Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_78819102002007192e-96
PPTG_16671102092115012e-63
PITG_00012101852074914e-62
PHYCA_104436101812044904e-62
PHYSO_554653102202204545e-56
PHYCA_97367203391912033473e-40
PPTG_07275203391841963161e-35
HYAP_01509102082033067e-34
PHALS_10836102041992744e-29
PYVX_15869103312061932e-16
PYIW_191578196826241750.71
PYU1_G0032268196820620721.2
CCI42021333887637703.7
PYVX_158671118727667.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_78819

Length=201
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_78819                                                           281        2e-96
PPTG_16671                                                            197        2e-63
PITG_00012                                                            193        4e-62
PHYCA_104436                                                          193        4e-62
PHYSO_554653                                                          179        5e-56
PHYCA_97367                                                           138        3e-40
PPTG_07275                                                            126        1e-35
HYAP_01509                                                            122        7e-34
PHALS_10836                                                           110        4e-29
PYVX_15869                                                            79.0       2e-16
PYIW_19157                                                            33.5       0.71 
PYU1_G003226                                                          32.3       1.2  
CCI42021                                                              31.6       3.7  
PYVX_15867                                                            30.0       7.9  

>PHYRA_78819
Length=200

 Score = 281 bits (719),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFNDVKYDFsks  60
            MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFNDVKYDFSKS
Sbjct  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFNDVKYDFSKS  60

Query  61   rppsslppsssnsHADITQrsnmssgsgsrsaspmnYSYeeeeeeRHVQFLFYggsdppt  120
            RPPSSLPPSSSNSHADITQRSNMSSGSGSRSASPMNYSYEEEEEERHVQFLFYGGSDPPT
Sbjct  61   RPPSSLPPSSSNSHADITQRSNMSSGSGSRSASPMNYSYEEEEEERHVQFLFYGGSDPPT  120

Query  121  ptsaggpggYRSDMISNYVEPISPAAFASPRINHEMPCFFSPRNTPAQSPMSAPIYSPHL  180
            PTSAGGPGGYRSDMISNYVEPISPAAFASPRINHEMPCFFSPRNTPAQSPMSAPIYSPHL
Sbjct  121  PTSAGGPGGYRSDMISNYVEPISPAAFASPRINHEMPCFFSPRNTPAQSPMSAPIYSPHL  180

Query  181  FKIAEQRHRHSAGHYSRYSR  200
            FKIAEQRHRHSAGHYSRYSR
Sbjct  181  FKIAEQRHRHSAGHYSRYSR  200

>PPTG_16671
Length=209

 Score = 197 bits (501),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 160/211 (76%), Gaps = 13/211 (6%)

Query  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFN-DVKYDFsk  59
            MG+S+FFHSVWD + RPFE+CTSCCDVLDP+YYRKTSPGVRRSPQMFNR+  DVKY+ + 
Sbjct  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60

Query  60   srpps-----slppsssnsHADITQrsnmssgsgsrsaspmnYSYeeeeeeRHVQFLFYg  114
            SRPPS     +     +  H   T  S+  S SGS S SP NYSYEEE+E R VQFLFYG
Sbjct  61   SRPPSSLPPFASSQVGTREHQSKT-LSSSGSRSGSNSDSPSNYSYEEEDE-RQVQFLFYG  118

Query  115  gsd--pptptsaggpggYRSDMISNYVEPISPAA-FASPRINHEMPCFFSPRNTPAQSPM  171
            GSD   PT        GYRSDMISNYVEP+SPAA   SPRINHEMPCFFSPR+TP QSPM
Sbjct  119  GSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPM  178

Query  172  SAPIYSPHLFKIAEQR-HRHSAGHYS-RYSR  200
            SAPIYSPHLFKI+EQR  R S G+YS RYSR
Sbjct  179  SAPIYSPHLFKISEQRTSRRSTGYYSMRYSR  209

>PITG_00012
Length=185

 Score = 193 bits (491),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 150/207 (72%), Gaps = 29/207 (14%)

Query  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFN-DVKYDFsk  59
            MG+SEFFHSVWD + RPFE+CTSCCDVLDP+YYRKTSPGV RSPQMFNR+   VKY+ + 
Sbjct  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITS  60

Query  60   srppsslppsssnsHADITQrsnmssgsgsrsaspmnYSYeeeeeeRHVQFLFYggs---  116
            SRPPSS   S S S+                      YSYEEEEEER VQFLFYGGS   
Sbjct  61   SRPPSSGSRSDSPSN----------------------YSYEEEEEERQVQFLFYGGSDPP  98

Query  117  dpptptsaggpggYRSDMISNYVEPISPAA-FASPRINHEMPCFFSPRNTPAQSPMSAPI  175
             P +       GGYRSDMISNYVEP+SPAA   SPRI+HEMPCFFSPRNTP QSPMSAPI
Sbjct  99   TPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSAPI  158

Query  176  YSPHLFKIAEQR-HRHSAGHYS-RYSR  200
            YSPHLFKI+EQR  R S G+Y+ RYSR
Sbjct  159  YSPHLFKISEQRMSRRSTGYYNMRYSR  185

>PHYCA_104436
Length=181

 Score = 193 bits (490),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 145/204 (71%), Gaps = 27/204 (13%)

Query  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFNDVKYDFsks  60
            MGVS FF  +WDL+R+PFE+CTSCCDVLDP+YYRKTSPGVRRSPQMFNR+   +YD    
Sbjct  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRW---EYDVQSK  57

Query  61   rppsslppsssnsHADITQrsnmssgsgsrsaspmnYSYeeeeeeRHVQFLFYggsd--p  118
               SS   S S++++ +                   YSYEEE+E R VQFLFYGGSD   
Sbjct  58   TLSSSGSRSGSSANSPLN------------------YSYEEEDE-RQVQFLFYGGSDPPT  98

Query  119  ptptsaggpggYRSDMISNYVEPISPAA-FASPRINHEMPCFFSPRNTPAQSPMSAPIYS  177
            P         GYRSDMISNYVEP+SPAA   SPRI+HEMPCFFSPRNTP QSPMSAPIYS
Sbjct  99   PNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYS  158

Query  178  PHLFKIAEQR-HRHSAGHYSRYSR  200
            PHLFKIAEQR  R SAG+Y R+SR
Sbjct  159  PHLFKIAEQRTTRRSAGYY-RFSR  181

>PHYSO_554653
Length=220

 Score = 179 bits (454),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 154/220 (70%), Gaps = 23/220 (10%)

Query  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFN-DVKYDFsk  59
            MG+SEFF  +WDL+R PFE+CTSCCDVLDP+YYRKTSPGVRR+PQMFNR++ DVK+D   
Sbjct  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGS  60

Query  60   srppsslpp-----sssnsHADITQrsnmssgsgsrsaspmnYSYe-----------eee  103
            + P    P        S+SHA  TQRS  S  S S S+                   EEE
Sbjct  61   NPPSRLPPSFSFSPVISSSHAGRTQRSFTSPASLSGSSPSSGSGSASRSQSPSSYSYEEE  120

Query  104  eeRHVQFLFYggsdpptptsagg-pggYRSDMISNYV---EPISPAAFASPRINHEMPCF  159
            +ER VQFLFYGGSDPPTPT  G  P GYRSDMIS Y+   EPISPA+ ASPRI+HEMPCF
Sbjct  121  DERQVQFLFYGGSDPPTPTGGGAYPSGYRSDMISKYIQPTEPISPASIASPRISHEMPCF  180

Query  160  FSPRNTPAQSPMSAPIYSPHLFKIAEQRHRHSAGHYSRYS  199
            FSPR TP  SPMSAPIYSPHLFKI EQR R+ A +Y RY+
Sbjct  181  FSPRTTPT-SPMSAPIYSPHLFKITEQRTRN-AEYYRRYT  218

>PHYCA_97367
Length=191

 Score = 138 bits (347),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 118/203 (58%), Gaps = 25/203 (12%)

Query  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLD----PNYYRKTSPGVRRSPQMFNRF---NDV  53
            MGVS+FF  VWD + RPFE+C SC +VLD    P YY KTSPGVRR+P  F+R    ND+
Sbjct  1    MGVSDFFQDVWDFVCRPFEDCKSCSEVLDNVLDPYYYGKTSPGVRRTPPTFDRTRWDNDL  60

Query  54   KYDFsksrppsslppsssnsHADITQrsnmssgsgsrsaspmnYSYeeeeeeRHVQFLFY  113
            KYDFS S                 +Q    S      S S    +    EE+  +QFLFY
Sbjct  61   KYDFSLS-------------RPPPSQSPANSRVVFPLSRSRSLSASRSLEEDEQIQFLFY  107

Query  114  ggsdpptptsaggpggYRSDMISNYVEPISPAAFASPRINHEMPCFFSPRNTPAQSPMSA  173
             GSD  T       G YRSD IS  ++PI+      PR++HE+PCFFSPR+ P  +PMSA
Sbjct  108  SGSDISTSDRLCSSG-YRSDAISRPLQPIT----EPPRLSHEIPCFFSPRDAPLMAPMSA  162

Query  174  PIYSPHLFKIAEQRHRHSAGHYS  196
            PIYSPHLF I+EQR R  + HYS
Sbjct  163  PIYSPHLFMISEQRGRSPSRHYS  185

>PPTG_07275
Length=184

 Score = 126 bits (316),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 120/196 (61%), Gaps = 17/196 (9%)

Query  10   VWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRF---NDVKYDFsksrppssl  66
            +WD LRRPFE+C S CDVLDP YY KTSPGVRR+P  F+R    ND+KYDFS SRPP S 
Sbjct  1    MWDFLRRPFEDCKSYCDVLDPYYYSKTSPGVRRNPPKFDRACWENDLKYDFSLSRPPPS-  59

Query  67   ppsssnsHADITQrsnmssgsgsrsaspmnYSYeeeeeeRHVQFLFYggsdppt--ptsa  124
                       +      + S SRS S       EEEEE+ VQFLFYGGSD  T      
Sbjct  60   -------FQSSSSGRMQFTLSRSRSQSRSASVLHEEEEEQQVQFLFYGGSDISTPVSVGK  112

Query  125  ggpggYRSDMISNYVEPISPAAFASPRINHEMPCFFSPRNTPAQSPMSAPIYSPHLFKIA  184
                GYRSD+I   +  +S      PRI+HE+PCFFSPR+TP  SPMSAPIYSPHLF+I 
Sbjct  113  LCSSGYRSDVICTPMRLVS----QPPRISHEIPCFFSPRDTPMMSPMSAPIYSPHLFQIN  168

Query  185  EQRHRHSAGHYSRYSR  200
            EQR R    H  RY +
Sbjct  169  EQRWRLRPRHNGRYLK  184

>HYAP_01509
Length=208

 Score = 122 bits (306),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 129/203 (64%), Gaps = 15/203 (7%)

Query  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRF-NDVKYDFsk  59
            MGVSE  +++   + RPF +C+SC DVLD +YY KTSPGV  SPQMFNR+ NDVK+ +++
Sbjct  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYTR  60

Query  60   srppsslppsss---nsHADITQrsnmssgsgsrsaspmnYSYe----eeeeeRHVQFLF  112
            SRP  S  P           +T+RS  SS      +S  N SY     EEE +R VQFLF
Sbjct  61   SRPLPSRLPPPPPPRTRKKGLTKRSTSSSSRPRSESSSNNPSYYSFEDEEERDRRVQFLF  120

Query  113  Yggs---dpptptsaggpggYRSDMISNYVEPISPAAFASPRINHEMPCFFSPRNTPAQS  169
            YGGS    P +        GYRSDMIS+ V   S  +  SP+INHE+PCFFSPR+TP +S
Sbjct  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAV---SLTSIRSPQINHEIPCFFSPRDTP-RS  176

Query  170  PMSAPIYSPHLFKIAEQRHRHSA  192
             +SA +YSPH+FKI EQ+ R +A
Sbjct  177  SVSASMYSPHVFKITEQKQRRNA  199

>PHALS_10836
Length=204

 Score = 110 bits (274),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 107/199 (54%), Gaps = 9/199 (5%)

Query  3    VSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFNDVKYDF-----  57
            +S F   +WDL+ +PFE C +CCDVLDP YYRK SPG RR+PQMFN +++ K        
Sbjct  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60

Query  58   sksrppsslppsssnsHADITQrsnmssgsgsrsaspmnYSYeeeeeeRHVQFLFYggsd  117
            + S P  S      +  A+  +   +S+      +S  + S  EEE E  + FLFY    
Sbjct  61   TSSFPTLSSSNLEYSCRANDNKFITLSTSRSRSVSSTPSESAHEEEGENQLHFLFY--GG  118

Query  118  pptptsaggpggYRSDMISNYVEPISP-AAFASPRINHEMPCFFSPRNTPAQSPMSAPIY  176
              + +       YR D+IS+  EP SP  +  SPRI+H+MPCFFS    P Q PMS  IY
Sbjct  119  SDSLSPKAVGKRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSDSIY  178

Query  177  SPHLF-KIAEQRHRHSAGH  194
            S +L   I +Q  R   GH
Sbjct  179  SANLLGDIDQQGQRSGTGH  197

>PYVX_15869
Length=331

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 101/206 (49%), Gaps = 23/206 (11%)

Query  3    VSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFN-DVKYDFsksr  61
            +S ++ S    LR PF +C + CD+  P      SPGV   PQ F R + D+KYDF+   
Sbjct  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAGP  200

Query  62   ppsslppsssnsHADITQrsnmssgsgsrsaspmnYSYeeeeeeRHVQFLFY--ggsdpp  119
              SS              +S+  + S     S  ++   ++  ++  QFLFY       P
Sbjct  201  ISSS-----------AASKSSSPARSTRSKTSSDSFLSYDDPYDQPTQFLFYCGSDPLTP  249

Query  120  tptsaggpggYRSDMISNYV-----EPISPAAFASPRINHEMPCFFSPRNTPAQSPMSAP  174
            T        G ++D IS Y      EP      ASPRI+H++P FFSPRN P  SP +AP
Sbjct  250  TSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNAPT-SPAAAP  308

Query  175  IYSPHLFKIAEQRHRHSAGHYSRYSR  200
            +YSPHLF+I E   R    ++ RYSR
Sbjct  309  LYSPHLFRITE---REYDPYFMRYSR  331

>PYIW_19157
Length=262

 Score = 33.5 bits (75),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  147  FASPRINHEMPCFFSPRNTPAQSPMSAPIYSPHLFKIAEQR  187
              +P+++H++P FFSPRN     P   P   P   +I+  R
Sbjct  145  VTTPKLSHQIPVFFSPRNAVPMLPRPKPREKPRPLRISNTR  185

>PYU1_G003226
Length=206

 Score = 32.3 bits (72),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 0/20 (0%)

Query  145  AAFASPRINHEMPCFFSPRN  164
            A  A+P+I+H++P FFSPRN
Sbjct  146  AKVATPKISHQIPVFFSPRN  165

>CCI42021
Length=876

 Score = 31.6 bits (70),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  17   PFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFNDV  53
            PF      CD++D NY ++T   V +SP +F   +D 
Sbjct  128  PFFNNKVVCDLMDANYIKQTRQAVAQSPGIFLVLDDT  164

>PYVX_15867
Length=187

 Score = 30.0 bits (66),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 20/27 (74%), Gaps = 1/27 (4%)

Query  148  ASPRINHEMPCFFSPRN-TPAQSPMSA  173
            A+P I+H+MP FF+P   T A SP++A
Sbjct  151  AAPAISHKMPVFFTPAQPTQATSPLAA  177

Lambda      K        H        a         alpha
   0.329    0.139    0.462    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9138472161

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40