714459924541135e-05
PPTG_1340114459927541135e-05
PHYRA_7783414459936351135e-05
CCI42457152926906351127e-05
CCA17102152926884351127e-05
PYIR_183821526711541241083e-04
PHYSO_5445981526711631101074e-04
PYU1_G008848152677651271064e-04
PHYRA_825431526711991471064e-04
PPTG_193711526711951331064e-04
SDRG_12762161281392381064e-04
CCA180231526711381101056e-04
PYAR_154631526710911101056e-04
CCI10489158709777511046e-04
PYAP_186361526710091491047e-04
PYIW_16987152678211101047e-04
CCI462351526711551101047e-04
H257_03361123428699601048e-04
PITG_192131526712011101030.001
PYVX_133121526710161581030.001
PITG_113039318293341000.001
SDRG_01407152678151191020.001
SPRG_0544914459723801000.002
SPRG_00890152678831101000.002
H257_03093152679751101000.002
PHYSO_3436291445997730990.003
H310_063781445983735990.003
H257_135671445983635980.003
SDRG_088001445988135980.003
H310_0484315267968110970.005
PITG_1789314313747119970.005
PHYSO_55616414313765132970.005
PHYKE_666215267765110960.006
PHALS_04098152671183141970.006
CCA21715241778251960.006
CCA2186015507878251960.006
PYVX_18338241774644960.006
PPTG_0455314313904119960.006
CCI3936728852046119970.006
PHYSO_344112241781337960.006
PHYCA_506137241781037960.007
PYIW_18480241775537960.007
PPTG_05519241781037960.007
PHYRA_79281241780937960.007
PITG_02762241781037960.007
HYAP_08026241779837960.007
SDRG_055678195980145960.007
PYAP_22646241781537950.008
PHYKE_5678241780937940.010
PYIW_1987356695185123910.011
SPRG_060218195983113940.013
PYU1_G004386241783742930.014
PHYRA_7353514313875118930.014
H257_0902812554556119930.014
H257_039319639695118930.014
PHALS_0669914313884134930.015
PHALS_03645241783042930.015
PPTG_14630185339856920.016
SPRG_1702213189210739860.016
PPTG_1604428851378112930.016
PHYRA_7353469686121039930.017
PITG_02109185352256920.018
PITG_0331828851343112920.019
SPRG_143129639661119920.019
PYIR_13120241781437920.020
PYAR_19883241783337920.022
H310_070709639680118920.022
PHALS_0558728851361112920.022
SPRG_092111255454990910.022
SDRG_147711255454990910.023
SPRG_0912814313620130910.023
H257_098231431365452910.024
PYU1_G0092499511258057920.024
PYIR_1316828851353112910.025
PYIW_20891185329156890.028
SPRG_0275212342883157910.029
SDRG_1448712342896459910.030
SPRG_1631213132226160890.031
PHALS_035401690479900.032
HYAP_04457152671203133900.033
SDRG_05150241778739900.035
H310_1244812554555127900.037
PHYCA_504801185339856890.038
SPRG_08346241779739900.039
PYVX_2334914313924113890.042
CCI43793134791117180890.043
PYU1_G01081856695169112850.049
PHYKE_491118534632780.049
PITG_0210618501015143890.052
PYU1_G0032291681045890.052
H257_051751643067865880.057
PYIW_1961312330131471890.057
H310_01921185334173870.057
PYAR_2606510677931460870.057
HYAP_0930413479114432880.058
PYAP_1673481951314113880.059
PPTG_1462618501055116880.062
CCA2689061471530112880.066
H310_144737490613137870.067
HYAP_061012885984112870.075
H257_02642640397551870.077
PITG_20103158351301126870.077
CCA1551328851341112870.077
HYAP_0640312330103766870.079
H310_046671643068065870.079
SDRG_142861431367030870.081
SDRG_0008012454429873850.090
SPRG_1190016605110860.094
PHYRA_9440928851270162870.095
PYU1_G012870185335256850.098
PYVX_14593185096450860.098
PHYSO_478611185352256860.10
PYVX_2343212330151060860.10
PPTG_2100071911012112860.12
SDRG_0560811092121127800.12
H310_06666863288744860.12
SDRG_062881664157850.12
PPTG_1898913479121332860.13
H257_03363185331673840.14
H310_07701241781137850.14
H257_07514241781037850.14
PYAP_13695185334856840.15
H310_136271431367876850.15
PYIR_2458885060909109850.15
PYIR_2337215835141584850.15
PYAR_192918506071158850.15
PHYRA_8194413479114932850.16
CCI40991241780127850.16
PYIW_1757181951330113850.16
PYU1_G0128591850118356850.16
PHALS_0793013479120032850.17
PYVX_145276030126956850.17
PYU1_G0122741583587384840.17
PHYSO_3501971255455797840.17
SPRG_02753185330957830.17
PYU1_G0095089576532832830.18
H310_0666713886889644840.18
H257_117868618572134840.19
PYIR_1511813479122232840.19
SDRG_14486185330857830.19
H310_0091295112182124840.20
PHALS_06336185251156830.20
SDRG_07086128106656123840.20
CCI47145185339056830.21
PHYSO_48987281951240126840.22
PYIW_1891113479119632840.22
PHALS_06568185338856830.22
PHYRA_73430185339556830.23
PHYSO_24848128851283112830.24
CCA24531185337456820.24
SPRG_0250211092121125780.25
PYAR_157921109212139780.25
CCI1092861471530200830.25
H257_01308863289744830.26
CCI434561109212639780.27
PYAP_161619866188939830.27
PHYKE_4910185237547820.29
PITG_0993081951221131830.30
PYAR_134918195108030820.31
PYU1_G0074238506092849820.32
PYIW_2194428851317108820.32
PYIW_2190185060913115820.33
SDRG_08383123078132159820.33
CCA2425210538323158810.33
PPTG_06823158351321126820.33
PYAR_1869095112455132820.34
PYU1_G0007249278718934790.36
PYIR_144941681952820.37
PYAP_2268528851104159810.40
SPRG_02010123078132659810.40
SDRG_0215412656882257810.41
PHYCA_5093851255455797810.41
SDRG_152623199582122810.42
SDRG_048711643068755810.42
SPRG_082171643068755810.44
H257_06469219447630730.44
H310_09363140947195479810.44
PHYRA_837687189273531810.45
PYAP_2347885060897109810.45
CCA27255157810112537810.47
PYAP_22195863290144810.50
PYVX_1308413479126771810.51
SPRG_0293995112161131810.53
CCA2551013479113933800.53
PYAR_14615863251744800.53
SPRG_00889122518994110800.54
PHYRA_770336023137231800.54
SPRG_14955749063554800.54
PHYSO_34998318501320113800.55
PHALS_080978195106932800.58
PHYRA_7343218501313124800.58
CCA191181109212529750.59
HYAP_137571151726231780.59
SPRG_0491212454426160780.60
CCA190339511188334800.61
SDRG_14070749063031800.62
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_81100

Length=350
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_81100                                                           687        0.0   
PHYSO_471523                                                          618        0.0   
PPTG_17127                                                            595        0.0   
PITG_18456                                                            592        0.0   
PHYCA_556162                                                          588        0.0   
PHALS_06478                                                           545        0.0   
PHYKE_8393                                                            500        1e-178
PYU1_G001735                                                          365        3e-125
PYIR_13451                                                            361        2e-123
PYAP_17762                                                            348        2e-118
PYIW_19971                                                            324        8e-109
PYVX_18171                                                            315        4e-106
PYAR_13570                                                            293        4e-97 
CCA18899                                                              257        1e-82 
CCI45123                                                              198        3e-60 
SPRG_06336                                                            199        4e-60 
SDRG_01781                                                            192        1e-57 
H257_06294                                                            174        2e-50 
H310_09223                                                            165        3e-47 
CCI45127                                                              105        5e-26 
PYAR_23286                                                            62.4       1e-09 
HYAP_08645                                                            60.5       8e-09 
PHYRA_84916                                                           59.7       1e-08 
PYU1_G006347                                                          59.3       2e-08 
PHYSO_361747                                                          58.9       2e-08 
PYIW_17381                                                            57.0       9e-08 
PPTG_18898                                                            57.0       1e-07 
PITG_20562                                                            56.6       1e-07 
PYIR_21589                                                            55.5       3e-07 
PHYKE_1990                                                            55.5       3e-07 
PYVX_20438                                                            55.1       4e-07 
SDRG_12763                                                            54.7       6e-07 
SPRG_06059                                                            53.5       1e-06 
PYAP_16997                                                            53.1       1e-06 
CCI44752                                                              53.1       1e-06 
H310_00231                                                            53.1       2e-06 
H257_06722                                                            52.8       2e-06 
SPRG_06058                                                            52.4       3e-06 
PHYKE_2479                                                            49.7       3e-06 
CCA18875                                                              52.0       4e-06 
PYU1_G001063                                                          51.6       5e-06 
PYIR_17453                                                            51.2       6e-06 
PYIR_15309                                                            51.2       6e-06 
PYIW_13172                                                            51.2       6e-06 
PYAP_17290                                                            51.2       7e-06 
PYIW_21108                                                            50.8       9e-06 
PYAR_19914                                                            49.7       2e-05 
CCI41225                                                              49.7       2e-05 
PYVX_13574                                                            49.7       2e-05 
H257_06721                                                            49.3       2e-05 
H310_00230                                                            49.3       3e-05 
PHALS_06533                                                           48.9       3e-05 
PHYCA_503112                                                          47.0       5e-05 
CCA16487                                                              48.5       5e-05 
PITG_18067                                                            48.1       5e-05 
PPTG_13401                                                            48.1       5e-05 
PHYRA_77834                                                           48.1       5e-05 
CCI42457                                                              47.8       7e-05 
CCA17102                                                              47.8       7e-05 
PYIR_18382                                                            46.2       3e-04 
PHYSO_544598                                                          45.8       4e-04 
PYU1_G008848                                                          45.4       4e-04 
PHYRA_82543                                                           45.4       4e-04 
PPTG_19371                                                            45.4       4e-04 
SDRG_12762                                                            45.4       4e-04 
CCA18023                                                              45.1       6e-04 
PYAR_15463                                                            45.1       6e-04 
CCI10489                                                              44.7       6e-04 
PYAP_18636                                                            44.7       7e-04 
PYIW_16987                                                            44.7       7e-04 
CCI46235                                                              44.7       7e-04 
H257_03361                                                            44.7       8e-04 
PITG_19213                                                            44.3       0.001 
PYVX_13312                                                            44.3       0.001 
PITG_11303                                                            43.1       0.001 
SDRG_01407                                                            43.9       0.001 
SPRG_05449                                                            43.1       0.002 
SPRG_00890                                                            43.1       0.002 
H257_03093                                                            43.1       0.002 
PHYSO_343629                                                          42.7       0.003 
H310_06378                                                            42.7       0.003 
H257_13567                                                            42.4       0.003 
SDRG_08800                                                            42.4       0.003 
H310_04843                                                            42.0       0.005 
PITG_17893                                                            42.0       0.005 
PHYSO_556164                                                          42.0       0.005 
PHYKE_6662                                                            41.6       0.006 
PHALS_04098                                                           42.0       0.006 
CCA21715                                                              41.6       0.006 
CCA21860                                                              41.6       0.006 
PYVX_18338                                                            41.6       0.006 
PPTG_04553                                                            41.6       0.006 
CCI39367                                                              42.0       0.006 
PHYSO_344112                                                          41.6       0.006 
PHYCA_506137                                                          41.6       0.007 
PYIW_18480                                                            41.6       0.007 
PPTG_05519                                                            41.6       0.007 
PHYRA_79281                                                           41.6       0.007 
PITG_02762                                                            41.6       0.007 
HYAP_08026                                                            41.6       0.007 
SDRG_05567                                                            41.6       0.007 
PYAP_22646                                                            41.2       0.008 
PHYKE_5678                                                            40.8       0.010 
PYIW_19873                                                            39.7       0.011 
SPRG_06021                                                            40.8       0.013 
PYU1_G004386                                                          40.4       0.014 
PHYRA_73535                                                           40.4       0.014 
H257_09028                                                            40.4       0.014 
H257_03931                                                            40.4       0.014 
PHALS_06699                                                           40.4       0.015 
PHALS_03645                                                           40.4       0.015 
PPTG_14630                                                            40.0       0.016 
SPRG_17022                                                            37.7       0.016 
PPTG_16044                                                            40.4       0.016 
PHYRA_73534                                                           40.4       0.017 
PITG_02109                                                            40.0       0.018 
PITG_03318                                                            40.0       0.019 
SPRG_14312                                                            40.0       0.019 
PYIR_13120                                                            40.0       0.020 
PYAR_19883                                                            40.0       0.022 
H310_07070                                                            40.0       0.022 
PHALS_05587                                                           40.0       0.022 
SPRG_09211                                                            39.7       0.022 
SDRG_14771                                                            39.7       0.023 
SPRG_09128                                                            39.7       0.023 
H257_09823                                                            39.7       0.024 
PYU1_G009249                                                          40.0       0.024 
PYIR_13168                                                            39.7       0.025 
PYIW_20891                                                            38.9       0.028 
SPRG_02752                                                            39.7       0.029 
SDRG_14487                                                            39.7       0.030 
SPRG_16312                                                            38.9       0.031 
PHALS_03540                                                           39.3       0.032 
HYAP_04457                                                            39.3       0.033 
SDRG_05150                                                            39.3       0.035 
H310_12448                                                            39.3       0.037 
PHYCA_504801                                                          38.9       0.038 
SPRG_08346                                                            39.3       0.039 
PYVX_23349                                                            38.9       0.042 
CCI43793                                                              38.9       0.043 
PYU1_G010818                                                          37.4       0.049 
PHYKE_4911                                                            34.7       0.049 
PITG_02106                                                            38.9       0.052 
PYU1_G003229                                                          38.9       0.052 
H257_05175                                                            38.5       0.057 
PYIW_19613                                                            38.9       0.057 
H310_01921                                                            38.1       0.057 
PYAR_26065                                                            38.1       0.057 
HYAP_09304                                                            38.5       0.058 
PYAP_16734                                                            38.5       0.059 
PPTG_14626                                                            38.5       0.062 
CCA26890                                                              38.5       0.066 
H310_14473                                                            38.1       0.067 
HYAP_06101                                                            38.1       0.075 
H257_02642                                                            38.1       0.077 
PITG_20103                                                            38.1       0.077 
CCA15513                                                              38.1       0.077 
HYAP_06403                                                            38.1       0.079 
H310_04667                                                            38.1       0.079 
SDRG_14286                                                            38.1       0.081 
SDRG_00080                                                            37.4       0.090 
SPRG_11900                                                            37.7       0.094 
PHYRA_94409                                                           38.1       0.095 
PYU1_G012870                                                          37.4       0.098 
PYVX_14593                                                            37.7       0.098 
PHYSO_478611                                                          37.7       0.10  
PYVX_23432                                                            37.7       0.10  
PPTG_21000                                                            37.7       0.12  
SDRG_05608                                                            35.4       0.12  
H310_06666                                                            37.7       0.12  
SDRG_06288                                                            37.4       0.12  
PPTG_18989                                                            37.7       0.13  
H257_03363                                                            37.0       0.14  
H310_07701                                                            37.4       0.14  
H257_07514                                                            37.4       0.14  
PYAP_13695                                                            37.0       0.15  
H310_13627                                                            37.4       0.15  
PYIR_24588                                                            37.4       0.15  
PYIR_23372                                                            37.4       0.15  
PYAR_19291                                                            37.4       0.15  
PHYRA_81944                                                           37.4       0.16  
CCI40991                                                              37.4       0.16  
PYIW_17571                                                            37.4       0.16  
PYU1_G012859                                                          37.4       0.16  
PHALS_07930                                                           37.4       0.17  
PYVX_14527                                                            37.4       0.17  
PYU1_G012274                                                          37.0       0.17  
PHYSO_350197                                                          37.0       0.17  
SPRG_02753                                                            36.6       0.17  
PYU1_G009508                                                          36.6       0.18  
H310_06667                                                            37.0       0.18  
H257_11786                                                            37.0       0.19  
PYIR_15118                                                            37.0       0.19  
SDRG_14486                                                            36.6       0.19  
H310_00912                                                            37.0       0.20  
PHALS_06336                                                           36.6       0.20  
SDRG_07086                                                            37.0       0.20  
CCI47145                                                              36.6       0.21  
PHYSO_489872                                                          37.0       0.22  
PYIW_18911                                                            37.0       0.22  
PHALS_06568                                                           36.6       0.22  
PHYRA_73430                                                           36.6       0.23  
PHYSO_248481                                                          36.6       0.24  
CCA24531                                                              36.2       0.24  
SPRG_02502                                                            34.7       0.25  
PYAR_15792                                                            34.7       0.25  
CCI10928                                                              36.6       0.25  
H257_01308                                                            36.6       0.26  
CCI43456                                                              34.7       0.27  
PYAP_16161                                                            36.6       0.27  
PHYKE_4910                                                            36.2       0.29  
PITG_09930                                                            36.6       0.30  
PYAR_13491                                                            36.2       0.31  
PYU1_G007423                                                          36.2       0.32  
PYIW_21944                                                            36.2       0.32  
PYIW_21901                                                            36.2       0.33  
SDRG_08383                                                            36.2       0.33  
CCA24252                                                              35.8       0.33  
PPTG_06823                                                            36.2       0.33  
PYAR_18690                                                            36.2       0.34  
PYU1_G000724                                                          35.0       0.36  
PYIR_14494                                                            36.2       0.37  
PYAP_22685                                                            35.8       0.40  
SPRG_02010                                                            35.8       0.40  
SDRG_02154                                                            35.8       0.41  
PHYCA_509385                                                          35.8       0.41  
SDRG_15262                                                            35.8       0.42  
SDRG_04871                                                            35.8       0.42  
SPRG_08217                                                            35.8       0.44  
H257_06469                                                            32.7       0.44  
H310_09363                                                            35.8       0.44  
PHYRA_83768                                                           35.8       0.45  
PYAP_23478                                                            35.8       0.45  
CCA27255                                                              35.8       0.47  
PYAP_22195                                                            35.8       0.50  
PYVX_13084                                                            35.8       0.51  
SPRG_02939                                                            35.8       0.53  
CCA25510                                                              35.4       0.53  
PYAR_14615                                                            35.4       0.53  
SPRG_00889                                                            35.4       0.54  
PHYRA_77033                                                           35.4       0.54  
SPRG_14955                                                            35.4       0.54  
PHYSO_349983                                                          35.4       0.55  
PHALS_08097                                                           35.4       0.58  
PHYRA_73432                                                           35.4       0.58  
CCA19118                                                              33.5       0.59  
HYAP_13757                                                            34.7       0.59  
SPRG_04912                                                            34.7       0.60  
CCA19033                                                              35.4       0.61  
SDRG_14070                                                            35.4       0.62  
PPTG_04299                                                            35.4       0.63  
PYAP_14828                                                            35.0       0.63  
SDRG_08236                                                            35.4       0.64  
PHYKE_9146                                                            35.0       0.65  
PHYKE_1044                                                            35.0       0.66  
PHALS_06334                                                           35.4       0.66  
PITG_07134                                                            35.4       0.66  
SDRG_02135                                                            34.7       0.66  
PYAP_23744                                                            33.5       0.67  
PYU1_G008119                                                          33.5       0.68  
PHYKE_7856                                                            34.7       0.69  
PHYCA_556081                                                          35.4       0.70  
PPTG_11714                                                            35.4       0.70  
PYIW_18491                                                            35.0       0.71  
PYIW_17818                                                            35.0       0.75  
SPRG_06629                                                            35.0       0.75  
PHALS_02608                                                           35.0       0.76  
SDRG_01408                                                            35.0       0.78  
HYAP_11712                                                            35.0       0.80  
H257_03095                                                            35.0       0.83  
PYIR_15407                                                            33.1       0.83  
CCI42088                                                              35.0       0.84  
SPRG_15871                                                            32.7       0.84  
PYAR_25500                                                            34.7       0.84  
PYIR_13555                                                            34.7       0.85  
PYIW_26522                                                            33.1       0.85  
PHYRA_78815                                                           34.7       0.88  
HYAP_11713                                                            34.7       0.90  
PYAP_24144                                                            34.7       0.91  
SPRG_01860                                                            34.7       0.93  
HYAP_13105                                                            34.7       0.96  
SPRG_08834                                                            34.7       0.97  
PHYSO_558498                                                          34.7       0.99  
PHALS_09729                                                           34.7       1.0   
PYAP_18434                                                            34.7       1.1   
H257_09270                                                            34.7       1.1   
SDRG_17208                                                            34.7       1.1   
PHALS_12503                                                           34.3       1.1   
H310_01510                                                            34.7       1.1   
H257_13346                                                            34.3       1.1   
PHYSO_315255                                                          34.7       1.2   
PHYCA_564296                                                          34.3       1.2   
SPRG_09805                                                            34.3       1.2   
PHYRA_76931                                                           34.3       1.2   
PPTG_19153                                                            34.3       1.2   
PYIR_21473                                                            34.3       1.3   
PYIR_16539                                                            34.3       1.3   
PITG_08640                                                            34.3       1.3   
PPTG_08785                                                            34.3       1.3   
PITG_10462                                                            34.3       1.3   
H257_08182                                                            34.3       1.4   
PYU1_G007013                                                          34.3       1.4   
PHYRA_82040                                                           34.3       1.4   
PYVX_14287                                                            34.3       1.4   
H310_02133                                                            34.3       1.4   
H310_05692                                                            34.3       1.4   
HYAP_02230                                                            34.3       1.4   
PHYCA_504712                                                          33.5       1.4   
SDRG_12776                                                            34.3       1.4   
SDRG_06927                                                            34.3       1.5   
H310_14019                                                            33.9       1.5   
PHALS_09273                                                           33.9       1.6   
SPRG_00364                                                            33.5       1.6   
PHYRA_72718                                                           33.9       1.6   
PYU1_G002632                                                          33.9       1.6   
HYAP_08248                                                            33.9       1.7   
PYVX_22589                                                            33.9       1.7   
PYU1_G006732                                                          33.9       1.7   
SPRG_11537                                                            33.9       1.7   
H310_02582                                                            33.9       1.7   
HYAP_11295                                                            33.9       1.9   
CCI49856                                                              33.9       1.9   
H257_00729                                                            32.0       2.0   
PYVX_16714                                                            33.9       2.0   
HYAP_13688                                                            33.9       2.0   
PYIR_18236                                                            33.5       2.0   
PHYRA_83071                                                           33.9       2.1   
PYIW_14463                                                            33.1       2.1   
SPRG_06273                                                            33.5       2.1   
SDRG_01838                                                            33.5       2.2   
PYIR_22667                                                            33.5       2.2   
CCA22367                                                              33.5       2.3   
PITG_16799                                                            33.5       2.3   
H310_01094                                                            32.0       2.3   
PHYRA_79348                                                           33.5       2.4   
PHYCA_505441                                                          33.5       2.4   
PHYSO_485120                                                          32.0       2.4   
PHYSO_484541                                                          33.5       2.4   
PPTG_07800                                                            32.3       2.4   
SDRG_03531                                                            32.7       2.4   
PYIR_22246                                                            33.5       2.4   
PYVX_19982                                                            33.5       2.4   
H310_00209                                                            33.5       2.4   
HYAP_13267                                                            33.5       2.5   
PHYKE_7347                                                            31.6       2.5   
H257_00263                                                            33.5       2.5   
H257_01309                                                            33.5       2.6   
PYAP_16658                                                            32.7       2.6   
PYAR_16674                                                            33.1       2.6   
PHYSO_506918                                                          33.1       2.6   
H257_06698                                                            33.5       2.7   
PYIW_15014                                                            33.1       2.8   
PYVX_15906                                                            31.6       2.8   
PHYSO_289146                                                          31.6       2.8   
PHALS_07062                                                           31.6       2.8   
PHYCA_510506                                                          31.6       2.9   
PYVX_22150                                                            32.7       2.9   
H257_09269                                                            33.1       2.9   
PITG_13665                                                            31.6       2.9   
PPTG_19631                                                            31.6       3.0   
PYAR_16120                                                            33.1       3.1   
PYIR_21831                                                            32.0       3.1   
PYVX_16095                                                            33.1       3.2   
H257_10151                                                            33.1       3.2   
SPRG_11536                                                            33.1       3.2   
CCI45895                                                              33.1       3.2   
PYAR_24323                                                            33.1       3.3   
PITG_17594                                                            33.1       3.3   
PHYSO_326768                                                          33.1       3.3   
PYVX_24789                                                            32.3       3.3   
HYAP_07348                                                            33.1       3.4   
SDRG_07085                                                            33.1       3.4   
H310_13911                                                            32.7       3.4   
H257_10847                                                            32.7       3.5   
PITG_07113                                                            32.3       3.5   
HYAP_02360                                                            31.2       3.5   
PITG_00020                                                            32.7       3.5   
H257_11802                                                            32.7       3.6   
PHALS_01010                                                           32.7       3.7   
PHYRA_85100                                                           31.2       3.7   
PHYRA_85097                                                           31.2       3.7   
H310_05691                                                            32.7       3.8   
H310_04842                                                            32.7       3.9   
PYAP_17850                                                            32.7       3.9   
PYIR_23012                                                            32.7       4.2   
H310_05457                                                            32.3       4.2   
PYAR_21162                                                            32.7       4.5   
PHYKE_5588                                                            32.3       4.5   
PHYKE_4241                                                            32.3       4.8   
PPTG_16659                                                            32.3       4.8   
PPTG_13492                                                            32.3       4.8   
H257_05679                                                            32.3       4.9   
H310_02933                                                            32.3       4.9   
PITG_15553                                                            32.3       5.0   
CCA16150                                                              32.0       5.2   
CCA19097                                                              32.3       5.2   
H257_10063                                                            32.3       5.3   
SPRG_01654                                                            32.3       5.3   
PPTG_10755                                                            32.3       5.3   
PHYCA_506274                                                          32.3       5.4   
PITG_00416                                                            32.3       5.5   
PITG_03652                                                            32.3       5.6   
PHYCA_539981                                                          32.3       5.6   
SDRG_03175                                                            32.3       5.6   
PYIW_23724                                                            32.3       5.7   
CCI44941                                                              32.0       5.7   
PHYSO_304784                                                          32.3       5.8   
SPRG_03722                                                            32.3       5.8   
PHYRA_84786                                                           32.3       5.8   
SDRG_15601                                                            32.0       5.8   
PHYCA_71329                                                           29.6       5.9   
PYAR_23366                                                            32.3       6.0   
PYIW_20221                                                            32.0       6.0   
PITG_11578                                                            32.3       6.0   
HYAP_01622                                                            32.0       6.1   
PYAP_17800                                                            32.0       6.1   
PPTG_16174                                                            32.0       6.2   
PHYRA_84567                                                           32.0       6.2   
SPRG_20275                                                            32.0       6.2   
PYAR_16228                                                            32.0       6.3   
PITG_21026                                                            32.0       6.4   
PHALS_05825                                                           31.6       6.5   
PHALS_03335                                                           32.0       6.5   
PHYCA_98948                                                           30.4       6.6   
PHYSO_552247                                                          32.0       6.6   
PITG_18687                                                            32.0       6.7   
PYVX_20375                                                            32.0       6.9   
PHALS_02739                                                           32.0       7.0   
PYIW_21526                                                            32.0       7.2   
SPRG_06061                                                            32.0       7.2   
PYU1_G000461                                                          31.6       7.4   
PYIW_15554                                                            32.0       7.5   
PHALS_11367                                                           32.0       7.9   
PYIW_23677                                                            29.6       7.9   
PHYKE_2345                                                            31.6       8.0   
SDRG_07310                                                            32.0       8.2   
PYAP_17960                                                            31.6       8.3   
H310_08803                                                            31.6       8.3   
HYAP_13815                                                            31.6       8.4   
PHYRA_73297                                                           30.0       8.4   
CCI45857                                                              31.6       8.5   
PHYSO_529931                                                          31.6       8.8   
PITG_07652                                                            31.6       9.0   
H257_12476                                                            31.6       9.2   
SPRG_21393                                                            31.6       9.2   
PYAR_19122                                                            31.6       9.4   
PHALS_06636                                                           31.6       9.5   
HYAP_13689                                                            31.2       9.7   
PHYCA_504798                                                          31.2       9.8   
CCA23797                                                              31.2       9.8   
CCA17832                                                              31.6       10.0  

>PHYRA_81100
Length=349

 Score = 687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/349 (100%), Positives = 349/349 (100%), Gaps = 0/349 (0%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC
Sbjct  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
            HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG
Sbjct  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
            DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180

Query  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
            KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDSRPKSTASKGHspqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGELE  300
            TLHLFSDDSRPKSTASKGHSPQRSQQSGGSPSRLPPAMETINDAGVSDLERLAQALGELE
Sbjct  241  TLHLFSDDSRPKSTASKGHSPQRSQQSGGSPSRLPPAMETINDAGVSDLERLAQALGELE  300

Query  301  VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
            VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF
Sbjct  301  VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349

>PHYSO_471523
Length=348

 Score = 618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/349 (87%), Positives = 323/349 (93%), Gaps = 1/349 (0%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            MNILRVPE+GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVL+GSNL +SYYESRAAC
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
            HPP  EPSAPKGSFYLSSIEPHEYVVGVMGAA KPFGFKM+GHAP+KGYVELDVFVET  
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
            DRNKWLEVARNALSAKRQLTRQAIDQSVS N+KNLFGF +SLSPQP M+PQKQMQTLT++
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180

Query  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
            +DELLS ALRDIEAAK VGREACNEIV QGEKLDAIEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDSRPKSTASKGHspqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGELE  300
            TLHLFSDDSRPK++ASK  S  +  Q  G P RLPPAM++INDAGVSDLERLAQALGELE
Sbjct  241  TLHLFSDDSRPKASASKA-SSPQRSQQSGRPPRLPPAMDSINDAGVSDLERLAQALGELE  299

Query  301  VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
            VQAE+LNGEAGR TQQIER+EHQLSNVTARVEKQTKQASA L +GP+LF
Sbjct  300  VQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348

>PPTG_17127
Length=351

 Score = 595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/351 (85%), Positives = 317/351 (90%), Gaps = 2/351 (1%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            MNILRVPE G TASGDKARPTSCEGYVTKRGHFRKSWRVRFLV++GSNLQ+SYYESRAAC
Sbjct  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
            HPP  EPSAPKGSFYLSSIEPHEYVVGVMGAA KPFGFKM+GHAPKKGYVELDVFV+T  
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
            DRNKWLEVARNALS KRQLTRQAIDQSVS NKK LFGF V+LSPQP M+PQKQMQTL ++
Sbjct  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180

Query  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
            KDELLS ALR++EAAKLVGREACNEIVIQGEKLD IEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDSRPKST-ASKGHs-pqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGE  298
            TLHLFSDDSRPKST  SKG S  +  Q  G SPSRLPPA +T +DAG SDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300

Query  299  LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
            LEVQAE+LNGEA  S+QQIER+EH L+NVT RVEKQTKQASATL AGP+LF
Sbjct  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PITG_18456
Length=351

 Score = 592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/351 (84%), Positives = 318/351 (91%), Gaps = 2/351 (1%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            MNILRVPE GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLV++GSNLQ+SYYESRAAC
Sbjct  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
            HPP  +PSAPKG FYLSSIEPHEYVVGVMGAA KPFGFKM+GHAPKKGYVELDVFV+T  
Sbjct  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
            DRNKWLEVARNAL AKRQLTRQAIDQSVS  KKNLFGF VSLSPQP M+PQKQ+QTL+++
Sbjct  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180

Query  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
            KDELLS ALR++EAAKLVGREACNEIV+QGEKLDAIEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDSRPKSTASKGHspqrsqqsg--gspsrLPPAMETINDAGVSDLERLAQALGE  298
            TLHLFSDDSRPKST S   S  +        SP+RLPPA+E  +DAGVSDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300

Query  299  LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
            LEVQAE+LNGEAGRS+QQIER+EH L+NVT RVEKQTKQASATL AGP+LF
Sbjct  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHYCA_556162
Length=351

 Score = 588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/351 (83%), Positives = 312/351 (89%), Gaps = 2/351 (1%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            MNILRVPE+GA  SGDKARPTSCEGYVTKRGHFRKSWRVRFLVL+GSNLQ++YYESRAAC
Sbjct  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
            HP   E S PKGSFYLSSIEPHEYVVGVMGAAGKPFGFKM+GHAPKKGYVELDVFVET G
Sbjct  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
            DRNKWLEVARNALSAKRQLTRQAIDQSVS NKKNLFGF VSLSPQP ++PQKQMQTLT+N
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180

Query  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
            KD+LLS ALRDIEAAK +GREACNEIVIQGEKLDAIEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDSRPKSTASK--GHspqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGE  298
            TLH+FS+DSRPKST+S       +  Q  G SP+RL  A E+  D G SDLERLAQALGE
Sbjct  241  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  300

Query  299  LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
            LE+QAE+LN EAG STQQI+ +EH LS VT RVEKQTKQASATLRAGP+LF
Sbjct  301  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351

>PHALS_06478
Length=345

 Score = 545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/349 (78%), Positives = 297/349 (85%), Gaps = 4/349 (1%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLVL+GSNLQ++YYESRAAC
Sbjct  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
            HPP  E + PKGSFYLS+IEPHEYV+GVMGAA +PFGFKM+GHAP+KG+VELDVFVETQ 
Sbjct  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
            DRNKWLEVA NAL AKRQLTRQAIDQSVS NKK LFGF V  S QP+M+PQKQMQTL  +
Sbjct  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180

Query  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
            K+ LL  ALR+IEAAKLVGREACNEIV QGEKLD IEQDL AIDRDLDFGDKLL RLKSP
Sbjct  181  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240

Query  241  TLHLFSDDSRPKSTASKGHspqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGELE  300
            TLH FSDD+RPK                 SPSRL PA+E   DAGVSDL+RLAQALGELE
Sbjct  241  TLHFFSDDTRPKVPLGD----HPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELE  296

Query  301  VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
            VQAE+LN E+G S+QQIER+EH LS+VT RVEKQTKQA ATL AGP+LF
Sbjct  297  VQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345

>PHYKE_8393
Length=326

 Score = 500 bits (1288),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 251/351 (72%), Positives = 279/351 (79%), Gaps = 27/351 (8%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            MNILRVPE+GATASGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
            HPP  E  A KGSFYLS+I PHEYVVGVMGAA KPFGFKM+GHAP+KGYVELDVFVET  
Sbjct  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
            DRNKWLEVARNAL AKRQ+ RQAIDQSVS  KK +FGFG+SLSPQPL+ PQKQ+Q LT N
Sbjct  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHN  155

Query  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
            K+ELL+ ALR++EAAK+VGREACNEIV+QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  156  KEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215

Query  241  TLHLFSDDSRPKSTASKGHspqrsqqsggsps--rLPPAMETINDAGVSDLERLAQALGE  298
            TLHLFSDD+RPKS A+   S  +        +   LP +M + NDA  SDLERLA ALGE
Sbjct  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGE  275

Query  299  LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
            LE+QAE+LNGEAGRSTQQI R+E QLSNVTARVEKQTKQASATL AGP+LF
Sbjct  276  LELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326

>PYU1_G001735
Length=342

 Score = 365 bits (938),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 192/352 (55%), Positives = 246/352 (70%), Gaps = 20/352 (6%)

Query  1    MNILRVPEIGATASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
            MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV  G++LQ+SY+ESR A
Sbjct  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60

Query  60   CHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQ  119
             H P    + PKGSFY+SS+E HEY +GVMG   KPFGFK++GHAP KGY+ELD+FVE+ 
Sbjct  61   AHAPG---TVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117

Query  120  GDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQ  179
             D NKWLEV +NAL A ++LTR+ +  S     K++FGFG S+SPQ       Q++ L  
Sbjct  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVKKLAA  167

Query  180  NKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKS  239
             K+ELL  ALR+IE AKL+GREA NEIV QGEKLD +E DLG ++ DLD  DKLLR LKS
Sbjct  168  TKEELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227

Query  240  PTLHLFSDDSRPKSTASKGHspqrsqqsggspsrLP------PAMETINDAGVSDLERLA  293
            P LH+FS+D+R K  A    +   S  +  + S +        A  T     ++DLE LA
Sbjct  228  PVLHVFSNDNRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLA  287

Query  294  QALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAG  345
             AL ELE QA ++N EA RST+QI R+E +L++V  RV+ QTK+A+AT++AG
Sbjct  288  LALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339

>PYIR_13451
Length=359

 Score = 361 bits (927),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/364 (54%), Positives = 246/364 (68%), Gaps = 27/364 (7%)

Query  1    MNILRVPEIGATASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
            MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV  G+NLQ++YY
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  55   ESRAACHPPAAEPS----APKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYV  110
            ESR A    ++        PKGSFY+SS+E HEY VGVMG   KPFGFK++GHAPKKGY+
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  111  ELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTP  170
            ELD+FVE+ GD NKW+EV +NAL A ++ +R    Q  +S  K +FGF  S SPQ     
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQD-NSTTKTMFGFSASASPQL----  175

Query  171  QKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFG  230
              Q++ L   K++LL  ALR+IE AKL+GREA NEIV+QGEKLD +E DLG ++ DLD  
Sbjct  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233

Query  231  DKLLRRLKSPTLHLFSDDSR----PKSTASKGHspqrsqqsggspsrLPPAMETI-----  281
            DKLLR +K P LHLFS D R    P +  + GH+ + S       +    A         
Sbjct  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQR  293

Query  282  NDAGVSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASAT  341
            NDA +SDLE+LA ALGELE QA ++N EA +ST+QI RVE +L+ V  RV+ QTK+A+AT
Sbjct  294  NDA-LSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANAT  352

Query  342  LRAG  345
            ++AG
Sbjct  353  MKAG  356

>PYAP_17762
Length=348

 Score = 348 bits (894),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 242/357 (68%), Gaps = 27/357 (8%)

Query  1    MNILRVPEIGATA----------SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            MNILR+P +GAT+               +PTSCEGYVTKRGHFRKSWRVRFLVL G++L 
Sbjct  1    MNILRLP-LGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLL  59

Query  51   ISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYV  110
            +SYY+S+       A    PKGSFYLSS+E HEY VGV+GA  KPFGFKM+GHAP+KGYV
Sbjct  60   VSYYDSKEVARTAGA---VPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYV  116

Query  111  ELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTP  170
            ELD+FVET GD NKWLEV +NAL A ++LTR    ++++   K+LFGF       P  +P
Sbjct  117  ELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSP  168

Query  171  QKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFG  230
            Q+QM+ +T  K+++L  A+ +IE+AKL+GR AC EI IQGE+LD I Q+L  ++ DLD+ 
Sbjct  169  QQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYA  228

Query  231  DKLLRRLKSPTLHLFSDDSRPKS-----TASKGHspqrsqqsggspsrLPPAMETINDAG  285
            DKLLR +K+P LH+FS D+R ++     T         +       + L  + + +  A 
Sbjct  229  DKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAP  288

Query  286  VSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATL  342
            +SD+ERLA  LGELE QA +LN EA + T Q+ERV  QL++V  RV+ QT++A+A++
Sbjct  289  LSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345

>PYIW_19971
Length=348

 Score = 324 bits (830),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 190/362 (52%), Positives = 239/362 (66%), Gaps = 34/362 (9%)

Query  1    MNILRVPEIGATAS----GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            MNILRVP++    S    GDK + TSCEGYVTKRGHFRKSWRVR+LV  G++LQ +    
Sbjct  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGG  60

Query  57   RAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFV  116
             +         + PKGSF++SS+E HEY VGVMG   KPFGFK++GHAPKKGY+ELD+FV
Sbjct  61   ASP--------ATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFV  112

Query  117  ETQGDRNKWLEVARNALSAKRQLTRQ--AIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQM  174
            ET GD NKW+EV +NAL A ++ TR   A D   SS  KN+FGF  ++SPQ       Q+
Sbjct  113  ETLGDLNKWVEVVQNALDAAKKHTRTPGAAD---SSTTKNMFGFSATVSPQL------QV  163

Query  175  QTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLL  234
            + L   K+ELL  ALR+IE AKL+GREA ++I  QG KL+ IE DLG ++ DLD G KLL
Sbjct  164  KKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLL  223

Query  235  RRLKSPTLHLFSDDSRPKSTA--SKGHspqrsqqsggspsrLPPAMETINDAG-------  285
              +K P LHLFS+D+R K  A  S  HS  +   SG  PS    + ET   A        
Sbjct  224  NHMKRPMLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDT  283

Query  286  --VSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLR  343
              +SDLERL  ALGELE QA  +N EA +ST+QI RVE +L+ V  RV+ QTK+A+AT++
Sbjct  284  SVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMK  343

Query  344  AG  345
            AG
Sbjct  344  AG  345

>PYVX_18171
Length=294

 Score = 315 bits (807),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 219/338 (65%), Gaps = 60/338 (18%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
            RPTSCEGYVTKRGHFRKSWRVR+LVL+G++L+++Y+ES+ A    AA     KG FYLSS
Sbjct  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAA----SKGEFYLSS  65

Query  79   IEPHEYVVGVMGAAG---KPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
            I+ H YV G MGA G   KPFGFKM+GHAPKKGY ELD+FVET  D  KWLEVA NAL +
Sbjct  66   IDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125

Query  136  KRQLTRQAI-DQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEA  194
               ++R+A  D   S+  K+LFGF  + SPQ      +Q++ ++ +KDELL  ALR++E 
Sbjct  126  AAAMSRKAAGDGGGSATTKSLFGFSTTTSPQ------QQLKAMSVSKDELLKDALRELEG  179

Query  195  AKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDD-SRPKS  253
            AKL+GREAC E+V+QGEKLD IE +LG I+ DLD+GDKLLRRLKSP LHL + D  RP  
Sbjct  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRRP--  237

Query  254  TASKGHspqrsqqsggspsrLPPAMETINDA--GVSDLERLAQALGELEVQAEILNGEAG  311
                                 P   +T+++A  G + LE+L                   
Sbjct  238  ---------------------PSPTKTLSNAGDGRAALEQL-------------------  257

Query  312  RSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
             STQQI R+E +L+ V  RV++QTKQA++ ++ G  +F
Sbjct  258  -STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYAR_13570
Length=322

 Score = 293 bits (750),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 227/325 (70%), Gaps = 29/325 (9%)

Query  36   SWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKP  95
            SWRVR+LVL G++L +SY++S+     P A   +PKGSFYLSS+E HEYVVGV+GA  KP
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGA---SPKGSFYLSSVEKHEYVVGVLGAQKKP  64

Query  96   FGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNL  155
            FGFKM+GHAP+KGYVELD+FVE++GD  KWLEV ++AL+A ++LTR  +  + S+  K+L
Sbjct  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122

Query  156  FGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQG-----  210
            FGF       P  +PQKQ+Q L+ +K+ELL  A+ +IE+AKL+GREAC EIV+QG     
Sbjct  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176

Query  211  ----------EKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTASKGHs  260
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K++AS  HS
Sbjct  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHS  236

Query  261  pqrsqqsggspsrLPPAM-ETINDAG--VSDLERLAQALGELEVQAEILNGEAGRSTQQI  317
            P +S+QS  S +    A+ + +  A   +SD+ERLA  LGELE QA +LN EA R T Q+
Sbjct  237  PVKSKQSALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQV  296

Query  318  ERVEHQLSNVTARVEKQTKQASATL  342
            ERV   L+++  RV+ QTK+A + +
Sbjct  297  ERVGDALAHINERVQNQTKKADSAV  321

>CCA18899
Length=343

 Score = 257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 202/335 (60%), Gaps = 32/335 (10%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+Q+SYYES+ +     A    PKGSF L S 
Sbjct  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNA---TPKGSFILQSA  71

Query  80   EPHEYVVGVMGAAG---KPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
            E HEY +  M       KPFGFKM+GHAPK+GY+ELDVFV++  D ++WL+V  N L A 
Sbjct  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131

Query  137  RQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAK  196
            + + R+A    + +  K++ GF    +     T ++Q+Q L   K + +  AL+ IE AK
Sbjct  132  KCMAREAFMAEMDTT-KSVLGFSYIGT-----TSKQQIQVLKSKKCDYIHEALQQIEMAK  185

Query  197  LVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTAS  256
              G  AC+EIV QGE+L  +EQ+L  I  DL+  +KL++ ++ P  + FS  SRP   A+
Sbjct  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-RSRPHDRAT  244

Query  257  KGHspqrsqqsggspsrLPPAM--ETINDAGV-----------SDLERLAQALGELEVQA  303
                   S+ S    S   P +  +T  D  V           +D+E+LA AL +LEVQA
Sbjct  245  I------SKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQA  298

Query  304  EILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQA  338
            +++N EA +S +QI R+E QLS +  R++ QT Q 
Sbjct  299  QLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQV  333

>CCI45123
Length=301

 Score = 198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/304 (37%), Positives = 173/304 (57%), Gaps = 21/304 (7%)

Query  49   LQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAG---KPFGFKMIGHAP  105
            +Q+SYYES+ +     A    PKGSF L ++E HEY +  M       +PFGFKM+GHAP
Sbjct  1    MQVSYYESKDSYKNRNA---TPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57

Query  106  KKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQ  165
            K+GYVELDVFV++  + ++WL+V  N L A +++ R+A    + +  K + GF  + +  
Sbjct  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTT-KGVLGFSFAGT--  114

Query  166  PLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDR  225
               T ++Q++ L   K + +  AL+ IE AK  G  AC+EIV QGE+L  +EQ+L  I+ 
Sbjct  115  ---TSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171

Query  226  DLDFGDKLLRRLKSPTLHLFSDD--------SRPKSTASKGHspqrsqqsggspsrLPPA  277
            DL+  +KL++ ++ P  + FS          S+  +     H          +  ++   
Sbjct  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231

Query  278  METINDAGVSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQ  337
             E I     +DLE+LA AL ELEVQA+++N EA +S  QI R+E QLS +  R++ QT Q
Sbjct  232  AEEIC-VPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQ  290

Query  338  ASAT  341
              A+
Sbjct  291  VVAS  294

>SPRG_06336
Length=335

 Score = 199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 121/334 (36%), Positives = 188/334 (56%), Gaps = 26/334 (8%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
            + TSCEGYVTKRGH  KSWR R++VL+G  L++SYY+S+       ++    KGSF L+ 
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAE  65

Query  79   IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQ  138
            IE H+Y     G   KP+GFK++GHAP  GY E  V+VET  D+ +WLEVA NAL   + 
Sbjct  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KN  121

Query  139  LTRQA-IDQSVSSNKKNLFGFGVSLSPQPLMTPQK-QMQTLTQNKDELLSGALRDIEAAK  196
            +T QA +DQ  S+    L G     +P   +T    Q++ + + K+ELL  A+  +E A+
Sbjct  122  VTPQASVDQRASA----LLGH---RAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHAR  174

Query  197  LVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSR------  250
             VG    +E+    E LD  E ++  ++ +LD GD +++++ SP  + FS          
Sbjct  175  TVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTG  234

Query  251  -PKSTASKGHspqrsqqsggspsrLPPAME---TINDAGVSDLERLAQALGELEVQAEIL  306
             PKS +++ H PQ    S        PA +      DAG  +L++L++ L  LEV A  +
Sbjct  235  SPKSKSARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTI  294

Query  307  NGEAGRSTQQIERVEHQLSNVTARVEKQTKQASA  340
            + E  R+T+QI+R++ ++     R+ +Q+ +  A
Sbjct  295  STEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328

>SDRG_01781
Length=335

 Score = 192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/334 (35%), Positives = 186/334 (56%), Gaps = 26/334 (8%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
            + TSCEGYVTKRGH  KSWR R++VL+G  L++SY++S+       ++    KGSF L+ 
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAE  65

Query  79   IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQ  138
            IE H+Y     G   KP+GFK++GHAP  GY E  V+VET  D+ +WLEVA NAL  K  
Sbjct  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-GKNV  122

Query  139  LTRQAIDQSVSS--NKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAK  196
              + + DQ  ++    +   GF   L+  P+     Q++ + + K+ELL  A+  +E A+
Sbjct  123  APQASADQRATALLGHRAASGF---LTSAPV-----QLRNVNKTKEELLRKAIVTLEHAR  174

Query  197  LVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSR------  250
             VG    +E+    E LD  E ++  +  +LD GD +++++ SP  + FS          
Sbjct  175  TVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAG  234

Query  251  -PKSTASKGHspqrsqqsggspsrLPPAMET---INDAGVSDLERLAQALGELEVQAEIL  306
             PKS +++ H PQ    S  +     P  +T     DAG  +L++L++ L  LEV A  +
Sbjct  235  SPKSKSARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTI  294

Query  307  NGEAGRSTQQIERVEHQLSNVTARVEKQTKQASA  340
            + E  R+T+QI+R++ ++     RV +Q+ +  A
Sbjct  295  STEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328

>H257_06294
Length=358

 Score = 174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 119/355 (34%), Positives = 181/355 (51%), Gaps = 33/355 (9%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL  76
            K   TSCEGYVTKRGH  KSW+ R++VL G  L +SYY+S+            PKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI----YTSKGHPKGSFVL  62

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL---  133
            S  E  +  +   GA+ KPFGFK IGH P +GY E  V+VE+Q D+ KWL VA NAL   
Sbjct  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120

Query  134  SAKRQLTRQAIDQ---------SVSSN--KKNLF---GFGVSLSPQPLMTPQKQMQTLTQ  179
            S+ ++   Q I++         SV  N  ++++      G   S   + + + QM+ + +
Sbjct  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180

Query  180  NKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKS  239
               ELL  A+ D + A  +G    NE+V Q + L+  E  +  + R +D  + L R LK 
Sbjct  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240

Query  240  PTL----HLFSDDSRPK-----STASKGHspqrsqqsggspsrLPPAMETINDAGVSD-L  289
            P L    HLF+     K     S   KG +              PP  +        D L
Sbjct  241  PILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQL  300

Query  290  ERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRA  344
            ++L++ L +L   A+ ++    R+T+Q++R++ ++++V  RV+K+ K   A L+A
Sbjct  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355

>H310_09223
Length=333

 Score = 165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/340 (33%), Positives = 176/340 (52%), Gaps = 28/340 (8%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL  76
            K   TSCEGYVTKRGH  K+W+ R++VL G  L ++YY+S+            PKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP----PKGSFVL  62

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
            S  E  +  +   G + KPFGFK IGH P +GY E  VFVETQ D+ KWL VA NAL   
Sbjct  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120

Query  137  RQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAK  196
              +   +++    +  K   G  +SL        + Q++ + +   ELL  A+ D + A 
Sbjct  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172

Query  197  LVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDD-SRPKSTA  255
             +G    +E+  Q E L+  E  + A+ + +D  + L + +K P L+ F+   SR KS  
Sbjct  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKR  232

Query  256  SK----------GHspqrsqqsggspsrL-PPAMETINDAGVSDLERLAQALGELEVQAE  304
             K          G S + S+   G   +L PP  +   +     L+ L++ L +L   A+
Sbjct  233  GKRGASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEE--DQLDELSKILAKLGQTAD  290

Query  305  ILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRA  344
             ++    R+T+Q++R++ ++++V  RV K+ K   + L+A
Sbjct  291  TISDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330

>CCI45127
Length=202

 Score = 105 bits (263),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 105/197 (53%), Gaps = 14/197 (7%)

Query  153  KNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEK  212
            K + GF  + +     T ++Q++ L   K + +  AL+ IE AK  G  AC+EIV QGE+
Sbjct  5    KGVLGFSFAGT-----TSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQ  59

Query  213  LDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDD--------SRPKSTASKGHspqrs  264
            L  +EQ+L  I+ DL+  +KL++ ++ P  + FS          S+  +     H     
Sbjct  60   LGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI  119

Query  265  qqsggspsrLPPAMETINDAGVSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQL  324
                 +  ++    E I     +DLE+LA AL ELEVQA+++N EA +S  QI R+E QL
Sbjct  120  LHMRKNDGKIEHVAEEIC-VPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQL  178

Query  325  SNVTARVEKQTKQASAT  341
            S +  R++ QT Q  A+
Sbjct  179  SGINDRIQSQTTQVVAS  195

>PYAR_23286
Length=607

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 58/123 (47%), Gaps = 20/123 (16%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
            A+ +   P +C GY+TK+GH RKSW+ R+ VL GS+  +SYY      + P  +P A   
Sbjct  379  ATANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLA---  433

Query  73   SFYLSSIEPHEYVV-GVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARN  131
                      E V+  V    G+PFGF  +       Y    V+ + + +R KW+   R 
Sbjct  434  ----------EVVIEDVQRWDGEPFGFMFMTSEQIPYY----VYADNERERTKWMNALRK  479

Query  132  ALS  134
              S
Sbjct  480  LTS  482

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 51/104 (49%), Gaps = 23/104 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            CEG++TKRGH   +W++R+ VL G+ L+  Y+         A E  + +   Y S +   
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE--YF---------AGEDKSKR---YGSVV---  236

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
              V  V   +G+  GF M   A +  Y    V+  ++ +R KWL
Sbjct  237  --VEKVAAWSGEAHGF-MFYTAKQVPYY---VYASSESERAKWL  274

 Score = 35.4 bits (80),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            +CEGY+T+RGH   S R  + VL G++L+
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  316

>HYAP_08645
Length=1514

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 55/116 (47%), Gaps = 19/116 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL ISYY      +     P A          
Sbjct  305  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGRPLA----------  352

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
                 V  V    G+PFGF  + +     Y    V+ +   +RNKW+  A N L+A
Sbjct  353  --EVLVEDVQSWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWMN-ALNKLNA  401

 Score = 42.7 bits (99),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
            CEGY+TKRGH   +W+ R+  L G+ L+  YY
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YY  142

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 29/43 (67%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNL-----QISYYESRAA  59
            SCEGY+TKRGH   S R+ + VL G++L     Q +Y E+++A
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSA  249

>PHYRA_84916
Length=1541

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 54/115 (47%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   ISYY      +    +P A          
Sbjct  402  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLA----------  449

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                 V  V    G+PFGF  + +     Y    V+ +   +RNKW+    NAL+
Sbjct  450  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWM----NALN  494

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 50/104 (48%), Gaps = 23/104 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  259

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                     +G+  GF    +  K+  +   V+  ++G+R++WL
Sbjct  260  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEGERSRWL  290

 Score = 40.0 bits (92),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  332

>PYU1_G006347
Length=1095

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 54/115 (47%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL ISYY      +    +P A          
Sbjct  392  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGKPLAEVA-------  442

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                 V  V    G+PFGF  +        V   V+ +   +RNKW+    NALS
Sbjct  443  -----VEDVQKWDGEPFGFMFM----TSEQVPYYVYADNDRERNKWM----NALS  484

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 49/104 (47%), Gaps = 23/104 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            CEG++TKRGH   +W+ R+ VL G  L+  Y+           E +   GS  ++ + P 
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE--YFS--------GEEKNKKYGSVTVAKVAPW  249

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                     +G+  GF    +  K+  +   V+  ++ +R+KWL
Sbjct  250  ---------SGEAHGFMF--YTTKQ--IPYYVYAASEAERSKWL  280

 Score = 38.9 bits (89),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (44%), Gaps = 29/114 (25%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNL-----QISYYESRAACHPPAAEPSAPKGSFYL  76
            SCEGY+T+RGH   S R+ + VL G++L     Q +Y ++++A                +
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASLRHYADQSAYRDNQSA----------------I  337

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
            + +E    V  V    G+P G           Y   D    T G++ KWL+  +
Sbjct  338  AEVE----VRSVAPWDGEPNGLMFQTSTGNVFYASTD----TVGEQQKWLQTVK  383

>PHYSO_361747
Length=1523

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 54/116 (47%), Gaps = 19/116 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   ISYY      +    +P A          
Sbjct  411  PVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKPLA----------  458

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
                 V  V    G+PFGF  +        V   V+ +   +RNKW+  A N L+A
Sbjct  459  --EVLVEDVQKWDGEPFGFMFM----TTEQVPYYVYADNDRERNKWMN-ALNKLNA  507

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 51/111 (46%), Gaps = 23/111 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+         
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAV--------  260

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              V  V   +G+  GF    +  K+  +   V+  ++ +R++WL V +  +
Sbjct  261  -TVEKVATWSGEAHGFMF--YTTKQ--IPYYVYASSESERSRWLRVLKEYM  306

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  341

>PYIW_17381
Length=952

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (49%), Gaps = 25/129 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL I+Y+      +    +P        L+ +
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGKP--------LAEV  452

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQL  139
                 V  V    G+PFGF  +        V   V+ +   +RNKW+    NAL   R+L
Sbjct  453  T----VEDVQKWDGEPFGFMFM----TSEQVPYYVYADNDRERNKWM----NAL---RKL  497

Query  140  TRQAIDQSV  148
            T  A + +V
Sbjct  498  TTVAEEPTV  506

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 49/104 (47%), Gaps = 23/104 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            CEG++TKRGH   +W+ R+ VL G+ L+    E +   +          GS  ++ + P 
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFSGEDKGKRY----------GSVTVAKVAPW  260

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                     +G+  GF    +  K+  V   V+  ++ +R+KWL
Sbjct  261  ---------SGEAHGFMF--YTTKQ--VPYYVYASSEAERSKWL  291

 Score = 39.3 bits (90),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 49/115 (43%), Gaps = 29/115 (25%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNL-----QISYYESRAACHPPAAEPSAPKGSFYLS  77
            CEGY+T+RGH   S R+ + VL G++L     Q +Y E+++A                + 
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSAI-----------AEVDVK  354

Query  78   SIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            SI P E         G+P G           Y   D    T G++ KW++  + +
Sbjct  355  SIAPWE---------GEPNGLMFQTSTGNVFYASAD----TLGEQQKWIQTVKRS  396

>PPTG_18898
Length=1559

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   ISYY      +    +P A          
Sbjct  405  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  452

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                 V  V    G+PFGF  + +     Y    V+ +   +R KW+
Sbjct  453  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERTKWM  493

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (47%), Gaps = 23/111 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  262

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                     +G+  GF    +  K+  +   V+  ++ +R++WL   ++ +
Sbjct  263  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEAERSRWLRALKDFM  300

 Score = 40.0 bits (92),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  335

>PITG_20562
Length=1559

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   ISYY      +    +P A          
Sbjct  406  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  453

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                 V  V    G+PFGF  + +     Y    V+ +   +R KW+
Sbjct  454  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERTKWM  494

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (47%), Gaps = 23/111 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  263

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                     +G+  GF    +  K+  +   V+  ++ +R++WL   ++ +
Sbjct  264  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEAERSRWLRALKDFM  301

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  336

>PYIR_21589
Length=1568

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 18/121 (15%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL I+YY       P     ++ KG   L+ +
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYY-------PDYDLANSAKGR-ALAEV  452

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQL  139
                 V  V    G+PFGF  +       Y    V+ +   +RNKW+   R   +   + 
Sbjct  453  T----VEDVQKWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLTTVAEEP  504

Query  140  T  140
            T
Sbjct  505  T  505

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 49/104 (47%), Gaps = 23/104 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            CEG++TKRGH   +W+ R+ VL G+ L+    E +   +          GS  ++ + P 
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFAGEDKGKRY----------GSVTVAKVAPW  260

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                     +G+  GF    +  K+  +   V+  ++ +R+KWL
Sbjct  261  ---------SGEAHGFMF--YTTKQ--IPYYVYAASEAERSKWL  291

 Score = 38.5 bits (88),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            SCEGY+T+RGH   S R+ + VL G++L+
Sbjct  305  SCEGYLTRRGHLVPSQRMAYYVLNGTSLR  333

>PHYKE_1990
Length=1499

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 53/115 (46%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ +L GS   ISYY      +         KG      +
Sbjct  403  PVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMAN-------NSKGKALAEVL  453

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                 V  V    G+PFGF  +       Y    V+ +   +RNKW+    NAL+
Sbjct  454  -----VEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM----NALN  495

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 48/104 (46%), Gaps = 23/104 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+         
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAV--------  252

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
              V  V   +G+  GF    +  K+  +   V+  ++ +R+KWL
Sbjct  253  -MVEKVATWSGEAHGFMF--YTTKQ--IPYYVYASSEAERSKWL  291

 Score = 39.7 bits (91),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLR  333

>PYVX_20438
Length=1346

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 27/134 (20%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ +L G++  ISY+      +      SA   +    ++
Sbjct  316  PVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMAN------SAKGKALAEVTV  367

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQL  139
            E       V    G+PFGF  +       Y    V+ +   +RNKW+    NAL   R+L
Sbjct  368  E------DVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM----NAL---RKL  410

Query  140  TRQAIDQSVSSNKK  153
               A+D+   + KK
Sbjct  411  --NAVDEEPEAEKK  422

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 50/116 (43%), Gaps = 29/116 (25%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNL-----QISYYESRAACHPPAAEPSAPKGSFYL  76
            SCEGY+TKRGH   S R+ + VL G+ L     Q +Y E+++A                +
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA----------------M  261

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            + +E    V  V    G+P G           Y   D    TQG++ KWL   + +
Sbjct  262  AEVE----VRSVATWDGEPHGLMFQTVTGNVFYASAD----TQGEQQKWLATVKKS  309

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L+  Y+ S
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS  154

>SDRG_12763
Length=1317

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 52/111 (47%), Gaps = 27/111 (24%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
            +P SC GY+TK+GH RKSW+ R+ VL G+ L  SYY                  S Y S 
Sbjct  220  KPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYY------------------SDYDSM  259

Query  79   IEPHEYVVGVMGAA---GKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
             +     VGV   A   G+ FGF+ I       Y    VF E+  +R KW+
Sbjct  260  NKQSLAEVGVEDVALWDGEQFGFQFITTEQVPYY----VFAESDRERQKWM  306

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 60/152 (39%), Gaps = 33/152 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK--GSFYLSSIE  80
            C GY+TKRGH   +W+ RF VL    + + YY          A+ S  K  G  +L  + 
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYY----------ADDSMVKKLGQVHLVKVA  58

Query  81   PHEYVVGVMG------AAGK---PFGFKMIGHAPKKGYVELDVFVETQGDRNKWL-----  126
            P EY     G      A G     FGF M     +  Y    V+     +R +WL     
Sbjct  59   PWEYFSATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQD  114

Query  127  --EVARNALSAKRQLTRQAIDQSVSSNKKNLF  156
               V  NA   +  LT++    S  S++   +
Sbjct  115  LYVVTSNATDCEGYLTKRTPGFSFLSSRPKYY  146

>SPRG_06059
Length=1312

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 50/108 (46%), Gaps = 21/108 (19%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
            +P SC GY+TK+GH RKSW+ R+ VL G  L  +YY         A   S  K S     
Sbjct  222  KPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYY---------ADYDSMNKQSLAEVG  270

Query  79   IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
            +E       V    G+ FGF+ I       Y    VF E+  +R KW+
Sbjct  271  VE------DVALWDGEQFGFQFITTEQVPYY----VFAESDRERQKWM  308

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 60/151 (40%), Gaps = 31/151 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK-GSFYLSSIEP  81
            C GY+TKRGH   +W+ RF VL    + + YY         A E  A K G  +L  + P
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYY---------ADESMAKKLGQVHLVKVAP  61

Query  82   HEYVVGVM---------GAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL------  126
             EYV             G+    FGF M     +  Y    V+     +R KWL      
Sbjct  62   WEYVSATTANSILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWLLALQDL  117

Query  127  -EVARNALSAKRQLTRQAIDQSVSSNKKNLF  156
              V  NA   +  LT++    S  S++   +
Sbjct  118  YVVTSNATDCEGYLTKRTPGFSFLSSRPKYY  148

>PYAP_16997
Length=1018

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 55/118 (47%), Gaps = 18/118 (15%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
            A+ +   P +C GY+TK+GH RKSW+ R+ VL G++  I+Y+      +       + KG
Sbjct  392  ATANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTAN-------SNKG  442

Query  73   SFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
                  I     V  V    G+PFGF  +        V   V+ + + +R KW+   R
Sbjct  443  KALAEVI-----VEDVQRWDGEPFGFMFM----TSEQVPYYVYADNERERGKWMNALR  491

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 53/119 (45%), Gaps = 23/119 (19%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
            +CEG++TKRGH   +W++R+ VL G+ L+  Y+           + S   GS  +  + P
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFS--------GDDKSKRYGSVIVEKVAP  255

Query  82   HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLT  140
                      +G+  GF           V   V+  ++ +R KWL   R+ +    ++T
Sbjct  256  W---------SGEAHGFMFY----TTKQVPYYVYASSEAERAKWLRALRDFMVEPEEVT  301

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            +CEG++T+RGH   S R  + VL G++L+
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR  329

>CCI44752
Length=1526

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 55/119 (46%), Gaps = 18/119 (15%)

Query  12   TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK  71
            T + +   P +C GY+TK+GH RKSW+ R+ +L G+   ISYY+     +    +     
Sbjct  407  TTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANNAKGKA----  460

Query  72   GSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
                L+ ++    V  V    G+ FGF  +       Y    V+ + + +R KW+   R
Sbjct  461  ----LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKWMSALR  507

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 47/107 (44%), Gaps = 23/107 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGY+TKRGH   +W+ RF VL G+ L+  YY S         E +   GS  ++ + P  
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPW-  271

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
                    +G+  GF          Y    V+  ++ ++ KWL   R
Sbjct  272  --------SGEAHGFMFYTTKQIPYY----VYAASEAEKTKWLRALR  306

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            +CEGY+T+RGH   S RV + VL G+ L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  344

>H310_00231
Length=1495

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 54/122 (44%), Gaps = 18/122 (15%)

Query  9    IGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPS  68
            +G        +P +C G++TK+GH RKSW+ R+ VL G+ L  +YY    A +      S
Sbjct  338  LGKVTVDKPVQPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASN---MRHS  392

Query  69   APKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEV  128
             P G   +  +   +         G+P GF  +        V   VF + + D+ KWL  
Sbjct  393  RPLGEVTVREVSTWD---------GEPGGFMFV----TNDNVPYYVFADNERDQAKWLTA  439

Query  129  AR  130
             R
Sbjct  440  LR  441

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            CEGY+TKRGH   S+R+R+ VL G++++
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK  278

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 43/103 (42%), Gaps = 22/103 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            GY+TKRGH   +W+ RF VL     ++SYY                 G  +L  + P   
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYYADEGM--------KKKLGEVHLEKVSPW--  205

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLE  127
                   +G+  GF M   + +  Y    V+  T  +R +WLE
Sbjct  206  -------SGEANGF-MFYTSKQIAYY---VYASTNSERRRWLE  237

>H257_06722
Length=1482

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 54/118 (46%), Gaps = 18/118 (15%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
            A+    +P +C G++TK+GH RKSW+ R+ VL G+ L  +YY    A +    +P     
Sbjct  342  ATDKPMQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKP-----  394

Query  73   SFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
               L  +   E    V    G+P GF  I +     Y    VF +   D+ KWL   R
Sbjct  395  ---LGEVTVRE----VSAWDGEPSGFMFITNDSVPYY----VFADNDRDQAKWLAALR  441

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
            CEGY+TKRGH   S+R+R+ VL GS   I YY    A
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGST--IKYYADETA  285

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 47/117 (40%), Gaps = 24/117 (21%)

Query  13   ASGDKARPTS--CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAP  70
            AS D + P+     GY+TKRGH   +W+ RF VL     ++SYY                
Sbjct  143  ASMDSSAPSGILASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYYADEGM--------KKK  193

Query  71   KGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLE  127
             G  +L  + P          +G+  GF    +     Y    V+  T  +R +WL+
Sbjct  194  LGEVHLEKVSPW---------SGEANGFMFYTNKQIAYY----VYASTNSERRRWLD  237

>SPRG_06058
Length=1258

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 19/130 (15%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL  76
            K  P +C G++TK+GH RKSW+ R+ VL G+ L  SYY    A +  A +         L
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANTRAGKA--------L  192

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
            S +   +  VG        F F  + + P        VF + + D+ KW+   + A+ A 
Sbjct  193  SDVSLKD--VGPWDGEACGFMFTTLENVPYY------VFADNERDQAKWMSALKKAVGAD  244

Query  137  RQLTRQAIDQ  146
              L  + ID+
Sbjct  245  -TLAIETIDE  253

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 2/42 (5%)

Query  18  ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
           ARP  CEGY+TKRGH   S+R+R+ V+ GS   + YY    A
Sbjct  42  ARPVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  81

>PHYKE_2479
Length=171

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 7/53 (13%)

Query  5    RVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            R P   +T+S  K      EGYVTKRGH  ++W++RF  LEG NL +SYYE++
Sbjct  62   RPPHSNSTSSRSK-----WEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  107

>CCA18875
Length=1514

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 66/142 (46%), Gaps = 27/142 (19%)

Query  12   TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK  71
            T + +   P +C GY+TK+GH RKSW+ R+ +L G+   ISYY+     +    +     
Sbjct  407  TLTTNVVEPVTCAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANHVKGKA----  460

Query  72   GSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARN  131
                L+ ++    V  V    G+ FGF  +       Y    V+ + + +R KW      
Sbjct  461  ----LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKW------  502

Query  132  ALSAKRQLTRQAIDQSVSSNKK  153
             +SA R+L+   +D+   + KK
Sbjct  503  -MSALRKLS--TLDEDTETEKK  521

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 47/107 (44%), Gaps = 23/107 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGY+TKRGH   +W+ RF VL G+ L+  YY S         E +   GS  ++ + P  
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPW-  271

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
                    +G+  GF          Y    V+  ++ ++ KWL   R
Sbjct  272  --------SGEAHGFMFYTTKQIPYY----VYAASETEKAKWLRALR  306

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            +CEGY+T+RGH   S RV + VL G+ L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  344

>PYU1_G001063
Length=783

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            EGYVTKRGH  ++W+ RF  LEG+NL  SYYES+ 
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKV  179

>PYIR_17453
Length=2619

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 57/127 (45%), Gaps = 7/127 (6%)

Query  9     IGATASGDKARPTSCEGYVTKRGHFR-KSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
             IG ++         CEGYV  R HF   +WR RF VLE + L +  Y   +A      E 
Sbjct  2146  IGVSSKDGSGICHRCEGYVRVRHHFLGAAWRERFAVLEDTRLYL--YPDTSAALSEGREQ  2203

Query  68    SAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLE  127
              A +    ++  + H      +G     FGF++   A   GY+E  V +E +  + KWL 
Sbjct  2204  KALEKHDLIAVKKWHPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIEDE--QTKWLA  2259

Query  128   VARNALS  134
                NA+S
Sbjct  2260  AITNAVS  2266

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (51%), Gaps = 5/51 (10%)

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSF  74
             EGY+ KRGH   S R R+ VL  + L+  Y+ +      PA     P GSF
Sbjct  1222  EGYLVKRGHLIPSMRKRYCVLVKNTLE--YFATHEDSRNPAIR---PHGSF  1267

>PYIR_15309
Length=937

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
             EGYVTKRGH  ++W+ RF  LEG+NL  SYYES+ 
Sbjct  147  WEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  180

>PYIW_13172
Length=939

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            EGYVTKRGH  ++W+ RF  LEG+NL  SYYES+ 
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  182

>PYAP_17290
Length=835

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
             EGYVTKRGH  ++W++RF  LEG+NL  SYYE++ 
Sbjct  152  WEGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKV  185

>PYIW_21108
Length=2593

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 62/130 (48%), Gaps = 8/130 (6%)

Query  6     VPEIGATASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVLEGSNLQISYYESRAACHPPA  64
             + +   ++ G  A+    EGYV  R HF  + WR RF VLEG+ L + Y +S AA     
Sbjct  2139  ISQSAKSSGGASAKRDQFEGYVRVRHHFLGAIWRERFAVLEGTRLLL-YTDSSAAMDEDR  2197

Query  65    AEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNK  124
                +  K    L ++E           +G  FGF++   A   GY+E    V T+ ++ K
Sbjct  2198  ERTALEKHD--LIAVEKWHPTYSANLGSGSRFGFRVENEA--GGYLECT--VTTEDEQTK  2251

Query  125   WLEVARNALS  134
             WL V  +A+S
Sbjct  2252  WLAVVSDAVS  2261

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 29/65 (45%), Gaps = 4/65 (6%)

Query  10    GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSA  69
             G +  G   R    EGY+ KRGH   S R R+ VL   N  + Y+ +      PA     
Sbjct  1220  GDSQPGGGLREALMEGYLVKRGHLIPSMRKRYCVLL-KNASLEYFATHEDSRNPAIR---  1275

Query  70    PKGSF  74
             P GSF
Sbjct  1276  PHGSF  1280

>PYAR_19914
Length=788

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            EGYVTKRGH  ++W+ RF  LEG+NL  SYYE++ 
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKV  178

>CCI41225
Length=981

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            EGYVTKRGH  ++W++RF  LEG+ L  SYYES+ 
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESKV  172

>PYVX_13574
Length=950

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            EGYVTKRGH  ++W++RF  LEG NL +SYYES+ 
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYESKV  191

>H257_06721
Length=1238

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
            G   +P +C GY+TK+GH RKSW+ R+ VL GS L  SYY
Sbjct  224  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  261

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (54%), Gaps = 11/63 (17%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK-GSFYLSSIEP  81
           C GY+TKRGH   +W++R+ VL   +  +SYYE          E  A K G  +L+ + P
Sbjct  14  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYED---------ESMAKKLGQVHLAKVAP  63

Query  82  HEY  84
            EY
Sbjct  64  WEY  66

>H310_00230
Length=1248

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 53/122 (43%), Gaps = 21/122 (17%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSF  74
            G   +P +C GY+TK+GH RKSW+ R+ VL G+ L  SYY             SA K   
Sbjct  218  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYYTDYE---------SANKQCL  266

Query  75   YLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                IE       V    G+  GF          Y    V+ +T+ +R KWL   +  L 
Sbjct  267  AEVGIE------DVQVWDGEMHGFMFTTTEQVMYY----VYADTERERQKWLVALKALLD  316

Query  135  AK  136
            A+
Sbjct  317  AQ  318

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 9/62 (15%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
           C GY+TKRGH   +W++RF VL   +  +SYYE  +         S   G  +L+ + P 
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYEDESM--------SKKLGQVHLAKVAPW  62

Query  83  EY  84
           EY
Sbjct  63  EY  64

>PHALS_06533
Length=930

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 8/56 (14%)

Query  9    IGATASGDKARPT------SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            +  T  GD+A  +        EGYVTKRGH  ++W++RF  LEG NL +SYYE++ 
Sbjct  90   MSVTMGGDQAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  143

>PHYCA_503112
Length=214

 Score = 47.0 bits (110),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            EGYVTKRGH  ++W+ RF  LEG NL +SYYE++
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEG-NL-VSYYENK  148

>CCA16487
Length=975

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            EGYVTKRGH  ++W++RF  LEG+ L  SYYE++ 
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKV  170

>PITG_18067
Length=924

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 8/54 (15%)

Query  11   ATASGDKARPT------SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            + +SGD A  +        EGYVTKRGH  ++W++RF  LEG NL +SYYE++ 
Sbjct  90   SMSSGDNAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PPTG_13401
Length=927

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 8/54 (15%)

Query  11   ATASGDKARPT------SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            + +SGD A  +        EGYVTKRGH  ++W++RF  LEG NL +SYYE++ 
Sbjct  90   SMSSGDNAVESLDLPMVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PHYRA_77834
Length=936

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            EGYVTKRGH  ++W++RF  LEG NL +SYYE++ 
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  151

>CCI42457
Length=906

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            EGYV KRGH  ++W++RF  LEG+  ++SYYES+ 
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESKG  162

>CCA17102
Length=884

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            EGYV KRGH  ++W++RF  LEG+ L  SYYES+ 
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESKG  142

>PYIR_18382
Length=1154

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 57/124 (46%), Gaps = 20/124 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +S + P  
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEE----ARSARNLRGRMIISKVRPEN  182

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS--AKRQLTR  141
            Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+    K  L  
Sbjct  183  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSLNG  230

Query  142  QAID  145
             ++D
Sbjct  231  SSVD  234

>PHYSO_544598
Length=1163

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   +S + P  
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEE----ARSARNLRGRMIISKVRPEN  72

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+
Sbjct  73   Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAI  110

>PYU1_G008848
Length=765

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/127 (26%), Positives = 58/127 (46%), Gaps = 20/127 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +S + P  
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEE----ARSARNLRGRMIISKVRPEN  187

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS--AKRQLTR  141
            Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+    K  +  
Sbjct  188  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSVNG  235

Query  142  QAIDQSV  148
             ++D  V
Sbjct  236  NSMDSDV  242

>PHYRA_82543
Length=1199

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/147 (24%), Positives = 66/147 (45%), Gaps = 26/147 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   +S + P  
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEE----ARSARNLRGRMIISKVRPEN  114

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTR--  141
            Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+    + T+  
Sbjct  115  Y--------GKAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQAAIEEGVRHTQSS  162

Query  142  ------QAIDQSVSSNKKNLFGFGVSL  162
                  +A+    S  + +L GF ++ 
Sbjct  163  MSMEGMEALQMQSSPTQVDLRGFYLAF  189

>PPTG_19371
Length=1195

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 58/133 (44%), Gaps = 18/133 (14%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            M+ L V    A+           EGYV K+G +   W  R+L+L+G+ L  +YY S+   
Sbjct  48   MDDLLVDSSTASTPAAMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEE-  104

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
               A      +G   +S + P  Y        GK  GF +      +G+    +   T+ 
Sbjct  105  ---ARSARNLRGRMIISKVRPENY--------GKAHGFLI----ETQGHKHFHLCCTTEL  149

Query  121  DRNKWLEVARNAL  133
            +++ W+E+ + A+
Sbjct  150  EKDMWVEMMQAAI  162

>SDRG_12762
Length=1392

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 2/38 (5%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
            K  P +C G++TK+GH RKSW+ R+ VL G+ L  SY+
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYF  389

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
            P  CEGY+TKRGH   S+R+R+ V+ GS   + YY    A
Sbjct  255  PVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  292

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
            GY+TKRGH   +W+ RF  L  S  ++SYY
Sbjct  164  GYLTKRGHVITNWKTRFFALR-SQGRLSYY  192

>CCA18023
Length=1138

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +  + P  
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEE----ARSARNLRGKMMIVKVRPEN  178

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  179  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  216

>PYAR_15463
Length=1091

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVL+G+ L  +YY S+      A      +G   +S + P  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEE----ARSGRNLRGRMIISKVRPEN  131

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  132  Y--------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAI  169

>CCI10489
Length=777

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 4/51 (8%)

Query  7    PEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            PE+  T   +    T  EGY+ KRGH  +SWR RF VL G+ L  SYY S+
Sbjct  92   PEVNHTF--EDMFKTDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSK  138

>PYAP_18636
Length=1009

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 65/149 (44%), Gaps = 26/149 (17%)

Query  13   ASGDKARPTSC------EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAE  66
            ASG    PT        EGYV K+G +   W  R+LVL+G+ L  +YY ++      A  
Sbjct  86   ASGATDAPTGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEE----ARS  139

Query  67   PSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                +G   +S + P  Y        GK  GF +       G+    +   T+ +++ W+
Sbjct  140  GRNLRGRMIISKVRPENY--------GKAHGFLL----ETMGHKHFHLCCSTELEKDMWV  187

Query  127  EVARNALS--AKRQLTRQAIDQSVSSNKK  153
            E+ + A+    K +L R  I  +  +N +
Sbjct  188  EMMQAAIDEGVKHKLERSLISSADVANAQ  216

>PYIW_16987
Length=821

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +S + P  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEE----ARSARNLRGRMIISKVRPEN  173

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  174  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  211

>CCI46235
Length=1155

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +  + P  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEE----ARSARNLRGKMMIVKVRPEN  173

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  174  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  211

>H257_03361
Length=699

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 7/60 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
           +G++ K+G    SW+ R+LVL G N  ISY++ +   +P A E    KGSF L+ ++P++
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPRAKE----KGSFVLAGVQPNK  63

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (66%), Gaps = 3/38 (8%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            RPT   G++ K+G   +SW+ R+ VL G N  I+Y+++
Sbjct  207  RPTYT-GWLDKQGEIVQSWKQRYFVLRGRN--IAYFDT  241

>PITG_19213
Length=1201

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   ++ + P  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEE----ARSARNLRGRMIINKVRPEN  124

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+
Sbjct  125  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAI  162

>PYVX_13312
Length=1016

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/158 (26%), Positives = 68/158 (43%), Gaps = 33/158 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   LS + P  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDE----ARSGRNLRGRMQLSRVRPEN  129

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL----------  133
            Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+          
Sbjct  130  Y--------GKAHGFLI----ETRGHKSFHLCCTTELEKDMWVEMMQAAIDDHDAAHGNA  177

Query  134  ---SAKRQLTRQAID--QSVSSNKKNLFGFGVSLSPQP  166
               S  R ++  +ID   + SS      G  V+ SP P
Sbjct  178  VLTSRHRGVSAGSIDLGSATSSAAGGSVGGTVAPSPPP  215

>PITG_11303
Length=293

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  245

>SDRG_01407
Length=815

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 18/119 (15%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSF  74
            G  A     EGYV K+G +   W  R+LVL+G++L  +YY ++      A      +G  
Sbjct  76   GPPAHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDE----ARSGRNLRGRM  129

Query  75   YLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
             ++ + P  Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  130  IITRVLPENY--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  176

>SPRG_05449
Length=723

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 12/80 (15%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE--  80
             EG+V+K+GH  ++W++R+  LE SNL +SYYES+      A +    KG  +L+ ++  
Sbjct  65   WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESKE----DARKRRHLKGRVHLTRVQII  118

Query  81   ----PHEYVVGVMGAAGKPF  96
                 H Y        GKPF
Sbjct  119  EGKSAHGYDFTFDTQEGKPF  138

>SPRG_00890
Length=883

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVL+G++L  +YY ++      A      +G   ++ + P  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDE----ARSGRNLRGRMIITRVLPEN  84

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  85   Y--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  122

>H257_03093
Length=975

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVL+G++L  +YY S+      A   +  +G   ++ + P  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDE----ARTGTNLRGRMIITKVLPEN  157

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +       G+    +   T+ +++ W+E+ + A+
Sbjct  158  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  195

>PHYSO_343629
Length=977

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISY  53
            EGYVTKRGH  ++W++RF  LEG+ +  ++
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>H310_06378
Length=837

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            EG+V K+GH  ++W+VR+  LEG NL +SYYE++
Sbjct  58  WEGFVQKKGHLVRNWKVRYFTLEG-NL-LSYYETK  90

>H257_13567
Length=836

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            EG+V K+GH  ++W+VR+  LEG NL +SYYE++
Sbjct  60  WEGFVQKKGHLVRNWKVRYFTLEG-NL-LSYYETK  92

>SDRG_08800
Length=881

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            EG+V+K+GH  ++W++R+  LE SNL +SYYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>H310_04843
Length=968

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVL+G++L  +YY S+      A      +G   ++ + P  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEE----ARTGKNLRGRMIITRVLPEN  156

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +       G+    +   T+ +++ W+E+ + A+
Sbjct  157  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  194

>PITG_17893
Length=747

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 16/119 (13%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y + ++C       +  KG   
Sbjct  212  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSC-------AKLKGEVL  261

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            L   +   + V V  A G+   F + +G      Y  L    + + DR  W+    +AL
Sbjct  262  LFHPQTRVHYVDVHVAGGRDASFAIQVG----PDYTLLLQAAQLR-DRENWMYCIEDAL  315

>PHYSO_556164
Length=765

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 58/132 (44%), Gaps = 16/132 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y + ++C       S  KG   
Sbjct  214  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSC-------SKLKGEVL  263

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
            L   +   + V V  A G+   F + +G      Y  L    + + DR  W+    +AL 
Sbjct  264  LFHPQTRVHYVDVHVAGGRDASFAIQVG----PDYTLLLQAAQLR-DRENWMYCIEDALL  318

Query  135  AKRQLTRQAIDQ  146
             +     Q + +
Sbjct  319  CRDSYHPQGMTE  330

>PHYKE_6662
Length=765

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EG+V K+G +   W  R+L+L+G+ L  +YY S+      A      +G   +  + P  
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEE----ARSARNLRGRMIIVKVRPEN  125

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+
Sbjct  126  Y--------GKAHGFLI----ETQGHKHFHLCCSTELEKDMWVEMMQAAI  163

>PHALS_04098
Length=1183

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 66/141 (47%), Gaps = 24/141 (17%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   +  + P  
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEE----ARSARNMRGRMTVYKVRPEN  128

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS--AKRQLTR  141
            Y        GK  GF +   + K    +  +   T+ +++ W+E+   A+   A+++ +R
Sbjct  129  Y--------GKAHGFLLETQSHK----QFHLCCATELEKDMWVEMMHAAVEEGARQRNSR  176

Query  142  QAID----QSVSSNKKNLFGF  158
             +++      +S  + +L GF
Sbjct  177  LSVEGMEILQISPTQVDLRGF  197

>CCA21715
Length=782

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 4/51 (8%)

Query  7    PEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            PE+  T   ++   T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  94   PEVSHTF--EELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>CCA21860
Length=782

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 4/51 (8%)

Query  7    PEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            PE+  T   ++   T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  94   PEVSHTF--EELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>PYVX_18338
Length=746

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (5%)

Query  14   SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            S + A  T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  72   SIEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  113

>PPTG_04553
Length=904

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 16/119 (13%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y + ++C       +  KG   
Sbjct  355  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYADSSC-------TKLKGEVL  404

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            L   +   + V V  A G+   F + +G      Y  L    + + DR  W+    +AL
Sbjct  405  LFHPQTRVHYVDVHVAGGRDASFAIQVG----PDYTLLLQAAQLR-DRENWMYCIEDAL  458

>CCI39367
Length=2046

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 55/119 (46%), Gaps = 27/119 (23%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++ K+GH  KSWRVRF VL  ++  ++YY  R             KG      I+ +E 
Sbjct  86   GWLRKQGHLWKSWRVRFFVLY-TDGTLAYYRKRGDV--------KMKG-----YIKLNEG  131

Query  85   VVGVM----GAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQL  139
            ++G+         + + F++     +KG+  L    +TQ +   W+ V R+     RQL
Sbjct  132  IIGIQYIDAWKTNRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVSVLRST----RQL  181

>PHYSO_344112
Length=813

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYCA_506137
Length=810

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PYIW_18480
Length=755

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
           T  EGYV K+GH  +SWR R+ +L G+    SYY S+
Sbjct  50  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  84

>PPTG_05519
Length=810

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYRA_79281
Length=809

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  134

>PITG_02762
Length=810

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>HYAP_08026
Length=798

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  122

>SDRG_05567
Length=980

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 36/145 (25%), Positives = 59/145 (41%), Gaps = 24/145 (17%)

Query  13   ASGDKARPTS-------CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAA  65
            AS   A+PT+         GY++KRG +RK+W+ R+ +L   +  + Y +S         
Sbjct  118  ASSSVAQPTTFTENDIHMAGYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQ  177

Query  66   EPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKW  125
             P  P      +SI          G    PF F++  H P++    L +   T  +  KW
Sbjct  178  VPITPNTRVIDNSI----------GCQKAPFYFEV--HTPRR---VLYLGAGTVQEHRKW  222

Query  126  LEVARNA--LSAKRQLTRQAIDQSV  148
            +   R    L   R++    + QS 
Sbjct  223  IRSIRETVELVRSREIGENYVTQSC  247

>PYAP_22646
Length=815

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  +SWR R+ +L G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISK  134

>PHYKE_5678
Length=809

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G  +  SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSG--VTFSYYVSK  134

>PYIW_19873
Length=185

 Score = 39.7 bits (91),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 59/123 (48%), Gaps = 9/123 (7%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACH--PPAAEPSAPKGSFYLSSIEP  81
            EG++ K+GH  ++ + R+ VL    L  SY+ ++       PA  PS+ KG   L+  + 
Sbjct  56   EGFLVKKGHVLRTQKERYFVLRAHTL--SYFRAKWGEKKGKPAMLPSSLKGVLELAPSD-  112

Query  82   HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTR  141
               +V     + + F  + +  A  K Y +LD+ V    +R +W++  R A      L +
Sbjct  113  ---IVTPAPHSDQWFRIQKLPDAGGKSY-KLDLKVANAEERQEWIDAIRGACRNTLLLKQ  168

Query  142  QAI  144
            QA+
Sbjct  169  QAM  171

>SPRG_06021
Length=983

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 47/113 (42%), Gaps = 15/113 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            GY++KRG +RK+W+ R+ +L   +  + Y +S          P  P      +SI     
Sbjct  139  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQVPITPNTRVIDNSI-----  193

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKR  137
                 G    PF F++  H P++    L +   T  +  KW+   R  +   R
Sbjct  194  -----GCQKAPFYFEV--HTPRR---VLYLGASTVQEHRKWIRSIRETVELVR  236

>PYU1_G004386
Length=837

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            D    T  EGY+ K+GH  +SWR R+ +L G+    SYY S+
Sbjct  131  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  170

>PHYRA_73535
Length=875

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 53/118 (45%), Gaps = 14/118 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y +  +C       +  KG   
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSC-------AKLKGEVL  382

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            L   +   + V V  A G+   F  I   P+  Y  L    + + DR  W+    +AL
Sbjct  383  LFHPQTRVHYVDVHVAGGRDASFA-IQVGPE--YTLLLQAAQLR-DRENWMYCIEDAL  436

>H257_09028
Length=556

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 23/119 (19%)

Query  18   ARPTSCEGYVTKRGHFRKS--WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
            A PT C GYV  + H + S  W+ R+ VL+ ++L I +Y++       AA     KG   
Sbjct  17   AVPTLCTGYVYNQ-HEKNSIIWKKRYCVLQENSLYIFHYDNAE-----AATQGELKGKIP  70

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKMIGHAP-KKGYVELDVFVETQGDRNKWLEVARNAL  133
             SS+   E         GKP GF+   + P  K Y    V+ +T+ ++ KW+   +  L
Sbjct  71   YSSVHDWE---------GKPHGFQF--YTPTNKCY---KVYTDTEEEKLKWVSTMQKQL  115

>H257_03931
Length=695

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 54/118 (46%), Gaps = 14/118 (12%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSF  74
             D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S       ++E + P+G  
Sbjct  103  SDFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGT-----SSEETFPRGVI  155

Query  75   YLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
             LS ++ H           K F F+ I H     Y  L +  + + D  +WL   ++A
Sbjct  156  SLSGVDVHPLDTAKF---KKQFCFE-ISHP---NYRSLYMVAKNEADLVQWLSSIKSA  206

>PHALS_06699
Length=884

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 55/134 (41%), Gaps = 16/134 (12%)

Query  12   TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK  71
            T++ D A   S  G++ KRGH  K+W+ R+ VL  S L+   Y S A C       +  K
Sbjct  325  TSAFDDAFLDSMSGWLRKRGHVCKNWKDRYFVLHKSVLR---YYSDACC-------TKLK  374

Query  72   GSFYLSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
            G   L   +   + V V    G+   F + +G         L +  E   DR  W+    
Sbjct  375  GEVLLFHPQTCVHYVDVHVTGGRDASFAIQVG-----SEYTLLLQAERLSDRENWMYCIE  429

Query  131  NALSAKRQLTRQAI  144
            +AL  +     Q +
Sbjct  430  DALLCRDSYQNQQV  443

>PHALS_03645
Length=830

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            D    T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  96   DDIFETDWEGYIWKQGHVVRSWRYRYAVLSGT--IFSYYVSK  135

>PPTG_14630
Length=398

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           G+V K+G   K+W+ RF+VL G   Q++YY++      P  +   PKGSF + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDTSKLV--PTVK---PKGSFQVITVE  60

>SPRG_17022
Length=107

 Score = 37.7 bits (86),  Expect = 0.016, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PPTG_16044
Length=1378

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 23/112 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++TK+GH  KSW+ RF VL  S+   +YY+++             KG   L+     + 
Sbjct  139  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGR--------KKIKGCMQLN-----DG  184

Query  85   VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            VV V    +  AGK + F++     +KG+ +L  +  +Q +   W+   R+ 
Sbjct  185  VVSVQHVDIRVAGKAYVFQI-----QKGFYKLLCYCCSQFEAELWVAALRSV  231

>PHYRA_73534
Length=1210

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
            D A   S  G++ KRGH RK+W+ R+ VLE S L+  YY
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR--YY  369

>PITG_02109
Length=522

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
            G+V K+G   K+W+ RF+VL G   Q++YY++ +  +P       PKGSF + ++E
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLNPTV----KPKGSFQVITVE  186

>PITG_03318
Length=1343

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 23/112 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++TK+GH  KSW+ RF VL  S+   +YY+++             KG   L+     + 
Sbjct  139  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGR--------KKIKGCMQLN-----DG  184

Query  85   VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            VV V    +  AGK + F++     +KG+ +L  +  +Q +   W+   R+ 
Sbjct  185  VVSVQHVDIRVAGKAYVFQI-----EKGFYKLLCYCCSQFEAELWVAALRSV  231

>SPRG_14312
Length=661

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 18/119 (15%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
            D   P S  G + K+ +  K+W+ RF+VL G +L   YY S A     A+E S PKG   
Sbjct  104  DFYAPLSRSGVLVKQANHLKNWKKRFMVLRGQSL--FYYVSGA-----ASEDSYPKGLIS  156

Query  76   LSSIEPHEYVVGVMGAA--GKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            L  +E     V ++  A   K F F++        Y  L +  + + D  +W+   ++A
Sbjct  157  LVGVE-----VQLVDVARFKKQFCFEL----SHPYYRPLYLMAKNEADLTQWMSCIKSA  206

>PYIR_13120
Length=814

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  +SWR R+ +L G+    SYY S+
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  138

>PYAR_19883
Length=833

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            T  EGY+ K+GH  ++WR R+ +L G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISK  134

>H310_07070
Length=680

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 53/118 (45%), Gaps = 14/118 (12%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSF  74
             D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S        +E + P+G  
Sbjct  113  SDFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGT-----TSEETYPRGVI  165

Query  75   YLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
             LS ++ H   V       K F F+ I H     Y  L +  +   D  +W+   ++A
Sbjct  166  SLSGVDVHPLDVSKF---KKQFCFE-ISHP---NYRSLYMVAKNDADLVQWMSSIKSA  216

>PHALS_05587
Length=1361

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 53/112 (47%), Gaps = 23/112 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++ K+GH  KSW+ RF VL  S+  + YY++++            KG  +L+     + 
Sbjct  139  GWLKKQGHMWKSWKARFFVL-FSDGTVVYYKNKS--------RKKIKGYMHLN-----DG  184

Query  85   VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            VV V    +  AGK + F++     +KG+  L     +Q D   W+   R+ 
Sbjct  185  VVSVQHVDIRVAGKAYVFQI-----EKGFYRLLCHCSSQIDAELWVTALRSV  231

>SPRG_09211
Length=549

 Score = 39.7 bits (91),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 43/90 (48%), Gaps = 18/90 (20%)

Query  37   WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
            W+ R+ VL+ S L I YYES  A    AAE S  KG     S+  H++        GKP 
Sbjct  34   WKRRYCVLQESALAIFYYESEEA----AAEGSL-KGKIPYCSV--HDW-------DGKPH  79

Query  97   GFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
            GF+      K       V+ ++  +RNKW+
Sbjct  80   GFQFYTPTNKC----FRVYCDSDDERNKWM  105

>SDRG_14771
Length=549

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 43/90 (48%), Gaps = 18/90 (20%)

Query  37   WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
            W+ R+ VL+ S L I YYES  A    AAE S  KG     S+  H++        GKP 
Sbjct  34   WKRRYCVLQESALAIFYYESEEA----AAEGSL-KGKIPYCSV--HDW-------DGKPH  79

Query  97   GFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
            GF+      K       V+ ++  +RNKW+
Sbjct  80   GFQFYTPTNKC----FRVYCDSDDERNKWM  105

>SPRG_09128
Length=620

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 58/130 (45%), Gaps = 14/130 (11%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++ K GH RKSW+ RF VL+GS LQ  YY    +      +    KG   L   +   +
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YYTDDVS----KVKTPKLKGEVLLFHKDTTVH  321

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQAI  144
                  AAG+ F F     A   G   L +   ++ DR  W+    +A+  +   +  A+
Sbjct  322  YAD-EPAAGRAFCF-----AIDAGAYSLLLQAASERDREAWIYAIEDAILCRDSYS--AL  373

Query  145  DQSVSSNKKN  154
            D   + ++++
Sbjct  374  DDQAADDRRS  383

>H257_09823
Length=654

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 2/52 (4%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL  76
            G++ K GH RK+W+ RF VL+GS LQ  Y+        P ++    KG   L
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ--YFTDDVDATTPKSKTHKLKGEVLL  314

>PYU1_G009249
Length=2580

 Score = 40.0 bits (92),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (53%), Gaps = 5/57 (9%)

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPS-APKGSFYLSSI  79
             EGY+ KRGH   S R R+ VL      + YY    A H  +  PS AP GSF + ++
Sbjct  1179  EGYLVKRGHLIPSMRKRYCVLLKRGNTLEYY----ATHEDSRNPSVAPHGSFRVDTV  1231

 Score = 39.3 bits (90),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 59/124 (48%), Gaps = 14/124 (11%)

Query  25    GYVTKRGHFRKS-WRVRFLVLEGSNLQISYYESRAACHPPA--AEPSAPKGSFYLSSIEP  81
             GYV  R HF  + WR RF+VL G++  + Y +S AA           A +    ++  + 
Sbjct  2101  GYVRVRHHFLGAIWRERFMVLHGTSAYL-YPDSSAATEDDEQLERKKALEKHNLVAIAKW  2159

Query  82    HEYVVGVMGAA---GKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEV---ARNALSA  135
             H   V   G+A      +GF++   A   GY+E    V T+ ++ +W++    A  ALSA
Sbjct  2160  HPTYVSTFGSAHSSSNRYGFRVENEA--GGYLE--CIVATEQEQTQWMKTISDAVTALSA  2215

Query  136   KRQL  139
               QL
Sbjct  2216  SSQL  2219

>PYIR_13168
Length=1353

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 53/112 (47%), Gaps = 23/112 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++TK+GH  K+W+ RF VL       +YY+++             +G   L     ++ 
Sbjct  116  GWLTKQGHMWKTWKTRFFVLYADG-TFAYYKNKG--------KKKMQGCLML-----NDG  161

Query  85   VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            +V V    +   GKP+ F++     +KG+ +L  +  +Q +   W+   R+A
Sbjct  162  IVTVKHVDVRKIGKPYVFQV-----EKGFYKLICYCCSQLEAELWVSALRSA  208

>PYIW_20891
Length=291

 Score = 38.9 bits (89),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           G+V K+G   ++W+ RFLVL G   Q++YY++ A+  P   E    KGSF + ++E
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGK--QLTYYDT-ASLTPKTKE----KGSFQVITVE  57

>SPRG_02752
Length=831

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 37/57 (65%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           EG++ K+G    +W+ R++VL+G +  I+YY+ +   +P A E    KG+F L+++E
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVTNPRAKE----KGTFTLAAVE  56

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
            G++ K G   KSW+ RF VL G++L  +YY+
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>SDRG_14487
Length=964

 Score = 39.7 bits (91),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 38/59 (64%), Gaps = 7/59 (12%)

Query  22  SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           + EG++ K+G    +W+ R++VL+G +  I+YY+ +   +P A E    KG+F L+++E
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVSNPRAKE----KGTFTLAAVE  56

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
            G++ K G   KSW+ RF VL G++L  +YY+
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>SPRG_16312
Length=261

 Score = 38.9 bits (89),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 31/60 (52%), Gaps = 9/60 (15%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
           P    GYV K+G F K+W+ RF+VL    L   YY S  A        + P+G F ++S+
Sbjct  38  PPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAM-------AKPRGFFRVTSV  88

>PHALS_03540
Length=904

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 8/79 (10%)

Query  4   LRVPEIGATASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACH  61
           L+       A+G  AR + C+  G+  K+G   KSW+ RF VL+G  L   Y+E R+   
Sbjct  23  LKATSRNVIAAGRVARSSYCDHSGWGYKQGSIIKSWKRRFFVLKGREL--IYFEERS---  77

Query  62  PPAAEPSAPKGSFYLSSIE  80
            P+ +    KG   +S +E
Sbjct  78  -PSGKGIDEKGRLRISGVE  95

 Score = 38.5 bits (88),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 57/133 (43%), Gaps = 25/133 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            P  C G++ K G   K+W+ R+  L G+ L   Y++S               G+   S  
Sbjct  783  PVVCSGWLRKEGGTVKNWKRRYFTLHGATL--CYFKS-------------DNGALLRSFT  827

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQL  139
              H     V+    K    ++     +K    L V  ETQ D ++WL+    A++A++Q 
Sbjct  828  VCH-----VVTLRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAIAAEKQ-  877

Query  140  TRQAIDQSVSSNK  152
             +Q  D S  +N+
Sbjct  878  KKQNTDSSQWTNE  890

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            CEG++ KRG     W+ R+ +L+G  LQ
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>HYAP_04457
Length=1203

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 30/133 (23%), Positives = 56/133 (42%), Gaps = 18/133 (14%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            M+ + +    A+ S         EGYV K+G +   W  R+L+L+G  L  +YY S+   
Sbjct  39   MDDMLMDSSSASTSAVMTHEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKED-  95

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
               A      +G   L  + P  Y        GK  GF +      + +    +   ++ 
Sbjct  96   ---ARSARNLRGRMLLLKVRPENY--------GKAHGFFL----ETQSHKHFHLCCSSEL  140

Query  121  DRNKWLEVARNAL  133
            +++ W+E+ + A+
Sbjct  141  EKDMWVEMMQAAI  153

>SDRG_05150
Length=787

 Score = 39.3 bits (90),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>H310_12448
Length=555

 Score = 39.3 bits (90),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 57/127 (45%), Gaps = 23/127 (18%)

Query  9    IGATASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
            I  TAS   A P+ C GYV  +       W+ R+ VL+ ++L I +Y+S       AA  
Sbjct  10   IAKTAS--TAVPSLCTGYVYNQPEKNSIIWKKRYCVLQENSLYIFHYDSAE-----AAAK  62

Query  68   SAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAP-KKGYVELDVFVETQGDRNKWL  126
               KG    SS+   E         GKP GF+   + P  K Y    V+ +T+ ++ KW+
Sbjct  63   GELKGKIPYSSVHDWE---------GKPHGFQF--YTPTNKCY---KVYTDTEDEKVKWI  108

Query  127  EVARNAL  133
               +  L
Sbjct  109  ATMQKQL  115

>PHYCA_504801
Length=398

 Score = 38.9 bits (89),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           G+V K+G   K+W+ RF+VL G   Q++YY++ A  +P     +  KGSF + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVNP----TTKAKGSFQVITVE  60

>SPRG_08346
Length=797

 Score = 39.3 bits (90),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PYVX_23349
Length=924

 Score = 38.9 bits (89),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 48/113 (42%), Gaps = 16/113 (14%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
            S  G++ K GH RK+W+ R+ VLE S L+    ESR+            KG   L     
Sbjct  444  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRL----------KGEVLLFHPAT  493

Query  82   HEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              + V +  + G+   F + +G      Y  L +  E   DR  W+    +AL
Sbjct  494  RVHYVDIHLSGGRDNTFAIQVG----SDYTLL-LQAERLSDRENWMYCIEDAL  541

>CCI43793
Length=1117

 Score = 38.9 bits (89),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 71/180 (39%), Gaps = 30/180 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            GY+ K+G F KSWR RF +L      ++YY S+        E S    S  L +  P   
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKEHL-TKLGEISVDDQSVLLKT--PRN-  230

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGD-RNKWLEVARNALSAKRQLTRQA  143
                    G P  F  + HA +     L +F E   D  N W++  R +   + ++ R A
Sbjct  231  --------GIPHCFT-VKHAART----LIMFTEDGEDIMNTWMD--RISRCIRLRIDRNA  275

Query  144  IDQ--------SVSSNKKNLFGFGVSLSPQPLMTPQKQMQT--LTQNKDELLSGALRDIE  193
            I          SV+S +  L     ++   P   P  + Q   L  N    L GAL  +E
Sbjct  276  ITNTIMDREQSSVNSTESALILDTAAIRAHPKTHPSHKHQNVHLASNDSFRLLGALEQME  335

>PYU1_G010818
Length=169

 Score = 37.4 bits (85),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 56/112 (50%), Gaps = 9/112 (8%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAA--EPSAPKGSFYLSSIEP  81
            EG++TK+GH  ++ + R+ VL    L  SY+  + +     +  +PS  KG   L++ + 
Sbjct  62   EGFLTKKGHVLRTQKERYFVLRQHTL--SYFRVKQSEKKAKSVIQPSTLKGVLELTASD-  118

Query  82   HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               +V     + + F  + +  A  K Y +LD+   +Q +R +W++  R  +
Sbjct  119  ---IVTPAPHSDQWFRIQKLPDAEGKIY-KLDLKASSQTERQEWIDALRATI  166

>PHYKE_4911
Length=46

 Score = 34.7 bits (78),  Expect = 0.049, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
           G+V K+G   K+W+ RF+VL G   Q++YY++
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT  38

>PITG_02106
Length=1015

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 64/143 (45%), Gaps = 33/143 (23%)

Query  7    PEIGATAS-----GDK--ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
            PE  A +S     GD+  A    C G++ K G   KSW+ R+  L GS L  SYY+S   
Sbjct  653  PEYDAISSSSSEQGDQEAAAAQGCVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKS---  707

Query  60   CHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQ  119
                  E  +   S  + SIEPH  V           G  +  H+ +K  ++ D    + 
Sbjct  708  ------EKGSLLRSVSVVSIEPHPTV---------SLGLVVSTHSGRKLIMQAD----SN  748

Query  120  GDRNKWLEVARNALSA--KRQLT  140
             + ++WL   + A++   +R+LT
Sbjct  749  EEFDRWLSAIQGAVAGENERKLT  771

>PYU1_G003229
Length=810

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query  11   ATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
            AT +      T   G++ K+GH  KSW+ RF V+EGS   I+Y+E
Sbjct  388  ATVTSGSDSGTRKTGWLNKQGHRMKSWKRRFFVVEGST--ITYFE  430

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 61/129 (47%), Gaps = 25/129 (19%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
            AS D + P  C G++ K G   K+W++R+  L+G+ L  +Y++S              KG
Sbjct  693  ASLDDSLP-GCSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS-------------DKG  736

Query  73   SFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
               L +++    V  V+    K F  ++     +K    L +  +TQ + ++WL     A
Sbjct  737  PL-LKALK----VCYVLPMRTKKFCLEVTMETGRK----LLIAADTQAEHDRWLAALHQA  787

Query  133  LSAKRQLTR  141
            +SA+++  R
Sbjct  788  VSAEKEKDR  796

 Score = 35.0 bits (79),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 9/80 (11%)

Query  13  ASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAP  70
           A G  A+ T C+  G+ +K+G   KSW+ R+ VL+G  L   Y+  R+    P+ +    
Sbjct  17  AVGRVAKSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSERS----PSGKGINE  70

Query  71  KGSFYLSSIE-PHEYVVGVM  89
           KG   +  +E   E+  G++
Sbjct  71  KGRLKIVGVEFTPEFTNGLL  90

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            CEG++ KRG    +W+ RF  L G  LQ
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ  287

>H257_05175
Length=678

 Score = 38.5 bits (88),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 15/65 (23%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
           EG++TKR  H    W  R+ +LEGSNL+  YY+ R        +P+ P+G++ L+    +
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLT----N  47

Query  83  EYVVG  87
           E VVG
Sbjct  48  ECVVG  52

>PYIW_19613
Length=1314

 Score = 38.9 bits (89),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 33/71 (46%), Gaps = 7/71 (10%)

Query  53   YYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVEL  112
            ++E    CH    E  AP GS  LS+  P E     + AA   FG+K +  AP K  VE 
Sbjct  608  FFEHLGICHTVMPE-KAPDGSLRLSASSPDE---QALVAAAACFGYKFVARAPGKAMVE-  662

Query  113  DVFVETQGDRN  123
              +    GD++
Sbjct  663  --YFSCLGDQD  671

>H310_01921
Length=341

 Score = 38.1 bits (87),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 10/73 (14%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE-PHE  83
           G+V K+G   KSW+ R++VL+  N Q++Y+ES           S  KGSF + ++E  H+
Sbjct  24  GWVYKQGSMIKSWKKRYMVLK--NKQLTYFESE-----KVEGNSKAKGSFQVITVEIAHD  76

Query  84  YVVGVM--GAAGK  94
              G++  G  G+
Sbjct  77  IKNGLLVHGTGGR  89

>PYAR_26065
Length=314

 Score = 38.1 bits (87),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 4/60 (7%)

Query  52   SYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVE  111
            S++E  + CH    E  AP GS  LS+  P E     + AA   FG+K    AP K +VE
Sbjct  91   SFFEHLSVCHTVMPE-RAPDGSVRLSASSPDEQA---LVAAAACFGYKFSARAPGKAFVE  146

>HYAP_09304
Length=1144

 Score = 38.5 bits (88),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            GY+ K+G F KSWR RF +L      +SYY S
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  156

>PYAP_16734
Length=1314

 Score = 38.5 bits (88),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 52/113 (46%), Gaps = 16/113 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G +TK+G +R++W+ RF +L   +  + YY+S         E     G+  +SS      
Sbjct  181  GTLTKQGSWRRNWKTRFFLLRRDHPSLCYYKSE--------EKLELLGAIAVSS---DTL  229

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKR  137
            V+        P+ F++     + G   L +  ET+ ++ +W++  +  + A R
Sbjct  230  VLDKSAGGHAPYRFQL-----RTGDASLLLEAETRENQQRWMDACQELVDAVR  277

>PPTG_14626
Length=1055

 Score = 38.5 bits (88),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 49/116 (42%), Gaps = 32/116 (28%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLS----S  78
            C G++ K G   KSW+ R+  L GS L  SYY+S              KGS   S    +
Sbjct  714  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKSE-------------KGSLLRSVSVIN  758

Query  79   IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
            +EPH  V           G  +     +K    L V  E+ G+ NKWL   + A++
Sbjct  759  VEPHPSV---------SLGLTVSTVGGRK----LIVQAESNGEFNKWLNAIQEAVA  801

>CCA26890
Length=1530

 Score = 38.5 bits (88),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 17/112 (15%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL---SSIEP  81
            GY+ KRG   KS+R R++ L G+ L  SYY+ + +        + P+GS  L   +S++P
Sbjct  297  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENVTSLQP  354

Query  82   HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
             E       +  + +G  ++  +        ++  E + + ++WL+   NA+
Sbjct  355  LE-------SKTEKYGIVLVTTSRT-----WELVAENESEYHRWLKELCNAV  394

>H310_14473
Length=613

 Score = 38.1 bits (87),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 57/137 (42%), Gaps = 16/137 (12%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR----AACHPPAAEPSAPKGSFYLSSIE  80
            G + KRGH RK+W  RF VL    L+  YY       A C   + +P   +G   L+ I 
Sbjct  27   GILLKRGHLRKNWLTRFFVLTSGALR--YYRKPPGGGAKCTTWSVDPRYLRGELPLADII  84

Query  81   PHEYVVGVMGAAGKP----FGFKMIGHAP---KKGYVELDVFVETQGDRNKWLEVARNAL  133
              E        A  P    F   ++ H      +  V   +   T+ +R +W+ V R   
Sbjct  85   HVECDDSTPQPAYHPRTYRFTITVLRHRILFLVRRPVRFHLQATTEDERERWVRVLRE--  142

Query  134  SAKRQLTRQAIDQSVSS  150
              ++QL++  + +  S+
Sbjct  143  -PRKQLSKVTLPRHTSA  158

>HYAP_06101
Length=984

 Score = 38.1 bits (87),  Expect = 0.075, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 51/112 (46%), Gaps = 23/112 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++TK+GH  KSW+ RF VL       +YY+++             KG   L     ++ 
Sbjct  143  GWLTKQGHLWKSWKTRFFVLFADG-TFAYYKNKGR--------KKIKGCMQL-----NDG  188

Query  85   VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            VV V    +  A K + F++     +KG+ +L  +  +Q +   W+   R+ 
Sbjct  189  VVSVQHVDIRVAEKAYAFQI-----EKGFYKLLCYCCSQFEAEIWVAALRSV  235

>H257_02642
Length=975

 Score = 38.1 bits (87),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (55%), Gaps = 5/51 (10%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAP  70
           P   EGY+ KRG +   W    +VL+G  L++SYY+       P A+P AP
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYDRLDG---PPAKPHAP  72

>PITG_20103
Length=1301

 Score = 38.1 bits (87),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 53/126 (42%), Gaps = 18/126 (14%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
            R  S EGY++K+     SW+  + VLE   L  ++YE+R          S   G   L S
Sbjct  221  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETRED----FISNSKLIGRIQLQS  274

Query  79   IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQ  138
            IE  +         GKP GF++I       ++       T  ++ +W      A+S   +
Sbjct  275  IEDED--------MGKPNGFRVIAEGNHVNHLS----SRTTFEKEQWKRAISIAISKAPE  322

Query  139  LTRQAI  144
            +TR  +
Sbjct  323  VTRPYV  328

>CCA15513
Length=1341

 Score = 38.1 bits (87),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (45%), Gaps = 23/112 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G+++K+GH  K WR RF VL      ++YY  R             KG      I+ +E 
Sbjct  86   GWLSKQGHLWKGWRSRFFVLYADG-TLAYYRRRGNV--------KMKG-----YIKLNEG  131

Query  85   VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            ++G+    +    + + F++     +KG+  L    +TQ +   W+   R+A
Sbjct  132  IIGIQYIDVWKTSRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVNHLRSA  178

>HYAP_06403
Length=1037

 Score = 38.1 bits (87),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 31/66 (47%), Gaps = 4/66 (6%)

Query  52   SYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVE  111
            +++E  A CH    E  AP  S  LS+  P E     + AA   FG+K +  AP K  VE
Sbjct  101  AFFEHLAVCHTVMPE-KAPDNSLRLSASSPDEQA---LVAAAACFGYKFVARAPGKAMVE  156

Query  112  LDVFVE  117
                +E
Sbjct  157  YFCCIE  162

>H310_04667
Length=680

 Score = 38.1 bits (87),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 38/65 (58%), Gaps = 15/65 (23%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
           EG++TKR  H    W  R+ +LEGSNL+  YY+ R        +P+ P+G++ L+    +
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLT----N  47

Query  83  EYVVG  87
           E +VG
Sbjct  48  ECIVG  52

>SDRG_14286
Length=670

 Score = 38.1 bits (87),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
            G++ K GH RK+W+ RF VL+GS LQ  YY
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YY  304

>SDRG_00080
Length=298

 Score = 37.4 bits (85),  Expect = 0.090, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 39/73 (53%), Gaps = 11/73 (15%)

Query  9    IGATASGDKAR--PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAE  66
            + ++ SG++A   P +  GYV K+G F K+W+ R++VL    L   YY S  A       
Sbjct  57   LSSSRSGNEAPSGPPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERAT------  108

Query  67   PSAPKGSFYLSSI  79
             + P+G F ++ I
Sbjct  109  -TKPRGFFRVTGI  120

>SPRG_11900
Length=605

 Score = 37.7 bits (86),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 23/110 (21%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
            +P  C GY+ K+G   K+WR R+  ++G + Q+SY +         A+ + PKG      
Sbjct  234  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSD---------ADGAPPKG------  277

Query  79   IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEV  128
                 +VV V     +PF   +   + ++    L V   TQ + + WL V
Sbjct  278  ---FGHVVDVCVNTKRPFALYIHLASGRR----LAVAGSTQAEADTWLAV  320

 Score = 35.0 bits (79),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 7/56 (13%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            G+V K+G   KSW+ RFLV++G +  ++YY+ R+   P   E    KGS  L  +
Sbjct  6   SGFVFKQGALIKSWKKRFLVVQGRH--VTYYD-RSVHEPNPRE----KGSLVLVDV  54

>PHYRA_94409
Length=1270

 Score = 38.1 bits (87),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 75/162 (46%), Gaps = 28/162 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++TK+GH  KSW+ RF VL  S+   +YY+++             KG   L+     + 
Sbjct  113  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGR--------KKIKGCMQLN-----DG  158

Query  85   VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLT  140
            VV V    +  A K + F++     +KG+ +L  +  +Q +   W+     AL + R++T
Sbjct  159  VVSVQHVDVRVADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVA----ALRSVRRVT  209

Query  141  RQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQM-QTLTQNK  181
                +  +++ ++      V+     +    KQ+ ++L Q K
Sbjct  210  PPCYETDLTATEEKAGSNAVTRHLNKIFITDKQIAKSLVQFK  251

>PYU1_G012870
Length=352

 Score = 37.4 bits (85),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           G+V K+G   ++W+ RF+VL G   Q++YY++ A+  P   E    KGSF + + E
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGK--QLTYYDT-ASISPKTKE----KGSFQVITAE  55

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 32/65 (49%), Gaps = 9/65 (14%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
            D A      G++ K G   K+W+ R+  L G+ L  SYY+S       A   SA KG  +
Sbjct  145  DDAGSIHHSGWLKKEGSRIKNWKKRYFTLHGNTL--SYYDS-------ADTGSAAKGYGH  195

Query  76   LSSIE  80
            + S+E
Sbjct  196  VKSVE  200

>PYVX_14593
Length=964

 Score = 37.7 bits (86),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query  7    PEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            P+  AT S D  +   C G++ K+G    SW+ R+  L GS L+  YY+S
Sbjct  592  PDALATNSLDGGKLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKS  639

>PHYSO_478611
Length=522

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
            G+V K+G   K+W+ RF+VL G   Q++YY++ A   P        KGSF + ++E
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVDPTVKA----KGSFQVITVE  189

>PYVX_23432
Length=1510

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 4/60 (7%)

Query  53   YYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVEL  112
            ++E  A CH    E +A  GS  LS+  P E     + AA   FGFK +  AP K  VE 
Sbjct  578  FFEHLAVCHTVMPERAA-DGSLRLSASSPDE---QALVAAAACFGFKFVARAPGKAMVEF  633

>PPTG_21000
Length=1012

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (46%), Gaps = 18/112 (16%)

Query  25   GYVTKR---GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
            GY+ KR     +  SWR  F VL+G+ L+  +Y S+      A   +  +G  ++ SIEP
Sbjct  53   GYLRKRYSSSMYMGSWR--FCVLQGARLR--WYRSKEC----AETDTQLRGEVWVQSIEP  104

Query  82   HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
             +   G    A  P  F +   + K     L    ETQ DR+ WL+    AL
Sbjct  105  WD---GRTALATYPHAFAVRTTSKKL----LLCTAETQRDRDLWLQHLERAL  149

>SDRG_05608
Length=121

 Score = 35.4 bits (80),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 50/127 (39%), Gaps = 33/127 (26%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPP---------  63
            A  D A+P   EG +TKR  + K WR R+ VL+G+ L    Y  RA    P         
Sbjct  3    AVADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGMIDLSEC  57

Query  64   --------------AAEPSAPKGSFYL--SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKK  107
                            E + P+ ++Y+   S E  +  +G +G A   F     G     
Sbjct  58   LTVKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTG---DD  114

Query  108  GYVELDV  114
            GY E DV
Sbjct  115  GYDEEDV  121

>H310_06666
Length=887

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 2/44 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
           EGY+ K+G   K W+ R+ V +G +L  SYY S+    P A  P
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKLEKKPNAVIP  65

>SDRG_06288
Length=641

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 32/57 (56%), Gaps = 7/57 (12%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
             G+V K+G   KSW+ RFLV++G +  +SYY+ R+   P   E    KGS  L  +
Sbjct  5   WSGFVFKQGSLIKSWKKRFLVVQGRH--VSYYD-RSVHEPDPRE----KGSLVLGDV  54

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 26/45 (58%), Gaps = 3/45 (7%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPP  63
            +P  C G + K+G   K+WR R+  ++G + Q+SY  S A   PP
Sbjct  258  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSY--SDAETEPP  299

>PPTG_18989
Length=1213

 Score = 37.7 bits (86),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  219

>H257_03363
Length=316

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 10/73 (14%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE-PHE  83
           G+V K+G   KSW+ R++VL+  N Q++Y+E     +      S  KGSF + +IE  H+
Sbjct  8   GWVYKQGSMVKSWKKRYMVLK--NKQLTYFE-----NEKIEGNSKAKGSFQVITIEIAHD  60

Query  84  YVVGVM--GAAGK  94
              G++  G  G+
Sbjct  61  IKNGLLVHGTGGR  73

>H310_07701
Length=811

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
           T  EGYV K+GH  ++WR R+ +L G+    +YY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>H257_07514
Length=810

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
           T  EGYV K+GH  ++WR R+ +L G+    +YY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>PYAP_13695
Length=348

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           G++ K+G   K+W+ RF+VL G   Q++YY++     P   E    KGSF + ++E
Sbjct  12  GWIYKQGSLVKNWKRRFMVLRGK--QLTYYDTE-RISPRVKE----KGSFQVITVE  60

>H310_13627
Length=678

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 37/76 (49%), Gaps = 3/76 (4%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++ K+GH  K+W+ RF VL+GS L+  Y+        P +     KG   L   +   +
Sbjct  270  GWLYKQGHILKNWKRRFFVLDGSVLR--YFSEDVDATVPKSTTHKLKGEVLLFHKDTTVH  327

Query  85   VVGVMGAAGKPFGFKM  100
             V +   +G+ F F +
Sbjct  328  YVDI-HLSGRDFTFAI  342

>PYIR_24588
Length=909

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 14/109 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++ K GH RK+W+ R+ VLE S L+    ES A            KG   L       +
Sbjct  412  GWLRKLGHVRKNWKSRYFVLEKSVLRYYADESMARL----------KGEVLLFHPATRVH  461

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
             V +  + GK   F +  H  K   + L    +   DR  W+    +AL
Sbjct  462  YVDIHLSGGKDCTFAI--HVGKDYALLLQ--ADQLSDRENWMYCIEDAL  506

>PYIR_23372
Length=1415

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 16/84 (19%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
            S EGY+ K+    +SW+  + VLEG  +  +YYESR          S   G   +  +E 
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESREDF----ISNSKLMGRIQIQGVED  375

Query  82   HEYVVGVMGAAGKPFGFKMI--GH  103
                       GKP GF++I  GH
Sbjct  376  DN--------MGKPNGFRVITEGH  391

>PYAR_19291
Length=711

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            +N L +    A+   D    + C G++ K GH RK+W++R+ VLE S L+  YY   A
Sbjct  189  LNGLYLDHPTASPFDDTFLDSMC-GWLRKLGHVRKNWKMRYFVLEKSVLR--YYADEA  243

>PHYRA_81944
Length=1149

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  154

>CCI40991
Length=801

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGS  47
            T  EGY+ K+GH  +SWR R+ VL G+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGT  132

>PYIW_17571
Length=1330

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 47/113 (42%), Gaps = 16/113 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G +TK G +R++W+ RF +L      + YY S          P           I+P   
Sbjct  175  GTLTKEGSWRRNWKTRFFILRRDFPSLCYYTSEDKLELLGEIP-----------IQPDTM  223

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKR  137
            V+    A   P+ F++   A       L +  E++ ++ +W++  +  + A R
Sbjct  224  VLDRSAAGHAPYRFQVRSDAKT-----LLLEAESRDNQRRWIDSCQELVDAVR  271

>PYU1_G012859
Length=1183

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 5/56 (9%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            M++++ P    + S    +P    G++ K+GH  +SW+ R+ VL G +LQ  Y+E+
Sbjct  476  MDLVKAP---PSLSPSIVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN  526

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (58%), Gaps = 2/40 (5%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPP  63
            +G++ K G   K+W+ RF+VL G+ L  SYY       PP
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADETPSSPP  234

 Score = 33.5 bits (75),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (55%), Gaps = 2/51 (4%)

Query  5    RVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
            +V E     SG++      EG++ K+G   K+W+ R+ VLE S L   YY+
Sbjct  594  QVEETNLDNSGNRLGRLGQEGWLLKKGQNFKTWKQRYFVLERSRLM--YYD  642

 Score = 33.5 bits (75),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 26/119 (22%), Positives = 53/119 (45%), Gaps = 24/119 (20%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLS  77
            A  ++C G++ K+G   K+W+ R+  L G+ L+    E+ +              SF +S
Sbjct  806  ADQSNCHGWLNKQGGTIKTWKRRYFSLHGTTLRYFKRETGSMLR-----------SFTIS  854

Query  78   SIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
             +E    V           G +++  + +K    L +  E++ D  +WL   + ++SA+
Sbjct  855  HVEKQPQVA---------LGLEVMTTSGRK----LMLTAESKEDYGRWLRALQASISAE  900

 Score = 33.1 bits (74),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISY  53
            A   +CEG++ K+GH  K W+ R+  L    L+  +
Sbjct  354  ASSQTCEGWLLKQGHKSKRWKRRYFTLNNDMLEYRH  389

>PHALS_07930
Length=1200

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  215

>PYVX_14527
Length=1269

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
            G+V K+G   ++W+ RF+VL G   Q++YY++  A   P+ +    KGSF L ++E
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGR--QLTYYDT--ARLTPSVK---AKGSFTLITVE  951

 Score = 32.7 bits (73),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            G+V K G   +SW+ RFLV +G++L  +YY++
Sbjct  589  GWVFKEGSLVRSWKKRFLVAKGADL--AYYKN  618

>PYU1_G012274
Length=873

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 40/84 (48%), Gaps = 16/84 (19%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
            S EGY+ K+    +SW+  + VLEG  +  +YYESR          +   G  ++ S+E 
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESREDF----IMNTKLIGRIHIQSVED  363

Query  82   HEYVVGVMGAAGKPFGFKMI--GH  103
                       GKP GF+++  GH
Sbjct  364  DH--------MGKPNGFRILTEGH  379

>PHYSO_350197
Length=557

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 42/97 (43%), Gaps = 18/97 (19%)

Query  37   WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
            W+ R+ V+    LQI Y+ S         E  A +G    SS+   +         GKP 
Sbjct  42   WKKRYCVVYKDELQIVYFLSLEDF-----EKRAIRGKIPFSSVHAWD---------GKPN  87

Query  97   GFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            GF+   + P        V+ ET  D+ KWLEV + AL
Sbjct  88   GFQF--YTPSNNCFR--VYTETPEDQLKWLEVMQKAL  120

>SPRG_02753
Length=309

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (60%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           +G+V K+G   +SW+ R++VL+  N Q+SY+++        A     KGSF + +IE
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLK--NKQLSYFDTENVTASTKA-----KGSFAVITIE  56

 Score = 32.0 bits (71),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            C G++ K G   K+W+ RF  L+G +L  +YY++
Sbjct  138  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDN  169

>PYU1_G009508
Length=328

 Score = 36.6 bits (83),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            GY+ K+G + K+WR R+ +L      +SYY+S
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  197

>H310_06667
Length=896

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 26/44 (59%), Gaps = 2/44 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
           EGY+ K+G   K W+ R+ V +G +L  SY+ ++A   P A  P
Sbjct  37  EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKADKTPSAVIP  78

>H257_11786
Length=572

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 20/134 (15%)

Query  24   EGYVTKRG-HFRKSWRVRFLV-LEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
            EGY+ K+G  FR   +  F++ LE  ++ + YY S+ A    +  P  P  + Y  S+E 
Sbjct  61   EGYMLKQGSRFRMLTKRYFILRLEEKHMTLGYYTSKEALVLCSETPIGPGHALYDISVEG  120

Query  82   HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTR  141
            H  +                    + G   L V VET+ D  KW    + A+   + +  
Sbjct  121  HHRL------------------ELRHGTTSLIVEVETEADFVKWKNCLQEAVRWHQAMVF  162

Query  142  QAIDQSVSSNKKNL  155
               ++  S  KK L
Sbjct  163  DGANKVTSYGKKCL  176

>PYIR_15118
Length=1222

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            GY+ K+G F K+WR R+ +L      +SYY+S
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  224

>SDRG_14486
Length=308

 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (60%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           +G+V K+G   +SW+ R++VL+  N Q+SY+++        A     KGSF + +IE
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLK--NKQLSYFDTENVTASTKA-----KGSFAVITIE  56

 Score = 32.0 bits (71),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            C G++ K G   K+W+ RF  L+G +L  +YY++
Sbjct  137  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDN  168

>H310_00912
Length=2182

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 63/124 (51%), Gaps = 18/124 (15%)

Query  17    KARPTS---CEGYV-TKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
             +++P+S    EG+V  +R HF  +W+  + VL+G  L  + Y++R        +P++ + 
Sbjct  1787  QSQPSSEIFLEGFVHLRRSHFGAAWKEHYCVLKGPWL--ATYDTREDFATAPGKPTSKRE  1844

Query  73    SFYLSSIEPHEYVVGV-MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARN  131
               ++      ++  GV  G A   F  + I    + G+VE   +V+   D+ +W++  + 
Sbjct  1845  VVFVG-----DWYGGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQT  1893

Query  132   ALSA  135
             A+S+
Sbjct  1894  AVSS  1897

>PHALS_06336
Length=511

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 34/56 (61%), Gaps = 8/56 (14%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            ++I+++ E+G      +  P +  G+V K G   +SW+ RFLV +G+ L  +YY++
Sbjct  118  LSIIQIREMG------REDPATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  165

>SDRG_07086
Length=656

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 49/123 (40%), Gaps = 12/123 (10%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
            T  EGY+ KR  + K W   + VL G  L        A   P  ++     G+F  +S  
Sbjct  33   TRWEGYLQKRSDWLKQWEAYYFVLHGCALYCYLSADEAKRQPENSK--IKHGAFSFTSHV  90

Query  81   PHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFV--ETQGDRNKWLEVARNALSAKRQ  138
              ++VV + G     F F+     P        VF+  +TQ  +  W+ +A   +   R 
Sbjct  91   ILQHVVSIHGHGAFDFIFETSSGKP--------VFLRAKTQAMKTLWMAMAAQGIHDTRI  142

Query  139  LTR  141
             +R
Sbjct  143  DSR  145

>CCI47145
Length=390

 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 6/56 (11%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           G++ K+G   +SW+ R++VL+G   Q+SYY++         E    KGSF + ++E
Sbjct  39  GWIFKQGSLVRSWKKRYMVLKGR--QLSYYDTDNILSLKVKE----KGSFQVITVE  88

>PHYSO_489872
Length=1240

 Score = 37.0 bits (84),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 54/126 (43%), Gaps = 17/126 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G +TK+G +R++W+ RF +L      + Y+ S          P           I     
Sbjct  154  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEIP-----------ITEDTI  202

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQAI  144
            V+   G    PF F++   A       L +  E++ ++ +W+E  +    A R  ++ ++
Sbjct  203  VLDRSGGGHAPFRFQIRTDAQT-----LLLEAESRENQKRWIEACQELADAIRA-SKYSV  256

Query  145  DQSVSS  150
            + S+SS
Sbjct  257  NTSLSS  262

>PYIW_18911
Length=1196

 Score = 37.0 bits (84),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            GY+ K+G F K+WR R+ +L      +SYY+S
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  205

>PHALS_06568
Length=388

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 32/56 (57%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           G+V K+G   KSW+ R++VL G   Q++YY++         +   PKGS  + ++E
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGR--QLTYYDT-----AKVDQKVKPKGSCQVITVE  60

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 25/43 (58%), Gaps = 2/43 (5%)

Query  14   SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            S D +   +  G++ K G   KSWR RF VL G++L  SY+ S
Sbjct  142  SEDGSEQVTHSGWLKKEGARVKSWRRRFFVLRGNSL--SYFNS  182

>PHYRA_73430
Length=395

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           G+V K+G   ++W+ RF+VL G   Q++YY++ A   P        KGSF + ++E
Sbjct  12  GWVFKQGSLVRNWKKRFMVLRGR--QLTYYDT-AKVDPTVKA----KGSFQVITVE  60

 Score = 31.6 bits (70),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (56%), Gaps = 2/43 (5%)

Query  14   SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            S D +   +  G++ K G   KSW+ R+ VL G+ L  SY+ S
Sbjct  141  SDDGSEQVTHSGWIKKEGARVKSWKRRYFVLRGNAL--SYFNS  181

>PHYSO_248481
Length=1283

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 53/112 (47%), Gaps = 23/112 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++TK+GH  KSW+ RF VL  S+   +YY+++             KG   L+     + 
Sbjct  92   GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGR--------KKIKGCMQLN-----DG  137

Query  85   VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            VV V    +  A K + F++     +KG+ +L  +  +Q +   W+   R+ 
Sbjct  138  VVSVQHVDIRLADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVAALRSV  184

>CCA24531
Length=374

 Score = 36.2 bits (82),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 6/56 (11%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
           G++ K+G   +SW+ R++VL+G   Q+SYY++         E    KGSF + ++E
Sbjct  27  GWIFKQGSLVRSWKKRYMVLKGR--QLSYYDTDNILSLKVKE----KGSFQVITVE  76

>SPRG_02502
Length=121

 Score = 34.7 bits (78),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 49/125 (39%), Gaps = 33/125 (26%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPP-----------  63
             D A+P   EG +TKR  + K WR R+ VL+G+ L    Y  RA    P           
Sbjct  5    ADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGVIDLSECLT  59

Query  64   ------------AAEPSAPKGSFYL--SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGY  109
                          E + P+ ++Y+   S E  +  +G +G A   F     G     GY
Sbjct  60   VKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTG---DDGY  116

Query  110  VELDV  114
             E DV
Sbjct  117  DEEDV  121

>PYAR_15792
Length=121

 Score = 34.7 bits (78),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 23/39 (59%), Gaps = 4/39 (10%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHP  62
           EG +TKR  + K WR RF VL+G+ L    Y  RAA  P
Sbjct  16  EGELTKRSVWLKEWRRRFFVLKGNKL----YFCRAAKEP  50

>CCI10928
Length=1530

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 87/200 (44%), Gaps = 36/200 (18%)

Query  10   GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSA  69
            GA A   K    +  GY+ KRG   KS+R R++ L+G+ L  SYY+ + +        + 
Sbjct  288  GAKAC-QKGTEVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKSREENKTY  344

Query  70   PKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVA  129
             +GS +L S+      +  + +  + +G  ++  +        ++ VE + + ++WL+  
Sbjct  345  LRGSIHLESVTS----LQPLESKTEKYGVVLVTTSRT-----WELVVENEIEYHRWLKEL  395

Query  130  RNA-------LSAKRQLTRQ--------------AIDQSVSSNKKNLFG-FGVSLSPQPL  167
             NA       ++ KR    Q              A D +V    +++F  +  +L   PL
Sbjct  396  CNAVEFYAVHITYKRMFQLQEVSAKAITDVRMVIATDDTVEEIVEHIFNCYKQALDAAPL  455

Query  168  --MTPQKQMQTLTQNKDELL  185
                P++ +  +T  +D L+
Sbjct  456  KPYIPEEYVLKITGYRDYLI  475

>H257_01308
Length=897

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 2/44 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
           EGY+ K+G   K W+ R+ V +G +L  SYY ++    P A  P
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTKLEKKPNAVIP  65

>CCI43456
Length=126

 Score = 34.7 bits (78),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (62%), Gaps = 0/39 (0%)

Query  14  SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQIS  52
           S D+ +  + EG +TKR  + K WR R+ +L+G+ L  S
Sbjct  11  SIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFS  49

>PYAP_16161
Length=889

 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHP  62
           EGY+ K+G   K W+ R+ V +G  L  SYY SR    P
Sbjct  30  EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSKP  66

>PHYKE_4910
Length=375

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (60%), Gaps = 4/47 (9%)

Query  12   TASGDKAR--PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            T SG   R  P +  G+V K G   +SW+ RFLV +G+ L  +YY++
Sbjct  115  TVSGAMGRTDPVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  159

>PITG_09930
Length=1221

 Score = 36.6 bits (83),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 55/131 (42%), Gaps = 27/131 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G +TK+G +R++W+ RF +L      + Y+ S                   L  I   E 
Sbjct  153  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLE-------------LLGEIPVTED  199

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFV-----ETQGDRNKWLEVARNALSAKRQL  139
             + +  + G        GHAP +  +  D        E++ ++ +W++  +    A R  
Sbjct  200  TIVLDRSGG--------GHAPFRFQIRTDAHTLLLEAESRENQKRWIDSCQELADAIRA-  250

Query  140  TRQAIDQSVSS  150
            ++ A++ SVSS
Sbjct  251  SKFAVNNSVSS  261

>PYAR_13491
Length=1080

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  27  VTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
           +TK+G +R++W+ RF +L      +SYY+S
Sbjct  2   LTKQGSWRRNWKTRFFILRSDYPSLSYYKS  31

>PYU1_G007423
Length=928

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query  6    VPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
             PE     + D +   S  G++ K GH RK+W+ R+ VLE S L+  YY
Sbjct  417  TPEAPDANAFDDSFLDSMRGWLRKLGHVRKNWKSRYFVLERSVLR--YY  463

>PYIW_21944
Length=1317

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 50/108 (46%), Gaps = 15/108 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++TK+GH  K+W+ RF VL  S+   +YY++              +GS  L     ++ 
Sbjct  105  GWLTKQGHMWKTWKTRFFVLY-SDGTFAYYKNEG--------KKRMQGSLTL-----NDG  150

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            +V +     +  G   +    +KG+ +L  +  +Q +   W+   R+A
Sbjct  151  IVSIKHVDIRKVGKSYVIQV-EKGFYKLLCYCCSQNEAELWVSALRSA  197

>PYIW_21901
Length=913

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 47/115 (41%), Gaps = 14/115 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
            S  G++ K GH RK+W+ R+ VL+ S L+    ES A            KG   L     
Sbjct  423  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLARL----------KGEVLLFHPAT  472

Query  82   HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
              + V +  + GK   F +  H  K   + L    E   DR  W+    +AL  +
Sbjct  473  RVHYVDIHLSGGKDGTFAI--HVGKDYALLLQ--AEQLSDRENWMYCIEDALLCR  523

>SDRG_08383
Length=1321

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 4/59 (7%)

Query  53   YYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVE  111
            ++E  A CH    E SA  GS  LS+  P E     + AA   FGFK    AP +  +E
Sbjct  507  FFEHLAVCHTVMPETSA-DGSLRLSASSPDE---QALVAAAACFGFKFFARAPGEAVIE  561

>CCA24252
Length=323

 Score = 35.8 bits (81),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 62/158 (39%), Gaps = 35/158 (22%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES-------RAACHPPAAEPSAPKGSFYLS  77
            G++  RG     WR RF VL GS L  + YE+       R A  P A   S P+    ++
Sbjct  87   GWLWMRGSRFGRWRHRFFVLNGSML--TSYETFPSEKVLRQAL-PEAFPDSQPRNVLRVA  143

Query  78   SIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKR  137
             +E            G   GFK+ G   K     LDV   T   RN WL       S K 
Sbjct  144  HVE----------EGGCRIGFKIYGTCGKI----LDVRAPTTDARNAWLR------SLKP  183

Query  138  QLTRQAIDQSVSSNKK---NLFGFGVS--LSPQPLMTP  170
               R+++  S+ +++    NL  F     L P  L  P
Sbjct  184  SCRRKSLSWSMGNSEDPSWNLSTFNTDGVLDPDRLSIP  221

>PPTG_06823
Length=1321

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 52/126 (41%), Gaps = 18/126 (14%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
            R  S EGY++K+     SW+  + VLE   L  ++YE+R          S   G   L  
Sbjct  244  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDF----ISNSKLIGRIQLQG  297

Query  79   IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQ  138
            IE  +         GKP GF++I       ++       T  ++ +W      A+S   +
Sbjct  298  IEDED--------MGKPNGFRVIAEGNHVNHLS----SRTAFEKEQWKRAISIAISKAPE  345

Query  139  LTRQAI  144
            +TR  +
Sbjct  346  VTRPYV  351

>PYAR_18690
Length=2455

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 54/132 (41%), Gaps = 11/132 (8%)

Query  6     VPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAA  65
             V EI A  S  +      EGY+ KRGH   S R R+ VL  + L  +YY ++       +
Sbjct  1120  VDEISAVESSHETSSILMEGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQEDSR--NS  1175

Query  66    EPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKW  125
             + S P GSF +  +       G        FG ++  H  K  +        +  ++ +W
Sbjct  1176  DTSQPLGSFRVEIVSDWH---GKTAMQTYEFGMELETHDGKTFFCA----AFSSEEKTQW  1228

Query  126   LEVARNALSAKR  137
             +    + ++  R
Sbjct  1229  IRAFHHGIAISR  1240

>PYU1_G000724
Length=189

 Score = 35.0 bits (79),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (71%), Gaps = 1/34 (3%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
            G++TK+GH  KSW+ RF VL  ++   +YY+++ 
Sbjct  111  GWLTKQGHMWKSWKTRFFVLF-ADGTFAYYKNKG  143

>PYIR_14494
Length=819

 Score = 36.2 bits (82),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 31/52 (60%), Gaps = 4/52 (8%)

Query  6    VPEIG-ATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            VP +G    S D++ P  C G++ K G   K+W++R+  L G+ L  SY++S
Sbjct  699  VPYVGMGCVSLDESFP-GCSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  747

 Score = 35.0 bits (79),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 23/46 (50%), Gaps = 4/46 (9%)

Query  5    RVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
            + P +G T     A    CEG++ KRG    +W+ RF  L G  LQ
Sbjct  251  KTPFLGETF----AETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ  292

 Score = 33.5 bits (75),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 30/55 (55%), Gaps = 11/55 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            G++ K+G   KSW+ RF V+E  +  I+YYE             APKG+ +++ +
Sbjct  422  GWLKKQGKHMKSWKRRFFVIE--DRTITYYEQLN---------EAPKGNGFINQV  465

 Score = 32.0 bits (71),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 21/79 (27%), Positives = 38/79 (48%), Gaps = 12/79 (15%)

Query  2   NILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACH  61
           N++ V  +   +  D A      G+ +K+G   KSW+ R+ VL+G  L   Y+  R+   
Sbjct  15  NVIAVSRVTKNSYCDHA------GWASKQGSIIKSWKRRYFVLKGREL--IYFAERS---  63

Query  62  PPAAEPSAPKGSFYLSSIE  80
            P+ +    KG   + ++E
Sbjct  64  -PSGKGIDEKGRLKIVAVE  81

>PYAP_22685
Length=1104

 Score = 35.8 bits (81),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 36/159 (23%), Positives = 71/159 (45%), Gaps = 31/159 (19%)

Query  25   GYVTKRGHFRKSWRVRFLVL--EGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            G++TK+GH  K+W+ RF VL  +G+   ++YY+++             KG   L+     
Sbjct  149  GWLTKQGHVWKNWKNRFFVLFHDGT---LAYYKAKG--------KRRMKGCMKLN-----  192

Query  83   EYVVGVMGA----AGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQ  138
            E VV V       + K + F++     +KGY  +     +Q +   W+    NAL   RQ
Sbjct  193  EGVVSVQHVDIRRSTKAYVFQV-----EKGYYRMWCCCCSQLEAELWV----NALRKVRQ  243

Query  139  LTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTL  177
             +    +  ++ +++   G  V+     +     ++Q++
Sbjct  244  CSPPCFEPLLTVHEEQFGGLAVNRQLNKIFVTDNRIQSM  282

>SPRG_02010
Length=1326

 Score = 35.8 bits (81),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 4/59 (7%)

Query  53   YYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVE  111
            ++E  A CH    E SA  GS  LS+  P E     + AA   FGFK    AP +  +E
Sbjct  508  FFEHLAVCHTVMPETSA-DGSLRLSASSPDE---QALVAAAACFGFKFFARAPGEAVIE  562

>SDRG_02154
Length=822

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (58%), Gaps = 9/57 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPS-APKGSFYLSSIE  80
            G++ K+G   K+W+ RF+VL+  +L   Y+E+          P+  PKGSF + +IE
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLH--YFETD------KLTPTLKPKGSFQVLAIE  176

>PHYCA_509385
Length=557

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 41/97 (42%), Gaps = 18/97 (19%)

Query  37   WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
            W+ R+ V+    LQI Y+ S         E  A +G    SS+   +         GKP 
Sbjct  42   WKKRYCVIYKGELQIVYFLSLEDF-----EKRAIRGKIPFSSVHAWD---------GKPN  87

Query  97   GFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
            GF+   + P        V+ ET  D+ KW+E  +N +
Sbjct  88   GFQF--YTPSDNCFR--VYTETAEDQAKWIETMQNCI  120

>SDRG_15262
Length=582

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 50/122 (41%), Gaps = 36/122 (30%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ--ISYYESRAACHPPAAEPSAPKGSFYLSSI  79
            S EG + KRGH R +W  RF  +E  N    +SYY           +  APKG+  L   
Sbjct  272  SMEGVLYKRGHVRTNWSKRFFRIEIHNKLPILSYYTE---------DQGAPKGNLPL---  319

Query  80   EPHEYVVGVMGAAGKPFGFKMIGHAP--KKGY-------VELDVFVETQGDRNKWLEVAR  130
                  +G + + G PF       AP  ++ Y       +EL +   T+ D   WL   +
Sbjct  320  ------LGCVVSGGIPF-------APDSRRNYFVIATDNLELHLSAMTEHDMYLWLHALQ  366

Query  131  NA  132
             A
Sbjct  367  QA  368

>SDRG_04871
Length=687

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +L+G+NL+  YY+ R        +P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDP-APRGAYVLT  46

>SPRG_08217
Length=687

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +L+G+NL+  YY+ R        +P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDP-APRGAYVLT  46

>H257_06469
Length=76

 Score = 32.7 bits (73),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISY  53
           EGYV K+GH  KSW+ R+  L+ S   + Y
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEY  31

>H310_09363
Length=1954

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
            M++L V +   T+S +  R TSC GY+ KRG    + + R+++L+ + L   YY++    
Sbjct  826  MDVL-VLDTTNTSSQNNKR-TSCAGYLMKRGEVNVTMQRRYMILQDNEL--VYYKTNPEL  881

Query  61   HPPAAEPSAPKGSFYLSSI  79
            +        P+GS +L ++
Sbjct  882  NKGWFGKEKPRGSLHLGNV  900

>PHYRA_83768
Length=735

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGA  91
            +PPA E   P G  +L +I PH Y +G+MGA
Sbjct  619  NPPATE--IPSGYKWLYNITPHRYTIGIMGA  647

>PYAP_23478
Length=897

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 46/109 (42%), Gaps = 14/109 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++ K GH RK+W++R+ VL+ S L+  YY             +  KG   L       +
Sbjct  380  GWLRKLGHVRKNWKLRYFVLDKSVLR--YYSDEGM--------TRLKGEVLLFHPATQVH  429

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
             V +  + GK   F  I   P+     L +  E   DR  W+    +AL
Sbjct  430  YVDIHESRGKDHTFA-IQVGPE---YTLLLQAERLADRENWMYCIEDAL  474

>CCA27255
Length=1125

 Score = 35.8 bits (81),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 0/37 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACH  61
            GY+ K+G +R++W+ RF +L        YY+S+   H
Sbjct  167  GYLLKQGSWRRNWKSRFFMLRQDYPSFCYYKSQHKLH  203

>PYAP_22195
Length=901

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 2/44 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
           EGY+ K+G   K W+ R+ V  G  L  SYY SR    P A  P
Sbjct  38  EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISRKDRKPNAVIP  79

>PYVX_13084
Length=1267

 Score = 35.8 bits (81),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 16/71 (23%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR---------AACHPPAAEPSAPKGSFY  75
            GY+ K+G F K+WR R+ VL      +SY+ S+         A       EP APK  F 
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSKDDLMKLGEIAIDESTTVEP-APKDGF-  299

Query  76   LSSIEPHEYVV  86
                 P+ ++V
Sbjct  300  -----PNRFIV  305

>SPRG_02939
Length=2161

 Score = 35.8 bits (81),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 30/131 (23%), Positives = 63/131 (48%), Gaps = 23/131 (18%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI--  79
            + EGY+ K+GHF  + + +++VL G++L   +Y S  A     A+ +A  G   ++S+  
Sbjct  464  TVEGYLVKQGHFVPTMKQKYVVLRGNHL--FFYASYDAY---MAKTTADVGCSQVASVGD  518

Query  80   -EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLE-----VARNAL  133
             + H  ++        PF  + + HA      ++     T  +++KW+      +A++A+
Sbjct  519  WDGHTLLLTY----PHPFRIETVAHA------QVLCSAPTASEKDKWMRGLRAAIAKHAI  568

Query  134  SAKRQLTRQAI  144
             AK   +   +
Sbjct  569  GAKTSTSSDVV  579

>CCA25510
Length=1139

 Score = 35.4 bits (80),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            GY+ K+G F KSWR R+ +L      ++YY S+
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSK  229

>PYAR_14615
Length=517

 Score = 35.4 bits (80),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (57%), Gaps = 2/44 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
           EG++ K+G   KSW+ R+ V +G  L  SYY SR    P A  P
Sbjct  38  EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISRKDRKPNAIIP  79

>SPRG_00889
Length=994

 Score = 35.4 bits (80),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 17/110 (15%)

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
            EG+V K+G +   W  R+LVL+G+ L  +YY  +      A      +G   L+ + P  
Sbjct  123  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQH----DARSGKNLRGRMVLTYVGPD-  175

Query  84   YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                    + K  GF +      KG+    +   T+ +++ W+E+ + AL
Sbjct  176  ------FKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  215

>PHYRA_77033
Length=1372

 Score = 35.4 bits (80),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  61    HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGA  91
             +PPA E   P G  +L +I PH Y +G+MGA
Sbjct  1256  NPPATE--IPSGYKWLYNITPHRYTIGIMGA  1284

>SPRG_14955
Length=635

 Score = 35.4 bits (80),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (54%), Gaps = 3/54 (6%)

Query  3   ILRVPEIGATASGDKARP-TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
           +L   E  A+  G K +      G + KRGH RK+W  RF VL  ++L+  YY+
Sbjct  5   VLHPQESSASVGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

>PHYSO_349983
Length=1320

 Score = 35.4 bits (80),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 24/113 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
            C G++ K G   KSW+ R+  L GS L  SYY++              KGS  L S++  
Sbjct  728  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKT-------------DKGSL-LRSVK--  769

Query  83   EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
              VV +       FG  +     +K  ++ D    ++ D   WL   R A++A
Sbjct  770  --VVNIAANPSVAFGLTVSTAGGRKLVIQAD----SKEDFEMWLGAVREAVAA  816

>PHALS_08097
Length=1069

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
            G++TK+G +R++W+ RF +L      + Y+ S
Sbjct  144  GFLTKQGSWRRNWKTRFFILRSDCPSLCYFTS  175

>PHYRA_73432
Length=1313

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 54/124 (44%), Gaps = 24/124 (19%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
            +S  ++    C G++ K G   KSW+ R+  L GS L  SYY+S              KG
Sbjct  703  SSTTQSESKGCVGWLKKEGGNVKSWKRRYFTLYGSKL--SYYKSE-------------KG  747

Query  73   SFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
            S  L S+     VV +        G  ++    +K  ++ D    +  + NKWL   + A
Sbjct  748  SL-LRSVS----VVDITAHPSVSLGLTVLTVGGRKLIIQAD----SNEEFNKWLGAIQEA  798

Query  133  LSAK  136
            ++A+
Sbjct  799  VAAE  802

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 43/108 (40%), Gaps = 24/108 (22%)

Query  25   GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
            G++ K+G   K+W+ R+ VLE S L                  SA  G   L S    E 
Sbjct  520  GWLLKKGQNFKTWKRRYFVLESSRLAY----------------SANAGGEVLGSGVVFEV  563

Query  85   VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
             VG +    +PF   +     +     L V   TQ   +KW +V RNA
Sbjct  564  EVGNL----RPFSLNIRFQNGRL----LHVVAPTQESFSKWFDVLRNA  603

>CCA19118
Length=125

 Score = 33.5 bits (75),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  24  EGYVTKRGHFRKSWRVRFLVLEGSNLQIS  52
           EG +TKR  + K WR R+ +L+G+ L  S
Sbjct  20  EGELTKRSMWMKEWRKRYFILKGNKLYFS  48

>HYAP_13757
Length=262

 Score = 34.7 bits (78),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 2/31 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
           G++ KRGH  K+W+ RF +L G+ L  +YY+
Sbjct  15  GWLWKRGHTFKTWKKRFFLLNGAAL--TYYK  43

>SPRG_04912
Length=261

 Score = 34.7 bits (78),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
           P    GYV K+G F K+W+ R + L    L   YY S  A        + P+G F ++S+
Sbjct  38  PPDFSGYVRKQGSFVKNWKRRIMALHDDTL--FYYVSERAM-------AKPRGVFRVTSV  88

>CCA19033
Length=1883

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
             EGY+ KRGH   S R R+ VL+  N  + Y+E++
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETK  1054

>SDRG_14070
Length=630

 Score = 35.4 bits (80),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
           G + KRGH RK+W  RF VL  ++L+  YY+
Sbjct  28  GVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

Lambda      K        H        a         alpha
   0.316    0.133    0.377    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22876779732

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40