Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_810981475874174130940.0
PPTG_171291475874575326540.0
PITG_184581475874773125940.0
PHYCA_5114151475874473125900.0
PHYSO_3489031475876674324390.0
PHYKE_839514758142073824000.0
PHALS_064761475872675221770.0
HYAP_071041475872166020940.0
PYIW_199691475873361015160.0
PYIR_134181475874761415090.0
PYU1_G0017331475873250515020.0
PYAP_177631475879451214020.0
PYAR_135711475866650513393e-175
PYVX_235901475868950611421e-145
CCA22843147585865038711e-106
CCI44111147585764978656e-106
SPRG_06355147587135566582e-74
SDRG_01763147587364655996e-66
SDRG_045751382110032281741e-11
SPRG_126211382110031771678e-11
H257_117731382110263531562e-09
PYIR_141071382111764681562e-09
SDRG_079831335559912261552e-09
SPRG_1903013355510001731543e-09
H310_082921382110072261533e-09
H257_0193413355510222451411e-07
PYVX_215131382114463361411e-07
PYAP_222301382111164251382e-07
PYAR_14788138217953781231e-05
PHYSO_4705331382110843541231e-05
PYIW_157171382111214371194e-05
PPTG_113651382111062021132e-04
PITG_172501382110463461104e-04
PITG_0658055211214104811.2
PYVX_15878466801347116811.3
PPTG_02543186591373116801.6
PHYCA_5322864893121375801.9
PHYRA_84772466801376116801.9
PHYCA_52515644723138287782.6
PPTG_13828551795868782.7
PPTG_138275521121268782.9
PYAP_2285510058252727773.6
PYVX_217761252820340744.0
PHYSO_49828612293936255764.7
PYIR_233601252822740735.9
PHYSO_5453781252822443736.5
PHYKE_499546680137387756.8
PHYRA_795195521124068757.2
PHYCA_53267610954166280748.9
PHYCA_5345035521108968749.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_81098

Length=742
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_81098                                                           1196       0.0   
PPTG_17129                                                            1026       0.0   
PITG_18458                                                            1003       0.0   
PHYCA_511415                                                          1002       0.0   
PHYSO_348903                                                          944        0.0   
PHYKE_8395                                                            929        0.0   
PHALS_06476                                                           843        0.0   
HYAP_07104                                                            811        0.0   
PYIW_19969                                                            588        0.0   
PYIR_13418                                                            585        0.0   
PYU1_G001733                                                          583        0.0   
PYAP_17763                                                            544        0.0   
PYAR_13571                                                            520        3e-175
PYVX_23590                                                            444        1e-145
CCA22843                                                              340        1e-106
CCI44111                                                              337        6e-106
SPRG_06355                                                            258        2e-74 
SDRG_01763                                                            235        6e-66 
SDRG_04575                                                            71.6       1e-11 
SPRG_12621                                                            68.9       8e-11 
H257_11773                                                            64.7       2e-09 
PYIR_14107                                                            64.7       2e-09 
SDRG_07983                                                            64.3       2e-09 
SPRG_19030                                                            63.9       3e-09 
H310_08292                                                            63.5       3e-09 
H257_01934                                                            58.9       1e-07 
PYVX_21513                                                            58.9       1e-07 
PYAP_22230                                                            57.8       2e-07 
PYAR_14788                                                            52.0       1e-05 
PHYSO_470533                                                          52.0       1e-05 
PYIW_15717                                                            50.4       4e-05 
PPTG_11365                                                            48.1       2e-04 
PITG_17250                                                            47.0       4e-04 
PITG_06580                                                            35.8       1.2   
PYVX_15878                                                            35.8       1.3   
PPTG_02543                                                            35.4       1.6   
PHYCA_532286                                                          35.4       1.9   
PHYRA_84772                                                           35.4       1.9   
PHYCA_525156                                                          34.7       2.6   
PPTG_13828                                                            34.7       2.7   
PPTG_13827                                                            34.7       2.9   
PYAP_22855                                                            34.3       3.6   
PYVX_21776                                                            33.1       4.0   
PHYSO_498286                                                          33.9       4.7   
PYIR_23360                                                            32.7       5.9   
PHYSO_545378                                                          32.7       6.5   
PHYKE_4995                                                            33.5       6.8   
PHYRA_79519                                                           33.5       7.2   
PHYCA_532676                                                          33.1       8.9   
PHYCA_534503                                                          33.1       9.4   

>PHYRA_81098
Length=741

 Score = 1196 bits (3094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/741 (100%), Positives = 741/741 (100%), Gaps = 0/741 (0%)

Query  1    MVGTMhrlknklrlhkkDANWALDEDSLRLKQTQddalrldrsttltdtvnvtddvEEMF  60
            MVGTMHRLKNKLRLHKKDANWALDEDSLRLKQTQDDALRLDRSTTLTDTVNVTDDVEEMF
Sbjct  1    MVGTMHRLKNKLRLHKKDANWALDEDSLRLKQTQDDALRLDRSTTLTDTVNVTDDVEEMF  60

Query  61   YGGRSTVSDVPQYRTTEQLRGTHMTLSALHEDaeasnasssfsqfsattpsNYAASTPGH  120
            YGGRSTVSDVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQFSATTPSNYAASTPGH
Sbjct  61   YGGRSTVSDVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQFSATTPSNYAASTPGH  120

Query  121  VPNQGAYHDFSTAHSTTRAISDAFelerlrsevvevkeevkairrevMNELHVTRYDVLK  180
            VPNQGAYHDFSTAHSTTRAISDAFELERLRSEVVEVKEEVKAIRREVMNELHVTRYDVLK
Sbjct  121  VPNQGAYHDFSTAHSTTRAISDAFELERLRSEVVEVKEEVKAIRREVMNELHVTRYDVLK  180

Query  181  ELALLKGAIAQLAATQHlspaasvsstessssdplsadeRAALTRQTSTKTSSATRERLA  240
            ELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAALTRQTSTKTSSATRERLA
Sbjct  181  ELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAALTRQTSTKTSSATRERLA  240

Query  241  ASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSL  300
            ASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSL
Sbjct  241  ASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSL  300

Query  301  TPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQ  360
            TPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQ
Sbjct  301  TPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQ  360

Query  361  FDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAM  420
            FDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAM
Sbjct  361  FDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAM  420

Query  421  EEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPV  480
            EEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPV
Sbjct  421  EEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPV  480

Query  481  SSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSH  540
            SSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSH
Sbjct  481  SSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSH  540

Query  541  PGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAG  600
            PGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAG
Sbjct  541  PGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAG  600

Query  601  PYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQF  660
            PYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQF
Sbjct  601  PYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQF  660

Query  661  YFAIDDAIQALrsmrrsvsssshsnsgssddspptsrrGHtssrassrvttsksNQRAHT  720
            YFAIDDAIQALRSMRRSVSSSSHSNSGSSDDSPPTSRRGHTSSRASSRVTTSKSNQRAHT
Sbjct  661  YFAIDDAIQALRSMRRSVSSSSHSNSGSSDDSPPTSRRGHTSSRASSRVTTSKSNQRAHT  720

Query  721  RHDPRATQEFKPVGILKRNKL  741
            RHDPRATQEFKPVGILKRNKL
Sbjct  721  RHDPRATQEFKPVGILKRNKL  741

>PPTG_17129
Length=745

 Score = 1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/753 (81%), Positives = 658/753 (87%), Gaps = 20/753 (3%)

Query  1    MVGTMhrlknklrlh---kkDANWALDEDSLRLKQTQdda-lrldrsttltdtvnvtddv  56
            MVGTM+R+KNKLR     KK+  WALDEDSLRLKQTQDD  +R DRSTTL DTVNVTDDV
Sbjct  1    MVGTMNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDV  60

Query  57   EEMFYG--GRSTVSDVPQYRTTEQLRGTHMTLSALHEDaeasnasssfsqfs---attps  111
            EEMFYG    +T SD+PQYRTTEQ+R  +MTLSALHED EASN S+  S FS    TTPS
Sbjct  61   EEMFYGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPS  120

Query  112  NYAASTPGHVPNQGAYHDFSTAHSTT---RAISDAFelerlrsevvevkeevkairrevM  168
            NYAASTPG+      YH F+T HSTT   RA+S  FELERLRSEV+EVKEEVKAIRREVM
Sbjct  121  NYAASTPGNF--SSTYHGFNTVHSTTGTSRAVSGDFELERLRSEVLEVKEEVKAIRREVM  178

Query  169  NELHVTRYDVLKELALLKGAIAQLAATQHlspaasvsstessssdplsadeRAALTRQTS  228
            NELHVTRYDVLKELALLKGAIAQL ATQH +P +  S+  SSS    + + RAALTRQTS
Sbjct  179  NELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSDPLSAEE-RAALTRQTS  237

Query  229  TKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLID  288
            TKTS ATR+RLAASR NIHKTPPPAARASVRLTQLAPVADNALSTPL+PQQIN+MFPLID
Sbjct  238  TKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLID  297

Query  289  FTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQ  348
            FTSELAAHAR LTPG+RTWALTRVEEWLDARFNVG+DTLLAVVGEGGTGKSAF GTVAQQ
Sbjct  298  FTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQ  357

Query  349  FRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVL  408
            FRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVD+LP FKNQLARLNLKYVLEEADPF+L
Sbjct  358  FRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLL  417

Query  409  AGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSS  468
            AGKVLVDPLNAMEEPMHATFMLVDGIDQC+AG  GRNELLEFFAQVIP LPSWVGF++SS
Sbjct  418  AGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISS  477

Query  469  KPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNF  528
            KPSSKLAKRLPVSSVLDFSAKNGAFV+DVSS+V+D+ARNFSD+D AEAKKVLK+KSGGNF
Sbjct  478  KPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNF  537

Query  529  AYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAK  588
            AYLEFTKQALSHPGMAAASKEGAVPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAK
Sbjct  538  AYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAK  597

Query  589  PLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCG  648
            PLLQLIVGAAAGPYS +TEEQAK+HF  TAEDLRMLR SFVDLVAV+HGAYRIESSALC 
Sbjct  598  PLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCA  657

Query  649  WLSDPARSEEQFYFAIDDAIQALrsmrrsvsssshsnsgssddspptsrrGHtssrassr  708
            WLSDPARSEEQFYF+IDDA+QALR MRR  SS S S    S      + R      +S  
Sbjct  658  WLSDPARSEEQFYFSIDDALQALRKMRRVSSSGSSSGHSGSSSDGKATHRA-----SSRV  712

Query  709  vttsksNQRAHTRHDPRATQEFKPVGILKRNKL  741
             T+SK++QRAHTRH+PRA  +FKPVGILKRNKL
Sbjct  713  KTSSKTHQRAHTRHEPRANPDFKPVGILKRNKL  745

>PITG_18458
Length=747

 Score = 1003 bits (2594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/731 (80%), Positives = 644/731 (88%), Gaps = 13/731 (2%)

Query  21   WALDEDSLRLKQTQdda-lrldrsttltdtvnvtddvEEMFYG--GRSTVSDVPQYRTTE  77
            WALDEDSLRLKQTQDD  +R DRSTTL DTVNVTDDVEEMFYG    +T SD+PQYRTTE
Sbjct  20   WALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYGRSTSNTSSDMPQYRTTE  79

Query  78   QLRGTHMTLSALHEDaeasnasssfsqfs---attpsNYAASTPGHVPNQGAYHDFSTAH  134
            QLRG ++TLSALHED EASN S+  S FS   ATTPSNYAASTPG   +   +   +TA 
Sbjct  80   QLRGNNITLSALHEDVEASNVSNVSSSFSQFSATTPSNYAASTPGKFTS--THQGLNTAQ  137

Query  135  STT---RAISDAFelerlrsevvevkeevkairrevMNELHVTRYDVLKELALLKGAIAQ  191
            +TT   RA+S  FELERLRSEV+EVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQ
Sbjct  138  TTTGMSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQ  197

Query  192  LAATQHlspaasvsstessssdplsadeRAALTRQTSTKTSSATRERLAASRANIHKTPP  251
            L ATQH++PA+  S+  SSS      + RAALTRQTSTKTS ATR+RLAASR NIHKTPP
Sbjct  198  LTATQHIAPASVSSTESSSSDPLSPDE-RAALTRQTSTKTSQATRDRLAASRTNIHKTPP  256

Query  252  PAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTR  311
            PAARASVRLTQLAPVADNALSTPL PQQIN+MFPLID TSELAAHAR LTPG+RTWALTR
Sbjct  257  PAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTR  316

Query  312  VEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRN  371
            VEEWLDAR+N+G+DTLLAVVGEGGTGKS F GTVAQQFRGNLLAAHCCQFDRKSKSSPRN
Sbjct  317  VEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRN  376

Query  372  VLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHATFMLV  431
            VLLSMVHQLVDSLP FKNQLARLNLKYVLEEADPF+LAGKVLVDPLNA+EEPMHATF+LV
Sbjct  377  VLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILV  436

Query  432  DGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNG  491
            DGIDQC+ G  GRNELLE FAQVIP LPSWVGF+VSSKPSSKLAKRLPVSSVLDFSAKNG
Sbjct  437  DGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNG  496

Query  492  AFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGA  551
            AFV+D SSLV+D+ARNFSD+DAAEAKKVLK+KSGGNFAYLEFTKQALSHPG+AAASKEGA
Sbjct  497  AFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGA  556

Query  552  VPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAK  611
            VPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL+VGAAAGPYS VTEEQAK
Sbjct  557  VPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAK  616

Query  612  KHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQFYFAIDDAIQAL  671
            +HFNLT EDLRMLR SFVDLV+V+HG+YRIESSALC WLSDPARSEEQFYF++DDA+ AL
Sbjct  617  EHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPARSEEQFYFSVDDALLAL  676

Query  672  rsmrrsvsssshsnsgssddspptsrrGHtssr-assrvttsksNQRAHTRHDPRATQEF  730
            R +RR  SSSS S    +      ++ GH SSR ++   T+SK++QRAHTR++PR + ++
Sbjct  677  RKIRRVGSSSSSSGHSGNSSDGKAAKNGHASSRPSNRVKTSSKTHQRAHTRYEPRTSPDY  736

Query  731  KPVGILKRNKL  741
            KPVGILKRNKL
Sbjct  737  KPVGILKRNKL  747

>PHYCA_511415
Length=744

 Score = 1002 bits (2590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/731 (82%), Positives = 647/731 (89%), Gaps = 16/731 (2%)

Query  21   WALDEDSLRLKQTQddalrldrsttltdtvnvtddvEEMFYG---GRSTV-SDVPQYRTT  76
            WALDEDSLRLKQ QDDA+R DRSTTL DTVNVTDDVEEMFYG    RST  S++PQYRTT
Sbjct  20   WALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFYGRNTNRSTTASEMPQYRTT  79

Query  77   EQLRGTHMTLSALHEDaea---snasssfsqfsattpsNYAASTPGHVPNQGAYHDFSTA  133
            EQ+RG ++TLSALHE+A     SN SSSFSQFSATTPSNYAASTPG+V N   YH FS+A
Sbjct  80   EQIRGNNLTLSALHEEAVTPSASNVSSSFSQFSATTPSNYAASTPGNVGN-NTYHGFSSA  138

Query  134  HST---TRAISDAFelerlrsevvevkeevkairrevMNELHVTRYDVLKELALLKGAIA  190
             +T   +R IS+ FELERLRSEV+EVKEEVKAIRREVMNELHVTRYDVLKEL LLKGAIA
Sbjct  139  LNTAGTSRVISEDFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGAIA  198

Query  191  QLAATQHlspaasvsstessssdplsadeRAALTRQTSTKTSSATRERLAASRANIHKTP  250
            QL A QH SP+ S + + SS         RAALTRQTSTKTS+ATR+RLAASR N+HKTP
Sbjct  199  QLTAAQHSSPSVSSTESSSSDPLSAEE--RAALTRQTSTKTSAATRDRLAASRLNVHKTP  256

Query  251  PPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALT  310
            PPAARASVRLTQLAPVADNALSTPL+ QQIN+MFPLIDFTS+LAAHAR LTPGSRTWALT
Sbjct  257  PPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALT  316

Query  311  RVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPR  370
            RVEEWLDARFNVG DTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPR
Sbjct  317  RVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPR  376

Query  371  NVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHATFML  430
            NVLLSMVHQLVD+LP FKNQLARLNLKYVLEEADP +LAGKVLVDPLNAMEEP+HATFML
Sbjct  377  NVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFML  436

Query  431  VDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKN  490
            VDGIDQCSAGP GRNELL+FFAQVIP LPSW+GF++SSKPSSKLAKRLPVSSVLDFSAKN
Sbjct  437  VDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKN  496

Query  491  GAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEG  550
            GAFV+DVSSLV+D+ARNFSD+DAAEAKKVLK KSGGNFAYLEFTKQALSHPGM A SKEG
Sbjct  497  GAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEG  556

Query  551  AVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQA  610
            AVPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL+VGAA+GPYS VTEEQA
Sbjct  557  AVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQA  616

Query  611  KKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQFYFAIDDAIQA  670
            K+HF LTAEDLRMLR SFVDLVAV+HG+YRIESSALC WLSDPARSEEQFYF+IDDA+ A
Sbjct  617  KEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFSIDDALHA  676

Query  671  LrsmrrsvsssshsnsgssddspptsrrGHtssrassrvttsksNQRAHTRHDPRATQEF  730
            LR MRR+VSSS HS+SGSS DS  T      S  +S    +SKS QR+HTRH+PR T   
Sbjct  677  LRKMRRNVSSSGHSHSGSSSDSSATHHTS--SRASSRVTASSKSQQRSHTRHEPR-TNPG  733

Query  731  KPVGILKRNKL  741
            KPVGILKR KL
Sbjct  734  KPVGILKRGKL  744

>PHYSO_348903
Length=766

 Score = 944 bits (2439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/743 (76%), Positives = 630/743 (85%), Gaps = 26/743 (3%)

Query  18   DANWALDEDSLRLKQTQdda-lrldrsttltdtvnvtddvEEMFYG--GRSTVS---DVP  71
            DA WALDEDSLRLKQ QDDA +R DRS TL+DTVNVTDDVE+MFYG   RST S   DVP
Sbjct  24   DAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVEDMFYGRNNRSTASAASDVP  83

Query  72   QYRTTEQLRGTHMTLSALHEDaeasnasssfsqf----sattpsNYAASTPGHVPNQGAY  127
            QYRTTEQLR TH+TLSALHEDAE  +A+++ S      S TTPSNYAASTPG+  N    
Sbjct  84   QYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPGNFSNHNGQ  143

Query  128  -----------HDFSTAHSTT-RAISDAFelerlrsevvevkeevkairrevMNELHVTR  175
                         FS   +T   A+++  ELERLR+EV+EVKEEVKAIRREVMNELHVTR
Sbjct  144  NNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAEVLEVKEEVKAIRREVMNELHVTR  203

Query  176  YDVLKELALLKGAIAQLAATQHlspaasvsstessssdplsadeRAALTRQTSTKTSSAT  235
            YDVLKELALLKGA+AQL A QH S   SVSST+SSS DPLSAD+RA L RQTSTKTS AT
Sbjct  204  YDVLKELALLKGAVAQLTAAQH-SSPPSVSSTDSSSLDPLSADDRAKLVRQTSTKTSPAT  262

Query  236  RERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAA  295
            RERLAASRAN+ KTPPP ARASVRLTQLAPVAD+ALSTPLT QQIN+MFPLIDFTSELAA
Sbjct  263  RERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELAA  322

Query  296  HARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLA  355
            HAR LTPGSRTWALTRVEEWLD+RFN G D LLAVVGEGGTGKSAF GTVAQQFRGN+LA
Sbjct  323  HARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLA  382

Query  356  AHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVD  415
            AHCCQFDRKSKS+PRNVLLSMVHQ+VD+ PPFKNQLARLNLKYVLEEADP +LA KVLVD
Sbjct  383  AHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLVD  442

Query  416  PLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLA  475
            PLNA+EEP+ A FM+VDGIDQC+AG +GRNELLEFFAQ+IP LP+WVGF++SSKPSSKLA
Sbjct  443  PLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFLLSSKPSSKLA  502

Query  476  KRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTK  535
            KRLPVSSVLDFSA+N AFV+DV+ LVED+ARNFSD+D  +AK +LKQKSGGNFAYLEFTK
Sbjct  503  KRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTK  562

Query  536  QALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIV  595
            QALSHPGMAAASKEGAVPL VL++LPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL+V
Sbjct  563  QALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVV  622

Query  596  GAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPAR  655
            GAA+GPYS VTEEQA++HFNLTAEDLRMLR SFVDLVAVRHG+YRIESSALC WLSDPAR
Sbjct  623  GAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPAR  682

Query  656  SEEQFYFAIDDAIQALrsmrrsvsssshsnsgssddspptsrrGHtssrassrvttsksN  715
            SEEQFYF+IDDA+QALR MRRS SS S S    S     TS     +   ++    +KS+
Sbjct  683  SEEQFYFSIDDALQALRQMRRSGSSGSSSGHSGSSSDGTTSA---PTLSRTTSRGATKSH  739

Query  716  QRAHTRHDPRATQEFKPVGILKR  738
             R+H +H+PRA  ++KPVGILKR
Sbjct  740  HRSHVKHEPRANPDYKPVGILKR  762

>PHYKE_8395
Length=1420

 Score = 929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/738 (72%), Positives = 608/738 (82%), Gaps = 24/738 (3%)

Query  21    WALDEDSLRLKQTQddalrldrsttltdtvnvtddvEEMFYGGRST------VSDVPQYR  74
             WALDEDSLRL + Q DA R DR+T +TDTVNV+DDVE+MFYG  +T       SDVP YR
Sbjct  690   WALDEDSLRLNKQQQDADRFDRNTAMTDTVNVSDDVEDMFYGRSTTQSQLSNTSDVPSYR  749

Query  75    TTEQLRGTHMTLSALHEDaeasnasssfsqfsattpsNYAASTPGHVPNQGAYHDFSTAH  134
             TTEQ+RGT+ TL+ALHE+   + ++S  S   A++     ASTPG+  N   ++ F+T H
Sbjct  750   TTEQMRGTNSTLTALHEEEAMTPSASHLSNSFASSY----ASTPGNYQNPPTFNGFNTTH  805

Query  135   ST--TRAIS-DAFelerlr---sevvevkeevkairrevMNELHVTRYDVLKELALLKGA  188
             ST  +R IS D +    +    +E+ EVK EV+ IRREVMNELH+TRYDVLKEL LLKGA
Sbjct  806   STGLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGA  865

Query  189   IAQLAATQHlspaasvsstessssdplsadeRAALTRQTSTKTSSATRERLAASRANIHK  248
             +AQL+A Q      SVS + SSSSDPLSA++RAALTR  S  TS  T++RLA SR NIH 
Sbjct  866   VAQLSAAQ---TTGSVSPSTSSSSDPLSAEDRAALTRVPSKLTSKTTKDRLAKSRVNIHT  922

Query  249   TPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWA  308
              PPPAARASVRLTQLAPVADNALSTPL PQQIN+MFPLIDFTSELAAHAR L PG+RTWA
Sbjct  923   VPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWA  982

Query  309   LTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSS  368
             LTRVEEWLDARFNVG+DT+LAVVG+GGTGKSAF GTVAQQFRGNLLAAHCCQFDRKSKS+
Sbjct  983   LTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKST  1042

Query  369   PRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHATF  428
             PRNVLLS VHQLVD+LPPFKNQLARLNLKYVLEE+DPF+LA KV VDPLNA+EEP+HATF
Sbjct  1043  PRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATF  1102

Query  429   MLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSA  488
             MLV+G+DQCSAGP GRNELLEF +Q+IP LPSWVGFM+SSKP SK AKRLPVSSVLDFSA
Sbjct  1103  MLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSA  1162

Query  489   KNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASK  548
             KNGAFVSDVSSLV+D+ARNFSD D+AEAK+VLK+KSGGNFAYLEFTKQALSHPGMA ASK
Sbjct  1163  KNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASK  1222

Query  549   EGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEE  608
             EGAVPL VL +LP++L+DIY EIFEDKFGQGRAR+W KAKPLLQLIVGAAAGPYS VTE 
Sbjct  1223  EGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEG  1282

Query  609   QAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQFYFAIDDAI  668
             QAK+HF  T EDLRMLR SFVDLV V+HGAYR+ESSALC WLSDPARSEEQFY ++DDA+
Sbjct  1283  QAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDAL  1342

Query  669   QALrsmrrsvsssshsnsgssddsppt----srrGHt-ssrassrvttsksNQRAHTRHD  723
              ALR +RRS SS S+S+   S  S       S   HT S   SSR  +SKS+QRAHTRH+
Sbjct  1343  TALRKLRRSRSSGSNSDHSHSGSSSSDGSVPSTTSHTPSRATSSRAASSKSHQRAHTRHE  1402

Query  724   PRATQEFKPVGILKRNKL  741
             PR   EFKP+GILKR K+
Sbjct  1403  PRVNPEFKPMGILKRGKM  1420

>PHALS_06476
Length=726

 Score = 843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/752 (69%), Positives = 599/752 (80%), Gaps = 37/752 (5%)

Query  1    MVGTMhrlknk---lrlhkkDANWALDEDSLRLKQTQddalrldrsttltdtvnvtddvE  57
            MVGTMH+LKNK     L KK++ + L++DSLR K TQD+ +R+DRS TLTDTVN+TDDVE
Sbjct  1    MVGTMHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVE  60

Query  58   EMFYGGRSTVSDVPQYRTTEQLRGTHMTLSALHEDaeasnasssfsqfsattp----sNY  113
            EMFY   +  S +PQYRTTEQ+RG ++ L ALHED E  + +S  S   +       S+Y
Sbjct  61   EMFYNRSTATSGIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTPSSY  120

Query  114  AASTPGHVPNQGAYHDFSTAHSTTR---AISDAFelerlrsevvevkeevkairrevMNE  170
            AASTPG+  + G +HDFST ++TT    AIS  F+LERL SEV+++K EVK IRREVMNE
Sbjct  121  AASTPGN--HAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNE  178

Query  171  LHVTRYDVLKELALLKGAIAQLAATQHlspaasvsstessssdplsadeRAALTRQTSTK  230
            LHVTRYDVLKEL LLKGAIAQLA+T+ L+ ++SVSST+SSSSDPLS+DERAALTRQT TK
Sbjct  179  LHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSSDERAALTRQTPTK  238

Query  231  TSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFT  290
            TS ATR+RLAA R N +K PP A RAS RLTQLAPVAD+ALSTPL  QQIN+ FPLIDFT
Sbjct  239  TSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFT  298

Query  291  SELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFR  350
            SELAAHARSLTPGSR+WALTR++EWLDARF++G+DTLLAVVGEGG+GKSAF GTVAQQFR
Sbjct  299  SELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFR  358

Query  351  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAG  410
            GNLLAAHCCQFDRKSKS PRNVLLSMVHQLVD+LP FKNQLARLNL+YVLEE DPF+LA 
Sbjct  359  GNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLAN  418

Query  411  KVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKP  470
            KVL+DPLNA+EEP H+TF+L+DGIDQC+ G  GRNELLEF +Q+I LLPSWVGF+VSSKP
Sbjct  419  KVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKP  478

Query  471  SSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAY  530
            SSKLAK LPVSSVLDFSAKNGAFV+D SSLVED+++ FSD+DA EAK++L +KSGGNFAY
Sbjct  479  SSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAY  538

Query  531  LEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPL  590
            LEFTKQALSHPGMA  S  G VPLSVL ELPETLYDIYAEIFEDKFGQG AR WGKAKPL
Sbjct  539  LEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPL  598

Query  591  LQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWL  650
            LQLIVGAAAGPYSLVTEEQAKK  +L A+DLRMLR SFVD+VAV+H              
Sbjct  599  LQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH--------------  644

Query  651  SDPARSEEQFYFAIDDAIQALrsmrrsvsssshsnsgssddspptsrrGHtssrassrvt  710
                  EEQFYF+I+DA+ ALR MR + SS S S                  SRA+SR  
Sbjct  645  ------EEQFYFSIEDALLALRKMRLNSSSDSSSGDPGISSDKNAPDHNRRLSRANSRGK  698

Query  711  tsksNQRAHTRHDPRAT-QEFKPVGILKRNKL  741
                +Q    RH+PR   + +KPVGILKR KL
Sbjct  699  LPNKSQ----RHEPRTNFENYKPVGILKRGKL  726

>HYAP_07104
Length=721

 Score = 811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/660 (70%), Positives = 526/660 (80%), Gaps = 10/660 (2%)

Query  18   DANWALDEDSLRLKQTQddalrldrsttltdtvnvtddvEEMFYGGRSTVSD--VPQYRT  75
            D  W LDEDS+RLKQ QD  +RLDRS TLTDTVN TDDVEEMFY    T S    PQYR+
Sbjct  14   DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS  73

Query  76   TEQLRGTHMTLSALHEDaeasnasssfsqfsattpsNYAASTPGHVPNQGAYHDFSTAHS  135
            TEQL G  +TL++L+EDAE  +  S+ S   +    +  A++   V     +H  +T+ S
Sbjct  74   TEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFSDH--ATSISSVNLTSTHHHLTTSTS  131

Query  136  TT---RAISDAFelerlrs-evvevkeevkairrevMNELHVTRYDVLKELALLKGAIAQ  191
                 RA+  A         E++EVK+EV AIR+ V+NELHVTRYDVLKELALLKGAIAQ
Sbjct  132  MMSHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQ  191

Query  192  LAATQHlspaasvsstessssdplsadeRAALTRQTSTKTSSATRERLAASRANIHKTPP  251
            L  T      +   S + S S+PLS+ +R ALTRQTST TSSATR+RLAASR N +K PP
Sbjct  192  LTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPP  251

Query  252  PAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTR  311
            PAARASVRLTQLAPVAD+ALSTPL+  Q+ND+FPLIDFT+ELAAHAR LTPGSRTWALTR
Sbjct  252  PAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTR  311

Query  312  VEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRN  371
             EEWL++RF  G D LLAVVGEGG+GKSAF GTVAQQ+RG L+AAHCCQFDRK KSSPRN
Sbjct  312  AEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRN  371

Query  372  VLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHATFMLV  431
            VLLS+VHQLV +LP FKNQLARLNLKYVLEEADP +LA KVLVDPLNA+E+P+   FMLV
Sbjct  372  VLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLV  431

Query  432  DGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNG  491
            DGIDQC+ GP GRNELLEF AQ+IP LPSW+G +VSSKPSSKLAKRLPVSSVLDFSAKN 
Sbjct  432  DGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNE  491

Query  492  AFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGA  551
            AFV+DVSSLV+++A +F   D  EAK+VLK KSGGNFAYLEFTKQALS  GMA+ SKEG 
Sbjct  492  AFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSKEGV  549

Query  552  VPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAK  611
            V + VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL +GA AGPYS VTEEQA+
Sbjct  550  VAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQ  609

Query  612  KHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQFYFAIDDAIQAL  671
            +HF LT EDLR+LR SFVDLVAV+HG YRIE+SALC WL DPAR+EEQFYF IDDA+QAL
Sbjct  610  EHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQAL  669

>PYIW_19969
Length=733

 Score = 588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/610 (50%), Positives = 401/610 (66%), Gaps = 46/610 (8%)

Query  62   GGRSTVSDVPQYRTTEQLRGTHMTLSALHEDaeasnasssfsqfsattpsNYAASTPGHV  121
            GG   V+DV  YRTTEQLRGT   L  L ED     AS                +T   +
Sbjct  113  GGSLRVTDV--YRTTEQLRGT-ANLIPLQEDEVLPAASR--------------TTTTSQM  155

Query  122  PNQGAYHDFSTAHSTTRAISDAFelerlrsevvevkeevkairrevMNELHVTRYDVLKE  181
            P  G Y   S  +S   +  DA   E    ++       +      MNE+HVTRYDVLKE
Sbjct  156  PTNGNY---SNGNSGGGSQLDALRTELSEMKLEVQAIRREM-----MNEMHVTRYDVLKE  207

Query  182  LALLKGAIAQLAATQHlspaasvsstessssdplsadeRAALTRQTSTKTSSATRERLAA  241
            + +LKG I QL         ++                   ++R T+  TS AT++R A 
Sbjct  208  VTMLKGTILQLVTALETKGLSTDEIN--------------TISRTTALFTSKATKDRRAT  253

Query  242  SRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLT  301
                   + P   RAS RLTQLAPVAD ALSTPL   QI++MFPLI+ + EL A +R+  
Sbjct  254  RD---ESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYD  310

Query  302  PGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQF  361
              SR WA+ R +EW+D+RFNVG D LLA+VGEGG+GKS   G ++ +F  N++A H C F
Sbjct  311  SSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTF  370

Query  362  DRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAME  421
            DRKSKSSPRNVLLS+V+Q++ +LP FKNQLARLNLKYVLEE+DP VLA K+LVDPL A+E
Sbjct  371  DRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALE  430

Query  422  EPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVS  481
            EPM A   ++DG+DQC +  RGRN+LL+F A +IP LP+W+G  ++SKPS +L  RL +S
Sbjct  431  EPMTAKVFMIDGLDQCKS--RGRNDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAIS  488

Query  482  SVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHP  541
            S+LDFSAKN  +++D   ++ D+  +FSD D  +A+++LK+KSGGNF +L+FTKQALSHP
Sbjct  489  SLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHP  548

Query  542  GMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGP  601
            GM      G +PL VLH+LPE++Y+IY EIFEDKFG+GR R+W K +PLL+LIV AA+GP
Sbjct  549  GM--EEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRNRIWKKVQPLLELIVTAASGP  606

Query  602  YSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQFY  661
            Y+L+TE QA++ F L+ ED+R +R SFVD++ VRHG YRIE+SAL  WL DP R+ EQFY
Sbjct  607  YALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFY  666

Query  662  FAIDDAIQAL  671
              +   + AL
Sbjct  667  VDVSGGMSAL  676

>PYIR_13418
Length=747

 Score = 585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/614 (50%), Positives = 410/614 (67%), Gaps = 47/614 (8%)

Query  62   GGRSTVSDVPQYRTTEQLRGTHMTLSALHEDaeasnasssfsqfsattpsNYAASTPGHV  121
            GG   V+D+  YRTTEQ+RGT+  L  L ED     AS + +          A ++ G  
Sbjct  120  GGSLRVTDM--YRTTEQMRGTN--LMPLQEDEVLPAASRATT--------TMATASNGGN  167

Query  122  PNQGAYHDFSTAHSTTRAISDAFelerlrsevvevkeevkairrevMNELHVTRYDVLKE  181
            P      + S      +AI                       RRE+MNE+HVTRYDVLKE
Sbjct  168  PIDALRAELSEMKLEVQAI-----------------------RREMMNEMHVTRYDVLKE  204

Query  182  LALLKGAIAQLAATQHlspaasvsstessssdplsadeRA----ALTRQTSTKTSSATRE  237
            + +LKG I QL          S+ ++ ++       +  +     ++R T+  TS AT+E
Sbjct  205  ITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSDELDTISRTTALYTSKATKE  264

Query  238  RLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHA  297
            R    RA    + P   RAS RLTQLAPVAD+ALSTPL   QI++MFPL++ ++EL A A
Sbjct  265  R----RATREDSAPVLVRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFA  320

Query  298  RSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAH  357
            ++  P SR WA+ R +EW+D+RFNVG D LLA+VG+GG+GKS   G +  +F  N++A H
Sbjct  321  QNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMH  380

Query  358  CCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPL  417
             C FDRKSKSSPRNVLLS+V+QL+ +LP FKNQLARLNLKYVLEE DP VLA KVLVDPL
Sbjct  381  LCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPL  440

Query  418  NAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKR  477
             A+EEP+ A   + DGIDQC +  +GRN+LL+F A +IP LP+WVG  ++SKPS +L  +
Sbjct  441  CALEEPLTAKVFVFDGIDQCKS--KGRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAK  498

Query  478  LPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQA  537
            L ++S+LDFSAKN  +++D   L+ D+  NFSD D  +A+++LK+KSGGNF +L+FTKQA
Sbjct  499  LAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQA  558

Query  538  LSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGA  597
            LSHPGM      G +PL VLH+LPE++Y+IY EIFEDKFG+GR+R+W K +PLL+LIV A
Sbjct  559  LSHPGM--EEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRSRIWKKVQPLLELIVTA  616

Query  598  AAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSE  657
            A+GPY+L+TE QA++ F+L+ ED+R +R +FVD++AV HG YRIE+SAL  WL DP R+ 
Sbjct  617  ASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAG  676

Query  658  EQFYFAIDDAIQAL  671
            EQFY  +   +  L
Sbjct  677  EQFYVDVSGGMNLL  690

>PYU1_G001733
Length=732

 Score = 583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/505 (55%), Positives = 370/505 (73%), Gaps = 7/505 (1%)

Query  168  MNELHVTRYDVLKELALLKGAIAQL-AATQHlspaasvsstessssdplsadeRAALTRQ  226
            MNE+HVTRYDVLKE+ +LKG I QL AA +        +   +     LS  +   +TR 
Sbjct  174  MNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRT  233

Query  227  TSTKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPL  286
            T+  TS AT++RLAA    +   P      + RLTQLAPVAD+ALSTPL   QI+DMFPL
Sbjct  234  TAVHTSKATKDRLAARE--VTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPL  291

Query  287  IDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVA  346
            +DF+++L  HA+   P SR WA  R ++W+D+RFNVG D LLA+VG+GG+GKS  +G + 
Sbjct  292  VDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALC  351

Query  347  QQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPF  406
             +F  N++A H C+FDRKSKSSPRNVLLS+V+QL+ +LP FKNQLARLNLKYVLEE DP 
Sbjct  352  DRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPL  411

Query  407  VLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMV  466
            VLA KVLVDPL A+EEP+ A  +LVDGIDQC +  + RN+LL+F A +IP  P+W+G  +
Sbjct  412  VLARKVLVDPLCALEEPLTAKVLLVDGIDQCKS--KDRNDLLDFLAAIIPEFPTWLGIFI  469

Query  467  SSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGG  526
            +SKPS +L  +L ++S+LDFS KN  +++D   L+ D+  NFSD D +EA+ +LK+KSGG
Sbjct  470  TSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGG  529

Query  527  NFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGK  586
            NF +L+FTKQALSHPGM    + G VPL VLH+LPE++Y+IY EIFEDKFG+G  R+W K
Sbjct  530  NFTFLDFTKQALSHPGM--EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKK  587

Query  587  AKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSAL  646
             +PLL LIV AA+GPY+L+TEEQA++ F+L+ +D+RM+R +F D++ VRHG YR+E+SA+
Sbjct  588  VQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAM  647

Query  647  CGWLSDPARSEEQFYFAIDDAIQAL  671
              WL DP RS EQFY  I  ++  L
Sbjct  648  YEWLVDPQRSGEQFYVNISASMDIL  672

>PYAP_17763
Length=794

 Score = 544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/512 (53%), Positives = 366/512 (71%), Gaps = 13/512 (3%)

Query  168  MNELHVTRYDVLKELALLKGAIAQLAATQHls--------paasvsstessssdplsade  219
            MNE+H+TRYDVLKE+ +LKG I QL +    S         AA++       ++ LS +E
Sbjct  202  MNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTATAAAMGIDVPPQANELSPEE  261

Query  220  RAALTRQTSTKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQ  279
            + AL+R+T+T  S  T+ER+  +R +  + PP     S RLTQLAPV D+ALSTPL  +Q
Sbjct  262  KEALSRKTTTVVSKVTKERITTTRED--QIPPVLRSTSSRLTQLAPVDDSALSTPLHQEQ  319

Query  280  INDMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKS  339
            I+DMFPLIDF++E+   +R    GSR W   RV+EWLD+RFNVG D +LA+VG+ G+GK+
Sbjct  320  IDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKT  379

Query  340  AFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYV  399
                +V  ++   ++A H C+FDRK+KSSPRNVLLS+V+QL  SLP FK+QLARLNLKYV
Sbjct  380  VAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARLNLKYV  439

Query  400  LEEADPFVLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLP  459
            LEE D   L+ KVL+DPLNA+EEP+   F++ D IDQC  G  G N+L +F + +IP  P
Sbjct  440  LEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGV-GYNDLQDFLSAIIPECP  498

Query  460  SWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKV  519
             W+GF+VSSKPS + A  +PVSSVLDFSA+N  +++D   L+ D+A  F DND AEAK++
Sbjct  499  KWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQAEAKQI  558

Query  520  LKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQG  579
            LK KSGGN++YLEFTKQALS+PGM  AS  G VP+ VLH+LP++LY+IY EIFEDKFG+G
Sbjct  559  LKTKSGGNYSYLEFTKQALSNPGMEEAS--GFVPVDVLHDLPQSLYEIYEEIFEDKFGKG  616

Query  580  RARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAY  639
            R RVW KA P+LQLI  AA+GPY+ +TE+      + T +++RMLR +F+D++++RHG Y
Sbjct  617  RTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISIRHGTY  676

Query  640  RIESSALCGWLSDPARSEEQFYFAIDDAIQAL  671
             I SSA+  WL+D  R  EQ++  ++  ++ L
Sbjct  677  AIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVL  708

>PYAR_13571
Length=666

 Score = 520 bits (1339),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 253/505 (50%), Positives = 350/505 (69%), Gaps = 51/505 (10%)

Query  168  MNELHVTRYDVLKELALLKGAIAQLAATQHlspaasvsstessssdplsadeRAALTRQT  227
            MNE+H +RYDVLKE+ +LKG I QL  T                           + R+T
Sbjct  126  MNEMHTSRYDVLKEVTMLKGTITQLIET---------------------------MARRT  158

Query  228  STKTSSATRERLAASRANIHKTPPPAARA-SVRLTQLAPVADNALSTPLTPQQINDMFPL  286
            +T  S +T+ER+  +R ++    PP  RA SVRLTQLAPV D+ALSTPLT +QI+++FPL
Sbjct  159  TTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPL  215

Query  287  IDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVA  346
            +DF++E+   AR    G+R WA  RV+EWLD+RFNVG D LLA+VG+ GTGK+       
Sbjct  216  LDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-------  268

Query  347  QQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPF  406
                      H C+F+RK KSSPRNVLLS+V+QL  +LP FK+QLARLNLKYVLEE D  
Sbjct  269  ----------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDVL  318

Query  407  VLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMV  466
             LA KVLVDPL ++EEP+ A F+L+DG+DQC     G N+LL+F + V+P  PSW+GF++
Sbjct  319  ALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPSWLGFLI  377

Query  467  SSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGG  526
            ++KPS + A+++PV+S+LDFSAKN A+V+D + L+ D+   F   D A+A ++LK KS G
Sbjct  378  TTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCG  437

Query  527  NFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGK  586
            N++YLEFT+QA+S+PGM A   +G+VP+ VLH+LP++LY+IY EIFEDKFG+GR R+W K
Sbjct  438  NYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRK  495

Query  587  AKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSAL  646
            A P+LQLI  AA+GPY+ +TE+      +   +D+RMLR +F+D++++RHG Y I SSAL
Sbjct  496  ALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSAL  555

Query  647  CGWLSDPARSEEQFYFAIDDAIQAL  671
              WL+DP R  E ++  +   ++ L
Sbjct  556  FDWLTDPQRKGEPYHVDVTLHVKVL  580

>PYVX_23590
Length=689

 Score = 444 bits (1142),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 253/506 (50%), Positives = 326/506 (64%), Gaps = 71/506 (14%)

Query  168  MNELHVTRYDVLKELALLKGAIAQLAATQHlspaasvsstessssdplsadeRAALTRQT  227
            MNELHV RYDVLKE+ +LKGA+AQL A        + S   S+ S   +A   ++ + + 
Sbjct  170  MNELHVLRYDVLKEVTVLKGAVAQLLAALAPGGGDAGSRPGSAGSATSAATTASSSSAEL  229

Query  228  STKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLI  287
            S            A RA I   P            LAPV D ALS PL P+Q++++FPL+
Sbjct  230  S-----------PADRAAIGVAP-----------TLAPVDDAALSAPLRPEQLDELFPLV  267

Query  288  DFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQ  347
            D ++++AA AR+  PG+R WA  RV+EWLD+RFNVG DTLL VVG  GTGKS F G+V  
Sbjct  268  DASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCD  327

Query  348  QFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFV  407
              +GN+LA H C+FDRK+KS+PR VLLS+V Q+V +LPPFK QLARLNLKYVLEE D FV
Sbjct  328  MLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFV  387

Query  408  LAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRG--RNELLEFFAQVIPLLPSWVGFM  465
            LAGKVL+DPL A EEP+ A  +++DG+DQC    RG  RNELLEF A V+P LPSW+G +
Sbjct  388  LAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVL  447

Query  466  VSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSG  525
            VSSKP+ +LA +L  +S+LDFS KN  FV D   LV+D+A NF+D  AAEA+++L+ K+G
Sbjct  448  VSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAG  507

Query  526  GNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWG  585
            GNFAYL+FT+QALS PG+     +G + L +LH+LPE+LY+IY EIFED           
Sbjct  508  GNFAYLDFTRQALSSPGL----DDGELELDMLHDLPESLYEIYLEIFEDN----------  553

Query  586  KAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSA  645
                                             +D+R+++ SFVD++AVR G YRIESSA
Sbjct  554  ---------------------------------DDMRLVKRSFVDIIAVRGGCYRIESSA  580

Query  646  LCGWLSDPARSEEQFYFAIDDAIQAL  671
            L  WLSDPARS E F+F  D  +  L
Sbjct  581  LFEWLSDPARSGESFFFDADAGVDEL  606

>CCA22843
Length=586

 Score = 340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 188/503 (37%), Positives = 295/503 (59%), Gaps = 18/503 (4%)

Query  171  LHVTRYDVLKELALLKGAIAQLAA--TQHlspaasvsstessssdplsadeRAALTRQTS  228
            +  TRYD++KE+  L+G +  +    T+    ++   + E+ ++   +A   +A   +  
Sbjct  85   IQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHTTANKTAFSESAEDDEII  144

Query  229  TKTSSATRERLAASRANIHKTPPPAARASVRLTQLA---PVADNALSTPLTPQQINDMFP  285
            ++  +  R  + A  +  +K+     R + + +  +   P+ ++ LS PL   + ++MFP
Sbjct  145  SRFITPERSTIVADCS--YKSGFVTERLNTKDSSFSTSVPLDESQLSKPLDKDEFDEMFP  202

Query  286  LIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTV  345
             ID  S+L ++A  L  G+R WAL RV+EW+++ F   +D +L ++GEGG+GKS   G +
Sbjct  203  CIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYI  262

Query  346  AQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADP  405
             Q+F   L A H CQFDRKS+SS R+V+LS+V Q     P +K QL  LNL+Y+L+E++P
Sbjct  263  CQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASKNPLYKRQLTCLNLRYILKESNP  322

Query  406  FVLAGKVLVDPLNAMEEPMHAT---FMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWV  462
             V+A K+L++PL A+  P+  +   F+L DGIDQC       N+LL+  + +    PS +
Sbjct  323  LVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLVENES-NDLLDLISHITQRFPSCI  379

Query  463  GFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQ  522
            GF+V+SK S     +    S++    +NG F++D   L+E+   NF      EA  +L +
Sbjct  380  GFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMENSILNFEPKHTNEACDILMR  439

Query  523  KSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRAR  582
            KSGGN  YL+FT++ALSHP +    +   + L VL ELP+++ DI+  IFEDKFGQG  R
Sbjct  440  KSGGNGLYLQFTERALSHPILHG--ERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQR  497

Query  583  VWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIE  642
            VW   KP+L+ IV AAAG + LV E Q K+ F L  E+ RM++ SF D++      YRI 
Sbjct  498  VWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEGYRII  557

Query  643  SSALCGWLSDPARSEEQFYFAID  665
            +S+L  WL    RS+   +F ID
Sbjct  558  TSSLFAWLIVENRSQ---HFYID  577

>CCI44111
Length=576

 Score = 337 bits (865),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 191/497 (38%), Positives = 280/497 (56%), Gaps = 22/497 (4%)

Query  171  LHVTRYDVLKELALLKGAIAQLA--------ATQHlspaasvsstessssdplsadeRAA  222
            +  TRYD+LKE+  LKG +A ++        A  +     + + +  S     +      
Sbjct  78   IQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTANGSACSEGADDNEILSNF  137

Query  223  LTRQTSTKTSSATR-ERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQIN  281
            +T   ST  S  +   RL +  + + ++  P          L  + +  LS PL+  +I+
Sbjct  138  VTPDRSTVLSDCSHITRLVSQSSILRESGLPT---------LMTMDEANLSKPLSKDEID  188

Query  282  DMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAF  341
            +MFPLID + ++ ++A  L  G+R WAL  + +W+ + F  G++ +L +VGEGG GKS  
Sbjct  189  EMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTL  248

Query  342  LGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLE  401
             G V Q+F  NL A H  QFDRK  SS R+V+LS+V Q    L  +K QL RLNL+Y+L 
Sbjct  249  AGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRLNLRYILA  308

Query  402  EADPFVLAGKVLVDPLNAMEEPMHA-TFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPS  460
            E++P V+A K+L+DPL A+ E      F+L DGIDQC    +  N+LLE  + +    PS
Sbjct  309  ESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQS-NDLLELLSHITERFPS  367

Query  461  WVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVL  520
            W+GF+V+SK     A RL  +SV+     N  F+ D   L+E++   F      EA  +L
Sbjct  368  WIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDIL  427

Query  521  KQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGR  580
             +KSGGN  YL+F  +ALSHP +    ++  + L VL ELPE++ +I   IF+DKFGQG 
Sbjct  428  MRKSGGNSLYLQFINRALSHPILHG--EQTFLSLDVLDELPESVDEIIFTIFDDKFGQGH  485

Query  581  ARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYR  640
             RVW  AKP+L++IV AAAGPY LV E Q K+ F L   + RM+  +F D++      YR
Sbjct  486  QRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGYR  545

Query  641  IESSALCGWLSDPARSE  657
            I +S+L  WL    RS+
Sbjct  546  IINSSLYDWLVVEKRSQ  562

>SPRG_06355
Length=713

 Score = 258 bits (658),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 172/556 (31%), Positives = 279/556 (50%), Gaps = 74/556 (13%)

Query  168  MNELHVTRYDVLKELALLKGAIAQLAATQHlspaasvsstessssdplsadeRAALTRQT  227
            M ELH T+YD+LKE+ +L+GA+ QL    H  P A+ +    +    LS    A ++ + 
Sbjct  161  MMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTEDRKLSVMSDATVSSEA  220

Query  228  STKTSSATRERLAASRANI------HKTPPP----------AARASVRLTQLA-------  264
             +++S+     +      +       +TP P          + RAS +L++ +       
Sbjct  221  DSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVRESIRASSKLSRESSKLSRES  280

Query  265  -----------------PVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTW  307
                             P+ D AL+ P     +N   P ++        A  + P +RTW
Sbjct  281  SKISRESSKLFRESTRQPIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTW  335

Query  308  ALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKS  367
            A+ +  +W           +L VVG  G GKS  L  +   +   ++A+H  ++D +  +
Sbjct  336  AINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAT  395

Query  368  SPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHAT  427
            S   +L+S+ HQ+   LP F+ QL RLNL Y+++E DP VLA K+L++PL +M  P+ + 
Sbjct  396  S--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQ  453

Query  428  FMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFS  487
             +++D +D+ ++ P G N L+   A V    PSWV F++SS+P   + K LP   VL F 
Sbjct  454  VIVLDAVDEDASTP-GTN-LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFH  511

Query  488  AKNGAFVSDVSSLVEDVARNFSDNDAAEAKKV---LKQKSGGNFAYLEFTKQALSHPGMA  544
             ++  F +D +  V+    +  D    + K +   LK KS G+F YL+F  QA       
Sbjct  512  MEHRPFAADCTIAVQ----SLMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAF------  561

Query  545  AASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAA------  598
             A     +   ++ ELP+TLY+IY ++FE+K+G+GR RVW K +P+L+ IVGAA      
Sbjct  562  -AMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEK  620

Query  599  -AGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRH--GAYRIESSALCGWLSDPAR  655
             A P+  VTE   +  F L   DL ++  SF D+VAV    G YR++S  L  +L D +R
Sbjct  621  NACPF--VTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQSKGLFDYLVDTSR  678

Query  656  SEEQFYFAIDDAIQAL  671
            S+E  +  ++  +  L
Sbjct  679  SQEVAHINVERGVHYL  694

>SDRG_01763
Length=736

 Score = 235 bits (599),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 151/465 (32%), Positives = 245/465 (53%), Gaps = 40/465 (9%)

Query  225  RQTSTKTSSATRE--RLAASRANIHKTPPPAARASVRL----TQLAPVADNALSTPLTPQ  278
            R+++  +S  +RE  +L+   + + +     +R S +L    +   P+ D AL+ P    
Sbjct  275  RESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQPWE-N  333

Query  279  QINDMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGK  338
             +N   P ++        A  + P +RTWA+ +  +W           +L VVG  G GK
Sbjct  334  VLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGK  389

Query  339  SAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKY  398
            S  L  +   +   ++A+H  ++D +   +P  +L+S+ HQ+   LP ++ QL RLNL Y
Sbjct  390  STLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKLPDYQQQLVRLNLPY  447

Query  399  VLEEADPFVLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLL  458
            +++E DP VLA K+L++PL +M  P+ +  +++D +D+  + P G N L+   A V    
Sbjct  448  LIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTP-GAN-LISLLADVALEF  505

Query  459  PSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKK  518
            PSWV F++SS+    + K LP   VL F  ++  F +D +  V+ V     D    + K 
Sbjct  506  PSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVM----DKHGLDDKN  561

Query  519  V---LKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDK  575
            +   LK KS G+F YL+F  QA S   M  +  +  + L    ELP+TL++IY ++FE+K
Sbjct  562  ILFLLKAKSQGSFLYLQFVDQAFS---MIHSEIDAGMIL----ELPKTLHEIYDQVFEEK  614

Query  576  FGQGRARVWGKAKPLLQLIVGAA-------AGPYSLVTEEQAKKHFNLTAEDLRMLRHSF  628
            +G+GR RVW K + +L+ IVGAA       A P+  VTE   +  F L   DL ++  SF
Sbjct  615  YGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLGQPDLALIARSF  672

Query  629  VDLVAVRH--GAYRIESSALCGWLSDPARSEEQFYFAIDDAIQAL  671
             D+V V    G YR++S  L  +L D ARS+E  +  ++  I  L
Sbjct  673  EDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717

 Score = 40.8 bits (94),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%)

Query  168  MNELHVTRYDVLKELALLKGAIAQLAATQH  197
            M ELH T+YD+LKE+ +L+GA+ QL    H
Sbjct  174  MMELHTTKYDLLKEMTMLRGAVMQLVDAMH  203

>SDRG_04575
Length=1003

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 109/228 (48%), Gaps = 12/228 (5%)

Query  254  ARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRVE  313
            A+   RL Q+A      L       ++  +F    F ++++ + +      R W L +++
Sbjct  399  AKYPQRLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLD  456

Query  314  EWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAH-CCQFDRKSKSSPRNV  372
            +W        HD +  + G+ GTGKSA    + Q  R  + A H  C+ D +++S  R  
Sbjct  457  QWKQT-----HDQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSH-RRC  509

Query  373  LLSMVHQLVDSLPPFKNQLARLN-LKYVLEEADPFVLAGKVLVDPLNAMEEPMHATF-ML  430
            +LS+ +QL   LP + + L + + L+ V+  +    L   +LV PL+A+ EP      +L
Sbjct  510  ILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVIL  569

Query  431  VDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRL  478
            +DG+D         N L+     ++  LPSWV  +++S+    + ++L
Sbjct  570  LDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKL  617

>SPRG_12621
Length=1003

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 89/177 (50%), Gaps = 10/177 (6%)

Query  305  RTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAH-CCQFDR  363
            R W L ++++W        HD +  V G+ GTGKSA    + Q  R  + A H  C+ D 
Sbjct  461  REWVLDQLDQWKQT-----HDQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDE  514

Query  364  KSKSSPRNVLLSMVHQLVDSLPPFKNQLARLN-LKYVLEEADPFVLAGKVLVDPLNAMEE  422
            +++S  R  +LS+ +QL   LP + + L + + L+ V+  +    L   +LV PL A+ E
Sbjct  515  QTQSH-RRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAE  573

Query  423  PMHATF-MLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRL  478
            P      +L+DG+D         N L+     ++  LPSWV  +++S+    + ++L
Sbjct  574  PATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKL  630

>H257_11773
Length=1026

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 81/353 (23%), Positives = 145/353 (41%), Gaps = 29/353 (8%)

Query  254  ARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRVE  313
             + +VRL QL       L       ++  +F    F +E++   +      R W + ++ 
Sbjct  421  VKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLT  478

Query  314  EWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVL  373
            EW              + G+ GTGK+A   +V Q  +  + A H    + +   + R  +
Sbjct  479  EW-----KASSSQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCV  532

Query  374  LSMVHQLVDSLPPFKNQLARLN--LKYVLEEADPFVLAGKVLVDPLNAMEEPMHATF-ML  430
            LS+ +QL   LP +   L + +  L+ ++  +    L   +LV PLNA+ +P      +L
Sbjct  533  LSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVIL  592

Query  431  VDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLP--VSSV-LD--  485
            +DG+D         N  +   A  +  LP WV ++++S+    + ++L   V  V LD  
Sbjct  593  IDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKC  652

Query  486  -FSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMA  544
                ++        +LV+ VA    D  AA  + ++ ++S G F Y      ALS   + 
Sbjct  653  GHQTRDDMLKYLQLALVQFVANADKDVPAATLRFIV-ERSEGLFLYASHIVNALSQKRLT  711

Query  545  AASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGA  597
                     L  L   P  +     + FED+F           +PLL+++  A
Sbjct  712  ---------LDKLESFPVGMGGYLRQYFEDQFTALHYET--SVRPLLEVLCAA  753

>PYIR_14107
Length=1176

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 96/468 (21%), Positives = 185/468 (40%), Gaps = 83/468 (18%)

Query  253  AARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRV  312
            A R S+R  QL       L       ++  +   + F  +++          R W   ++
Sbjct  500  AVRYSIRKDQLVTALKGKLDHEGQQARLFSILSPLSFQQQISKLTSRF--AGREWLFMQL  557

Query  313  EEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNV  372
            E W+ +        +  V G+ G+GK+A    + Q     + A H    + +   + R  
Sbjct  558  ENWIASPTAT---QVFWVTGQIGSGKTALAARMVQVI-PEIAAFHFALQEDEQTQNARRC  613

Query  373  LLSMVHQLVDSLPPFKNQL-ARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHAT--FM  429
            +LS+ +QL   LP +   L +R  L+ ++  ++   L  ++LV+PLN +  P       +
Sbjct  614  VLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARPQSTKPLVL  673

Query  430  LVDGI--------------------------------DQCSAGPRGRNELLEFFAQVIPL  457
            L+DG+                                D C++ P G   L+     ++  
Sbjct  674  LIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVSALPSLVAR  733

Query  458  LPSWVGFMVSSKPSSKLAKRL---PVSSVLDFSAKNGAFVSDVSSLVEDV----------  504
            LP+WV  ++ S+    +  +L     S VLD S K+ +   D+   VE++          
Sbjct  734  LPNWVRVVLLSRLDPAIVAKLQGYTPSIVLD-SLKSES-QQDIKRYVENMLGESPATTLR  791

Query  505  -----------ARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVP  553
                       A  FS+  + E   ++ ++S G F Y     Q++         +E  + 
Sbjct  792  RGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI---------EEKRLA  842

Query  554  LSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKH  613
            +  L  LP  +   + + F+  F + + +     +P+L+++  A+  P+SL         
Sbjct  843  VDQLESLPIGMGGYFRQFFDGHFDEQQYQ--DSIRPVLEVLC-ASFEPFSLWN---IVSI  896

Query  614  FNLTAEDLRMLRHSFVDLVAV-RHGAYRIESSALCGWLSDPARSEEQF  660
             N    D + +  SF  L+++   G  R   S++C W+ DPA + + F
Sbjct  897  LNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAGKYF  944

>SDRG_07983
Length=991

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/226 (27%), Positives = 96/226 (42%), Gaps = 29/226 (13%)

Query  254  ARASVRLTQLAPVADNALSTPLTPQQINDMFPLID---FTSELAAHARSLTPGSRTWALT  310
            AR   R  QL    D  +      QQ   +F L+    F S+++   +     +R W L 
Sbjct  391  ARYKTRYHQLLSALDGQIGLDHDGQQAR-LFSLLSPFSFQSQISKLTQLFV--AREWVLA  447

Query  311  RVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPR  370
            + + W+          +  + G  G+GKSA +  + Q  R  + A H    +     S R
Sbjct  448  KYDAWVQ---TPNGSRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEEDQTQSAR  503

Query  371  NVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFV----LAGKVLVDPLNAMEEPMHA  426
              +LS+V+QL   LP + N    +N +  LEE  P      L   +L+ PL+A+  P   
Sbjct  504  RCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVKSLVDLIHALLIAPLSAIAHPASI  560

Query  427  TFMLVDGIDQCSAGPRGRNELLEFFAQV---IPLLPSWVGFMVSSK  469
              +L+DGID    G         F A +   + L PSWV F+  ++
Sbjct  561  LVLLIDGIDCFEPG---------FVATLTAHMDLWPSWVRFVFGTR  597

>SPRG_19030
Length=1000

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 77/173 (45%), Gaps = 23/173 (13%)

Query  304  SRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDR  363
            +R W L + + W+          +  V G  G+GKSA +  + Q  R  + A H    + 
Sbjct  449  AREWVLAKYDAWVQ---TPNGSRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  504

Query  364  KSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFV----LAGKVLVDPLNA  419
                S R  +LS+V+QL   LP + N    LN +  LEE  P      L   +L+ PL+A
Sbjct  505  DQTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLSA  561

Query  420  MEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQV---IPLLPSWVGFMVSSK  469
            +  P     +L+DGI+    G         F A +   + L PSWV F+  ++
Sbjct  562  IAHPASILVLLIDGIECFEPG---------FVATLTAHMDLWPSWVRFVFGTR  605

>H310_08292
Length=1007

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 97/226 (43%), Gaps = 10/226 (4%)

Query  255  RASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRVEE  314
            + +VR+ QL       L       ++  +F    F +E+A   +      R W + ++ +
Sbjct  407  KYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIAKFTQGF--AGREWVMDQLTQ  464

Query  315  WLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLL  374
            W              V G+ GTGK+A    + Q  +  + A H    D +   +PR  +L
Sbjct  465  W-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCIL  518

Query  375  SMVHQLVDSLPPFKNQLARLN-LKYVLEEADPFVLAGKVLVDPLNAMEEPMHATF-MLVD  432
            S+ +QL   LP +   L +   L+ ++  +    L   +LV PLNA+ +P      +L+D
Sbjct  519  SLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILLD  578

Query  433  GIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRL  478
            G+D         N  +     ++  LPSWV  + +S+    + ++L
Sbjct  579  GLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKL  624

>H257_01934
Length=1022

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/245 (25%), Positives = 107/245 (44%), Gaps = 21/245 (9%)

Query  244  ANIHKTPPPA--ARASVRLTQLAPVADNALSTPLTPQQINDMFPLID---FTSELAAHAR  298
            ++ H TP     AR S R  QL    +  +      QQ   +F L+    F S+++   +
Sbjct  400  SSFHTTPWTLHDARYSTRREQLIAALNGRVGLDQEGQQAR-LFSLLSPFSFQSQISTATQ  458

Query  299  SLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHC  358
                  R W L   +EW+ +  +      L + G  G+GK+A    + Q  R  ++A H 
Sbjct  459  GYC--GRAWVLHEFDEWVTSPPSNARRVFL-LTGVIGSGKTALAAHIIQN-RPEVVAFHL  514

Query  359  CQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFV-----LAGKVL  413
               + +   + R  +L++V+QL   LP + N L   + K  LEE   FV     L  ++L
Sbjct  515  ASHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEET-VFVGNLADLVQELL  571

Query  414  VDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSK  473
            + PL  +  P     +L+DGI+     P   + L+      +   P+W+ F+ +S+   +
Sbjct  572  IAPLERIATPPSTMVILIDGIE---CFPCADDNLVAILTASLNRWPAWMRFVFTSREDPR  628

Query  474  LAKRL  478
            +   L
Sbjct  629  VLSLL  633

>PYVX_21513
Length=1446

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/336 (20%), Positives = 135/336 (40%), Gaps = 46/336 (14%)

Query  305  RTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRK  364
            R W   RV++W++   +     +  + G+ G+GK++    + Q F   + A H    +  
Sbjct  438  RDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDD  496

Query  365  SKSSPRNVLLSMVHQLVDSLPPFKNQL-ARLNLKYVLEEADPFVLAGKVLVDPLNAMEEP  423
                 R  +LS+ +QL   LP +   L +R  L+ ++  +    L   +LV+PLN ++ P
Sbjct  497  QTHIARRCVLSLAYQLTTQLPEYGVFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRP  556

Query  424  MHATFMLVDGIDQCSAG-------------PRGRNE--LLEFFAQVIPLLPSWVGFMVSS  468
                 +L+DG++   +G             P    +  L+     ++  LPSWV  ++ S
Sbjct  557  AKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLS  616

Query  469  KPSSKLAKRLPV---SSVLD-FSAKNGAFVSDVSSLVEDVARNFSD-NDAAEAKKVLKQK  523
            +    +  RL     S V+D F+ +N   +           ++ +D  +AA A+   + +
Sbjct  617  REDHDVMTRLQTYIPSVVIDHFAQENECDIKKFVGSALAPKKSLADIVEAATAETSGRSR  676

Query  524  SGGNFAYLEFTKQALSHPG----------------------MAAASKEGAVPLSVLHELP  561
                  ++ F +   + PG                      +    +EG V L+ L +LP
Sbjct  677  LTTLARHVSFIRSPRNRPGATTEQIEMIARRAEGLFLYAANIVQGIEEGRVALNELDKLP  736

Query  562  ETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGA  597
              +     + F+  F     +     +P L+++  A
Sbjct  737  TGMGGCLRQFFDSHFDDNTYKT--TIRPALEVLCAA  770

>PYAP_22230
Length=1116

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 95/425 (22%), Positives = 154/425 (36%), Gaps = 99/425 (23%)

Query  305  RTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRK  364
            R W L  + +W++     G   +  V G+ G+GK++    + Q     + A H    D  
Sbjct  496  RAWLLESIRQWINTPVTSG-SKVFWVTGQIGSGKTSVAARMVQ-LMPEIAAFHFALQDDD  553

Query  365  SKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPF----VLAGKVLVDPLNAM  420
                 R  +LS+ +QL   LP +      L     LEE  P      L   +LV+PLNA+
Sbjct  554  QTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAI  610

Query  421  EEPM--HATFMLVDGI-------DQCSAGP--------RGRNE-----------------  446
              P       +L+DG+       D  + GP        RG                    
Sbjct  611  ARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGSSD  670

Query  447  --LLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPV---SSVLDFSAKNGAFVSDVSSLV  501
              L+     +I  LP WV  ++ S+    +  +L V   S  LD   +     +D+   V
Sbjct  671  ECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENE--ADIREFV  728

Query  502  E-----------------------------DVARNFSDND----AAEAKKVLKQKSGGNF  528
            E                               A + SDN     +AE  +V+ ++S G F
Sbjct  729  EMALCSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKISAEQVEVITKRSEGLF  788

Query  529  AYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAK  588
             Y     QA+         +EG + +  L  LP  L     + FE  F     +   K +
Sbjct  789  LYAANIVQAI---------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYKT--KIR  837

Query  589  PLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAY-RIESSALC  647
            P+L+++  A    Y  +T       F+ +  + + +  SF  L+ V    Y R   S++ 
Sbjct  838  PVLEVLCAA----YEPMTTAMLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSSVL  893

Query  648  GWLSD  652
             W+ D
Sbjct  894  EWVQD  898

>PYAR_14788
Length=795

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 78/378 (21%), Positives = 138/378 (37%), Gaps = 62/378 (16%)

Query  318  ARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMV  377
            A  N     +  V G+ G GK++    + Q     + A H    +       R  +LS+ 
Sbjct  409  ASINELRSKVFWVTGQIGAGKTSVAAKMVQTI-PEIAAFHFALQEDDQTQLARRCVLSLA  467

Query  378  HQLVDSLPPFKNQLARLNLKYVLEEADPFV----LAGKVLVDPLNAMEEPM--HATFMLV  431
            +QL   LP +      L     LEE  P      L   +L+ PLNA+  P       +L+
Sbjct  468  YQLTTQLPAYA---VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLI  524

Query  432  DGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRL-PVSSVLDFSAKN  490
            DG++  ++   G    +     +I  LPSWV  ++ S+    +  +L   S  +    + 
Sbjct  525  DGLEHLASNTGGAGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRRE  584

Query  491  GAFVSDVSSLVE------------------------DVARNFSDNDAA-----------E  515
                 D+   VE                         +  +F+++  A           E
Sbjct  585  QENEEDIRGFVEAALCSPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSE  644

Query  516  AKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDK  575
              +++ ++S G F Y     Q++         +EG + +  L  LP  L     + FE  
Sbjct  645  QVELITKRSEGLFLYAVNIVQSI---------EEGRLSVDQLASLPLGLGGYLRQFFESH  695

Query  576  FGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVR  635
            F     +   K +P+L+++  A    Y  +T       F+ +  D   +  SF  L  + 
Sbjct  696  FDDTTYKT--KIRPVLEVLCAA----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCIS  749

Query  636  HGAY-RIESSALCGWLSD  652
               Y R   S++  W+ D
Sbjct  750  DDGYMRPFHSSVLEWVQD  767

>PHYSO_470533
Length=1084

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 79/354 (22%), Positives = 137/354 (39%), Gaps = 67/354 (19%)

Query  305  RTWALTRVEEWLDARF---------NVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLA  355
            R W   R ++W+              + +  +  +VG+ G+GK++    + Q     + A
Sbjct  472  REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTC-PEIAA  530

Query  356  AHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADP---FV-LAGK  411
             H  + + +   + R  +LS+ +QL   LP + + L        LEE  P   FV L  +
Sbjct  531  FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVSQ  587

Query  412  VLVDPLNAMEEP--MHATFMLVDGID--------------QCSAGPRGRNELLEFFAQVI  455
            +L+ PLNA+  P    +  +L+DGI+                S G +    L+     + 
Sbjct  588  LLIGPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALA  647

Query  456  PLLPSWVGFMVSSKPS----SKLAKRLPVSSVLD-FSAKNGAFV----------------  494
              LP WV  +V S+      SKL    P   ++D F  +N   +                
Sbjct  648  SRLPDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEV  707

Query  495  --SDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAV  552
              +  S    DV  N  +    +  +++ ++S G F Y     QA++         EG +
Sbjct  708  DFAKASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT---------EGRL  758

Query  553  PLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVT  606
             L  L ELP  +     + F   F         + +P+L+++  AA  P  L T
Sbjct  759  RLHELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLEVLC-AAYEPLPLAT  810

>PYIW_15717
Length=1121

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 91/437 (21%), Positives = 170/437 (39%), Gaps = 103/437 (24%)

Query  305  RTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRK  364
            R W   ++E W+ +        +  V G+ G+GK+A    + Q     + A H    + +
Sbjct  525  REWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMVQLI-PEIAAFHFALQEDE  580

Query  365  SKSSPRNVLLSMVHQLVDSLPPFKNQL-ARLNLKYVLEEADPFVLAGKVLVDPLNAMEEP  423
               + R  +LS+ +QL   LP + + L +R  L+ ++  ++   L  ++LV+PLN +  P
Sbjct  581  QTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARP  640

Query  424  MHAT---FMLVDGIDQC---------SAGPRGRNE---------------------LLEF  450
              AT    +L+DG++           +  P GR                       L+  
Sbjct  641  QTATKPLVLLIDGLEHLVSDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLVSA  700

Query  451  FAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSS---VLD-FSAKNGAFVSDVSSLVEDV--  504
               ++  LP WV  ++ S+    +  +L   +   VLD F  +N     D+ S VE +  
Sbjct  701  LPSLVARLPKWVRVVLLSRKDPAIIAKLQGHTPNVVLDRFERENQ---QDIKSYVEKILG  757

Query  505  ----------------------ARNFSDNDAA------------------EAKKVLKQKS  524
                                   RN S + +                   E   ++ ++S
Sbjct  758  EPSPQQVGVYGSPGQPPAPMLMPRNRSPSISTLPGSNAISAGVQTSKLSPEQVNLIVKRS  817

Query  525  GGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVW  584
             G F Y     Q++         +E  +P+S L  LP  +   + + F+  F + + +  
Sbjct  818  EGLFLYAVNIVQSI---------EERRLPVSQLESLPIGMGGYFRQFFDSHFDEQQYK--  866

Query  585  GKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAV-RHGAYRIES  643
               +P+L+++  A+  P+SL T        + +  D + +  SF  L+ V   G  R   
Sbjct  867  DSIRPVLEVLC-ASFEPFSLAT---IASILSWSVYDQQEIAASFGSLLFVGADGNIRPFH  922

Query  644  SALCGWLSDPARSEEQF  660
            S++  W+ D A + E F
Sbjct  923  SSVLDWVQDLATAGEYF  939

>PPTG_11365
Length=1106

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 84/202 (42%), Gaps = 32/202 (16%)

Query  305  RTWALTRVEEWLDARF------NVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHC  358
            R W   + + W+           + +  +  VVG+ G+GK++    + Q     + A H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSC-PEIAAFHL  561

Query  359  CQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADP---FV-LAGKVLV  414
               + +   + R  +LS+ +QL   LP + + L        LEE  P   FV L   +L+
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLI  618

Query  415  DPLNAMEEP--MHATFMLVDGIDQC------------SAGPRGRNELLEFFAQVIPL---  457
             PL A+  P    +  +L+DG++              S G    N+  E F  ++P+   
Sbjct  619  GPLTAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVS  678

Query  458  -LPSWVGFMVSSKPSSKLAKRL  478
             LP WV  ++ S+    +  +L
Sbjct  679  RLPEWVRIVLLSREEPPVLSKL  700

>PITG_17250
Length=1046

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 79/346 (23%), Positives = 138/346 (40%), Gaps = 59/346 (17%)

Query  305  RTWALTRVEEWLD----ARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQ  360
            R W     + W+     +   + +  +  V+G+ G+GKS+    + Q     + A H   
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQAC-PEIAAFHFAT  508

Query  361  FDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADP---FV-LAGKVLVDP  416
             + +   + R  +LS+ +QL   LP + + L        LEE  P   FV L   +L+ P
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLIGP  565

Query  417  LNAMEEP--MHATFMLVDGID-----QCS---AGPRGRNELLEFFAQVIPL----LPSWV  462
            LNA+  P    +  +L+DG++      C+    G    ++  E    ++P+    LP WV
Sbjct  566  LNAIARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWV  625

Query  463  GFMVSSKPSSKLAKRL-----PVSSVLDFSAKNGA----FVSDVSSLVEDVARNF-----  508
              ++ S+    +  +L     P   +  F  +N      F+S   S +     +F     
Sbjct  626  RIVLLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASA  685

Query  509  ---SDNDAAE-----AKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHEL  560
               S +D  E       +++ ++S G F Y     QA+S         EG + L  L EL
Sbjct  686  QIGSGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS---------EGRLRLHELAEL  736

Query  561  PETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVT  606
            P  +     + F   F         + +P+L+ +  AA  P  L T
Sbjct  737  PVGMGAYLHQFFASHFADHDVYK-HRIRPVLE-VCCAAYEPLPLAT  780

>PITG_06580
Length=1214

 Score = 35.8 bits (81),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 42/104 (40%), Gaps = 10/104 (10%)

Query  325  DTLLAVVGEGGTGKSAFLGTVAQQFR----------GNLLAAHCCQFDRKSKSSPRNVLL  374
            D  L +V    T  S+   +V Q             GNLL+A     D   K+ P NV +
Sbjct  445  DISLKIVNSSRTMSSSKFASVQQALERLMAKYTTLYGNLLSADVHSADDVGKTMPLNVFV  504

Query  375  SMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLN  418
               H  V SL  F+++  R N        +   LA + L+ P+N
Sbjct  505  YSFHVFVVSLLEFEDKFNRKNFSARYRVKNFIKLACRSLLQPVN  548

>PYVX_15878
Length=1347

 Score = 35.8 bits (81),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 6/116 (5%)

Query  297  ARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQF--RGNLL  354
            ARSL   S    + R E   +A       T+  V+G+ G+GKSA +  ++ QF    N+ 
Sbjct  76   ARSLARMSPMKRVVRKEVIKNASGVFKPGTITLVLGQPGSGKSALMKMLSGQFPVESNI-  134

Query  355  AAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAG  410
                 + D      P+  L+  V Q ++ +P      A L  +  LE A  FV  G
Sbjct  135  ---TVEGDITYNGVPQKELIKRVPQFIEYVPQSDKHFATLTTRETLEYAHKFVGGG  187

>PPTG_02543
Length=1373

 Score = 35.4 bits (80),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 52/116 (45%), Gaps = 6/116 (5%)

Query  297  ARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQF--RGNLL  354
            ARSL   S    + R E   +A       T+  V+G+ G+GKSA +  ++ QF    N+ 
Sbjct  73   ARSLARMSPMRRVVRKEVIKNASGVFKPGTITLVLGQPGSGKSALMKMLSAQFPVESNIT  132

Query  355  AAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAG  410
                  ++      P+  ++  V Q V+ +P      A L ++  LE A  F+ AG
Sbjct  133  VEGEITYN----GVPQKDVIKRVPQFVEYVPQSDKHFATLTVRETLEYAHKFIGAG  184

>PHYCA_532286
Length=1213

 Score = 35.4 bits (80),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query  329  AVVGEGGTGKSAF-------LGTVAQQFRGNLLA--AHCCQFDRKSKSSPRNVLLSMVHQ  379
            AVVG  G+GKS         LG  ++Q R N L    H    D ++ S  R+  +++V++
Sbjct  29   AVVGPNGSGKSNLMDAISFVLGVNSRQLRSNQLKDLIHRAPSDSEAVSKTRSAFVTLVYE  88

Query  380  LVD-SLPPFKNQLAR  393
            L +   PP K+Q A+
Sbjct  89   LTEKETPPSKSQAAQ  103

>PHYRA_84772
Length=1376

 Score = 35.4 bits (80),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 51/116 (44%), Gaps = 6/116 (5%)

Query  297  ARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQF--RGNLL  354
            ARSL   S    + R E   +A       T+  V+G+ G+GKSA +  ++ QF    N+ 
Sbjct  76   ARSLARMSPMRRVVRKEVIKNASGVFKPGTITLVLGQPGSGKSALMKMLSAQFPVESNIT  135

Query  355  AAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAG  410
                  ++      P+  ++  V Q V+ +P      A L  +  LE A  FV AG
Sbjct  136  VEGEITYN----GVPQKDIIKRVPQFVEYVPQSDKHFATLTTRETLEYAHKFVGAG  187

>PHYCA_525156
Length=1382

 Score = 34.7 bits (78),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 41/87 (47%), Gaps = 6/87 (7%)

Query  326  TLLAVVGEGGTGKSAFLGTVAQQF--RGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDS  383
            T+  V+G+ G+GKSA +  ++ QF    N+       ++      P+  ++  V Q V+ 
Sbjct  110  TITLVLGQPGSGKSALMKMLSAQFPVESNITVEGEITYN----GVPQKEIVKRVPQFVEY  165

Query  384  LPPFKNQLARLNLKYVLEEADPFVLAG  410
            +P      A L  +  LE A  FV AG
Sbjct  166  VPQSDKHFATLTTRETLEYAHKFVGAG  192

>PPTG_13828
Length=958

 Score = 34.7 bits (78),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 0/68 (0%)

Query  351  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAG  410
            GNLL+A     D   K+ P NV +   H  V SL  F+++  R N        +   LA 
Sbjct  227  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFLKLAC  286

Query  411  KVLVDPLN  418
            + L+ P+N
Sbjct  287  RSLLQPVN  294

>PPTG_13827
Length=1212

 Score = 34.7 bits (78),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 0/68 (0%)

Query  351  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAG  410
            GNLL+A     D   K+ P NV +   H  V SL  F+++  R N        +   LA 
Sbjct  481  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFLKLAC  540

Query  411  KVLVDPLN  418
            + L+ P+N
Sbjct  541  RSLLQPVN  548

>PYAP_22855
Length=527

 Score = 34.3 bits (77),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  320  FNVGHDTLLAVVGEGGTGKSAFLGTVA  346
             N+GHD++L ++G  G G+S FL  +A
Sbjct  120  LNLGHDSILYLLGSPGIGRSCFLVLIA  146

>PYVX_21776
Length=203

 Score = 33.1 bits (74),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  311  RVEEWL-DARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQF  349
            +++EWL D + +VG D +LAVVG      S+F    AQQF
Sbjct  106  KIKEWLRDLQSHVGEDIVLAVVGNKSDCASSFDFAQAQQF  145

>PHYSO_498286
Length=936

 Score = 33.9 bits (76),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 99/255 (39%), Gaps = 26/255 (10%)

Query  242  SRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLT  301
            S+ + HK     +R     +    V D   + PL  Q ++ + PL+     L A     +
Sbjct  557  SKHHFHKPTSIQSRGIHLSSSFFSVGDTMCAAPLMQQALDHLTPLVISEQRLVARVFFPS  616

Query  302  PGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQF  361
            P  R      +EE L        + LL  + E   G++A L  +       +L     + 
Sbjct  617  PTERADGKHELEE-LTVMMEGVFEKLLKRMNE--FGEAAGLRNILDALALVVLVNGNLEE  673

Query  362  DRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAME  421
             R+  +   NV++S           F+ Q+ R+ +K+  EE + ++ A  V    +  + 
Sbjct  674  YRQQSAFLYNVMVS-----------FQLQMKRMLIKFT-EEQEAWISAQNVDTK-MAGVL  720

Query  422  EPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVS  481
             P+     ++  +++  AG    + L+  +  ++P    W+  +  S+P      RL   
Sbjct  721  APVKKIVNMIARMEESVAGKASDSTLVSIYNMIVPATMQWLDKVSESRPKYAALTRL---  777

Query  482  SVLDFSAKNGAFVSD  496
                   +N  F+SD
Sbjct  778  -------ENYLFLSD  785

>PYIR_23360
Length=227

 Score = 32.7 bits (73),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  311  RVEEWL-DARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQF  349
            +V+EWL D R +VG D +LA+VG      S+F    AQQF
Sbjct  109  KVKEWLQDLRHHVGDDIVLAIVGNKCDVASSFNFAKAQQF  148

>PHYSO_545378
Length=224

 Score = 32.7 bits (73),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  308  ALTRVEEWL-DARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQF  349
            +  +++EWL D + +VG D +LAVVG      S F  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSTFDFSKAQQF  141

>PHYKE_4995
Length=1373

 Score = 33.5 bits (75),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 40/87 (46%), Gaps = 6/87 (7%)

Query  326  TLLAVVGEGGTGKSAFLGTVAQQF--RGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDS  383
            T+  V+G+ G+GKSA +  +A QF    N+       ++      P+  ++  V Q V+ 
Sbjct  103  TITLVLGQPGSGKSALMKMLAGQFPIESNITVEGEITYN----GVPQKDIVKRVPQFVEY  158

Query  384  LPPFKNQLARLNLKYVLEEADPFVLAG  410
            +P      A L  +  LE A  FV  G
Sbjct  159  VPQSDRHFATLTTRETLEYAHKFVGGG  185

>PHYRA_79519
Length=1240

 Score = 33.5 bits (75),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 31/68 (46%), Gaps = 0/68 (0%)

Query  351  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAG  410
            GNLL+A     D   K+ P NV +   H  V SL  F+ +  + N        +   LA 
Sbjct  501  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVISLLEFEEKFNKKNFSARYRVKNFIKLAC  560

Query  411  KVLVDPLN  418
            + L+ P+N
Sbjct  561  RSLLQPIN  568

>PHYCA_532676
Length=1662

 Score = 33.1 bits (74),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 6/80 (8%)

Query  326  TLLAVVGEGGTGKSAFLGTVAQQF--RGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDS  383
            TL  V+G+ G+GKS+ +  ++ +F    N+       ++  S+   R    S + QLV  
Sbjct  323  TLTLVLGQPGSGKSSLMKILSGRFPASKNVTVEGEVTYNGTSQEELR----SKLPQLVSY  378

Query  384  LPPFKNQLARLNLKYVLEEA  403
            +P     LARL++K  LE A
Sbjct  379  VPQHDKHLARLSVKETLEFA  398

>PHYCA_534503
Length=1089

 Score = 33.1 bits (74),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 32/68 (47%), Gaps = 0/68 (0%)

Query  351  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAG  410
            GNLL+A     D   K+ P NV +   H  V SL  F+++  R N        +   LA 
Sbjct  608  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVISLLEFEDKFNRKNFSARYRVKNFLKLAC  667

Query  411  KVLVDPLN  418
            + L+ P++
Sbjct  668  RSLLQPIS  675

Lambda      K        H        a         alpha
   0.319    0.131    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 59587612842

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40