Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_724155698665561631530.0
PHYSO_4800105698665361630670.0
PHYRA_72463926265861630640.0
PHYSO_485614926765361630610.0
PHYCA_104465926765361630490.0
PHYCA_1043356903565661630470.0
PHYSO_486085926565361630420.0
PITG_11244926266361630380.0
PHYSO_344705926279861630340.0
PPTG_02122926265761630340.0
PITG_11249926765361630050.0
PITG_11247926565361630010.0
PYAP_173349729165061629530.0
PHYCA_1044294084764561629520.0
PYU1_G0139279729164961629420.0
SDRG_11899926765260928650.0
H310_0261014834765060928650.0
SPRG_04533926765260928620.0
PHYCA_5329125698662661628490.0
SDRG_1147312211563661128170.0
PYVX_15641926262961627940.0
SPRG_0006812211564361127820.0
PYU1_G013931926266361027750.0
PYIW_16876926264361627750.0
CCI4322116052066061327600.0
PYAP_192359943964361327480.0
CCI40249926766060727350.0
CCA16153926766360727300.0
PITG_11252927065461227270.0
PYAP_17333926265761627220.0
HYAP_01537927065161026980.0
PHYSO_482793927065861026930.0
PHALS_09802927065161026760.0
H257_12958926764960726710.0
H310_09557926764460726680.0
PHYCA_104444927064461726670.0
PHYRA_71655927065361026510.0
PHYKE_7016927065061726460.0
PYAR_198079262161361026350.0
CCA14967152039143159625960.0
PYIR_15859926262661325940.0
PPTG_196902483756656125520.0
CCI4024715245664361725490.0
H257_1732214834760660925430.0
CCA1615115245664361725200.0
PYVX_229818037761261024840.0
HYAP_015407534563462224510.0
PYIR_158579729157761623330.0
PHALS_043303140378544622060.0
PHYKE_69845698645045022030.0
PYIW_168739729149645721320.0
PPTG_0212075345100144120820.0
PHALS_013383001738337919480.0
H310_0943447865861819400.0
PYIW_2175547865861119360.0
PHALS_0083347865261119360.0
PYAR_18354478108461119330.0
PYAP_1334147865761119310.0
PYVX_1673847865861119250.0
PYU1_G00409847865661119220.0
PPTG_0824547865861119180.0
PHYCA_51069647865961119170.0
PHYSO_28637647866061119140.0
PHYRA_7104247865461119100.0
HYAP_0100547866061119050.0
HYAP_010049399666061119050.0
PHYKE_799247865761119040.0
PYU1_G0040979399666360818960.0
PITG_0052747865661118930.0
SDRG_0356447865861218770.0
CCI5023447866561218600.0
CCA2493647866161218570.0
H257_0000712754278760717670.0
CCA20828976178761117670.0
H310_1475912754278760717640.0
H257_18885976178660417640.0
HYAP_12660976178660517630.0
CCI46091976178760517590.0
SDRG_05777976178660517570.0
PPTG_03121976178660517490.0
PYIW_2656716585556453917480.0
PHYRA_478736903539635717470.0
PYIW_221448493763360517460.0
PYIR_243878493763361117430.0
SPRG_1051912754278260517420.0
PITG_11913976178660517420.0
PYVX_18121976163361117370.0
PYAP_222388493763361117360.0
PHYKE_10815976178660517360.0
PHYRA_78193976178660517350.0
PYU1_G0015408493763360517330.0
PHALS_02079976178660517310.0
SPRG_0033347861561217270.0
PHYCA_509820976178660517210.0
SPRG_10477976176259916680.0
PHYRA_418886871958634716640.0
PHYRA_47865926738133716220.0
PYIR_1673747851149115650.0
H310_026044159331229614800.0
PHYRA_722386941960161514620.0
PYU1_G0037541272865062413632e-180
PYAP_197381272864855713623e-180
PYVX_150511272863258313543e-179
H310_066311272865162213442e-177
H257_012771272865256113407e-177
PITG_157861272863362313318e-176
PHYKE_90081272865062413321e-175
PHYRA_711231272863362513282e-175
PHYSO_5254295984561060113253e-175
PPTG_182741272864862513284e-175
PHYCA_5411341272863362513213e-174
PHYSO_5004801272863362513213e-174
SDRG_110431272864956213214e-174
PHALS_076161272867762513192e-173
CCI459821272866161713095e-172
CCA215141272865956413061e-171
SDRG_0581612754247948412732e-169
PYAR_221881272863461012822e-168
PYIR_196971272860859312775e-168
PHYSO_3396666941958560812442e-163
SPRG_022941272863456112396e-162
PITG_153701240847428911481e-150
PYAR_199308493762541711422e-147
PPTG_021219729122221210892e-145
PYAP_16216309756451711083e-143
PHYSO_552116309757052010921e-140
HYAP_01993309756952910841e-139
PPTG_10122309756951710762e-138
PITG_05721486430229210477e-138
PYU1_G006940309756551710719e-138
PHYRA_71591309757051710692e-137
PYAR_144875698646724610481e-135
PITG_03546309756951710536e-135
PYIR_24123309756751710527e-135
PHYKE_64309756951710502e-134
SDRG_10038309756551210483e-134
PPTG_16727927021720410092e-133
SPRG_1113312787367643910426e-132
PHALS_00390309756954410172e-129
PHYCA_5322073097111851910468e-128
PYVX_17692309755152510031e-127
H310_12765309756051110004e-127
SPRG_1569530975815129945e-126
H257_0765030975634909804e-124
PYAR_2470430975254959713e-123
PYIR_16738939965553289664e-122
SDRG_057781275266182409236e-115
CCI4758230975825539145e-114
PYIW_19165309711245169453e-113
CCA2022930975835538999e-112
PITG_15111122191861808532e-110
PYAR_246871058826185438828e-109
PHYSO_54956197613613668451e-106
PYIW_17145127284433918451e-105
PHYKE_2977753452201708152e-104
PITG_16528133105615058324e-102
PHYSO_493381133105625058263e-101
PHYRA_79054133105635068212e-100
PYU1_G002895133105615058132e-99
SDRG_171221278733613707953e-99
PPTG_05819133105615068099e-99
PHYCA_6458133105605088081e-98
PYAR_14579133105675078054e-98
H310_03911133105705167923e-96
PHALS_02692133105575057801e-94
SPRG_01255133105665007811e-94
PYIW_17320133105635007802e-94
PYIR_13638133105435027773e-94
CCI45261133105585087774e-94
PHALS_1279092652141637194e-90
H257_01680133105715187471e-89
PYVX_13615133105855357482e-89
SDRG_010681221786216197493e-89
PHYRA_51904408471291297036e-89
SDRG_16621133105314887398e-89
PYAP_19903133105275027389e-89
CCA22305133105615107374e-88
HYAP_01857133104924677305e-88
SPRG_001831221796096097335e-87
PHALS_00667297021421426908e-87
PHYSO_5252361275422462276694e-82
SPRG_001821221786156186891e-80
H257_167751460792912486579e-80
SDRG_010671221796116126742e-78
SPRG_06720139304253916201e-72
PYVX_13288457648106796451e-72
PHYSO_249932300172322126003e-72
H257_04453139304233896112e-71
PHALS_09281139304653976142e-71
SDRG_16559139304613916116e-71
PYAP_18643457648046786328e-71
PPTG_19375457648096816259e-70
H310_12260139304243896009e-70
PHYRA_53570139303953955989e-70
HYAP_06818127283163005901e-69
SPRG_104761275262702765816e-69
PHALS_04095457648036746161e-68
PHYCA_120845139304443925931e-68
PHYCA_111740415938106836152e-68
PYIR_21692139304683975942e-68
PPTG_09003139304493965914e-68
PHALS_08498127148957186131e-67
PYAR_15468457647696566052e-67
PYIW_142318611412435716183e-67
PITG_17383139304383985817e-67
CCA159131523708576936058e-67
PYIW_19956139304593965811e-66
PYU1_G008851457647953915976e-66
PYU1_G006843139304814115778e-66
CCI467091523708196855933e-65
PHYCA_504114127148873965944e-65
HYAP_07918127148973965883e-64
PITG_15771127148833965848e-64
PYAP_19741127148854055831e-63
PHYRA_82545457648063915792e-63
H310_062291261518003925783e-63
PHYRA_73661127148843985786e-63
H257_164841261517953905748e-63
CCA27145139304634035541e-62
PHYKE_6664457648043905703e-62
PHYSO_2555061271412283985784e-62
PHYKE_9011127149023985672e-61
PYAP_21865139304814105463e-61
PYU1_G000896861147115665567e-61
PYAR_16202127148934055638e-61
SDRG_032661261517923905492e-59
SPRG_080601261517933905474e-59
PHYSO_247517457647946465441e-58
PHYSO_285382139303793535147e-58
PPTG_04054314033242555098e-58
CCA21519127149295525419e-58
PYIR_25979861144384005171e-57
PYIR_24220127149083975382e-57
PYVX_15061127148913975321e-56
HYAP_04460457648183925292e-56
H310_014931481489093975312e-56
PPTG_14555167767035515223e-56
H310_01496127149043975284e-56
PPTG_17083237953042144931e-55
PYU1_G003764127149103965232e-55
HYAP_015389267130944691e-54
H257_00287127148933965143e-54
PYIR_18381457647473915032e-53
PHYSO_339667525751601524616e-53
PHYCA_55893426644894884877e-53
CCI11769139303723614771e-52
SDRG_01828127148665564984e-52
PPTG_18280242463843524735e-52
HYAP_10418139303152974632e-51
CCI45987127149393974914e-51
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_72415

Length=656
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_72415                                                           1219       0.0   
PHYSO_480010                                                          1186       0.0   
PHYRA_72463                                                           1184       0.0   
PHYSO_485614                                                          1183       0.0   
PHYCA_104465                                                          1179       0.0   
PHYCA_104335                                                          1178       0.0   
PHYSO_486085                                                          1176       0.0   
PITG_11244                                                            1174       0.0   
PHYSO_344705                                                          1173       0.0   
PPTG_02122                                                            1173       0.0   
PITG_11249                                                            1162       0.0   
PITG_11247                                                            1160       0.0   
PYAP_17334                                                            1142       0.0   
PHYCA_104429                                                          1141       0.0   
PYU1_G013927                                                          1137       0.0   
SDRG_11899                                                            1108       0.0   
H310_02610                                                            1108       0.0   
SPRG_04533                                                            1107       0.0   
PHYCA_532912                                                          1102       0.0   
SDRG_11473                                                            1089       0.0   
PYVX_15641                                                            1080       0.0   
SPRG_00068                                                            1076       0.0   
PYU1_G013931                                                          1073       0.0   
PYIW_16876                                                            1073       0.0   
CCI43221                                                              1067       0.0   
PYAP_19235                                                            1063       0.0   
CCI40249                                                              1058       0.0   
CCA16153                                                              1056       0.0   
PITG_11252                                                            1055       0.0   
PYAP_17333                                                            1053       0.0   
HYAP_01537                                                            1043       0.0   
PHYSO_482793                                                          1041       0.0   
PHALS_09802                                                           1035       0.0   
H257_12958                                                            1033       0.0   
H310_09557                                                            1032       0.0   
PHYCA_104444                                                          1031       0.0   
PHYRA_71655                                                           1025       0.0   
PHYKE_7016                                                            1023       0.0   
PYAR_19807                                                            1019       0.0   
CCA14967                                                              1004       0.0   
PYIR_15859                                                            1003       0.0   
PPTG_19690                                                            987        0.0   
CCI40247                                                              986        0.0   
H257_17322                                                            984        0.0   
CCA16151                                                              975        0.0   
PYVX_22981                                                            961        0.0   
HYAP_01540                                                            948        0.0   
PYIR_15857                                                            903        0.0   
PHALS_04330                                                           854        0.0   
PHYKE_6984                                                            853        0.0   
PYIW_16873                                                            825        0.0   
PPTG_02120                                                            806        0.0   
PHALS_01338                                                           754        0.0   
H310_09434                                                            751        0.0   
PYIW_21755                                                            750        0.0   
PHALS_00833                                                           750        0.0   
PYAR_18354                                                            749        0.0   
PYAP_13341                                                            748        0.0   
PYVX_16738                                                            746        0.0   
PYU1_G004098                                                          744        0.0   
PPTG_08245                                                            743        0.0   
PHYCA_510696                                                          743        0.0   
PHYSO_286376                                                          741        0.0   
PHYRA_71042                                                           740        0.0   
HYAP_01005                                                            738        0.0   
HYAP_01004                                                            738        0.0   
PHYKE_7992                                                            738        0.0   
PYU1_G004097                                                          734        0.0   
PITG_00527                                                            733        0.0   
SDRG_03564                                                            727        0.0   
CCI50234                                                              721        0.0   
CCA24936                                                              719        0.0   
H257_00007                                                            685        0.0   
CCA20828                                                              685        0.0   
H310_14759                                                            684        0.0   
H257_18885                                                            684        0.0   
HYAP_12660                                                            683        0.0   
CCI46091                                                              682        0.0   
SDRG_05777                                                            681        0.0   
PPTG_03121                                                            678        0.0   
PYIW_26567                                                            677        0.0   
PHYRA_47873                                                           677        0.0   
PYIW_22144                                                            677        0.0   
PYIR_24387                                                            676        0.0   
SPRG_10519                                                            675        0.0   
PITG_11913                                                            675        0.0   
PYVX_18121                                                            673        0.0   
PYAP_22238                                                            673        0.0   
PHYKE_10815                                                           673        0.0   
PHYRA_78193                                                           672        0.0   
PYU1_G001540                                                          672        0.0   
PHALS_02079                                                           671        0.0   
SPRG_00333                                                            669        0.0   
PHYCA_509820                                                          667        0.0   
SPRG_10477                                                            647        0.0   
PHYRA_41888                                                           645        0.0   
PHYRA_47865                                                           629        0.0   
PYIR_16737                                                            607        0.0   
H310_02604                                                            574        0.0   
PHYRA_72238                                                           567        0.0   
PYU1_G003754                                                          529        2e-180
PYAP_19738                                                            529        3e-180
PYVX_15051                                                            526        3e-179
H310_06631                                                            522        2e-177
H257_01277                                                            520        7e-177
PITG_15786                                                            517        8e-176
PHYKE_9008                                                            517        1e-175
PHYRA_71123                                                           516        2e-175
PHYSO_525429                                                          514        3e-175
PPTG_18274                                                            516        4e-175
PHYCA_541134                                                          513        3e-174
PHYSO_500480                                                          513        3e-174
SDRG_11043                                                            513        4e-174
PHALS_07616                                                           512        2e-173
CCI45982                                                              508        5e-172
CCA21514                                                              507        1e-171
SDRG_05816                                                            494        2e-169
PYAR_22188                                                            498        2e-168
PYIR_19697                                                            496        5e-168
PHYSO_339666                                                          483        2e-163
SPRG_02294                                                            481        6e-162
PITG_15370                                                            446        1e-150
PYAR_19930                                                            444        2e-147
PPTG_02121                                                            424        2e-145
PYAP_16216                                                            431        3e-143
PHYSO_552116                                                          425        1e-140
HYAP_01993                                                            422        1e-139
PPTG_10122                                                            419        2e-138
PITG_05721                                                            407        7e-138
PYU1_G006940                                                          417        9e-138
PHYRA_71591                                                           416        2e-137
PYAR_14487                                                            408        1e-135
PITG_03546                                                            410        6e-135
PYIR_24123                                                            409        7e-135
PHYKE_64                                                              409        2e-134
SDRG_10038                                                            408        3e-134
PPTG_16727                                                            393        2e-133
SPRG_11133                                                            405        6e-132
PHALS_00390                                                           396        2e-129
PHYCA_532207                                                          407        8e-128
PYVX_17692                                                            390        1e-127
H310_12765                                                            389        4e-127
SPRG_15695                                                            387        5e-126
H257_07650                                                            382        4e-124
PYAR_24704                                                            378        3e-123
PYIR_16738                                                            376        4e-122
SDRG_05778                                                            360        6e-115
CCI47582                                                              356        5e-114
PYIW_19165                                                            368        3e-113
CCA20229                                                              350        9e-112
PITG_15111                                                            333        2e-110
PYAR_24687                                                            344        8e-109
PHYSO_549561                                                          330        1e-106
PYIW_17145                                                            330        1e-105
PHYKE_2977                                                            318        2e-104
PITG_16528                                                            325        4e-102
PHYSO_493381                                                          322        3e-101
PHYRA_79054                                                           320        2e-100
PYU1_G002895                                                          317        2e-99 
SDRG_17122                                                            310        3e-99 
PPTG_05819                                                            316        9e-99 
PHYCA_6458                                                            315        1e-98 
PYAR_14579                                                            314        4e-98 
H310_03911                                                            309        3e-96 
PHALS_02692                                                           305        1e-94 
SPRG_01255                                                            305        1e-94 
PYIW_17320                                                            305        2e-94 
PYIR_13638                                                            303        3e-94 
CCI45261                                                              303        4e-94 
PHALS_12790                                                           281        4e-90 
H257_01680                                                            292        1e-89 
PYVX_13615                                                            292        2e-89 
SDRG_01068                                                            293        3e-89 
PHYRA_51904                                                           275        6e-89 
SDRG_16621                                                            289        8e-89 
PYAP_19903                                                            288        9e-89 
CCA22305                                                              288        4e-88 
HYAP_01857                                                            285        5e-88 
SPRG_00183                                                            286        5e-87 
PHALS_00667                                                           270        8e-87 
PHYSO_525236                                                          262        4e-82 
SPRG_00182                                                            270        1e-80 
H257_16775                                                            257        9e-80 
SDRG_01067                                                            264        2e-78 
SPRG_06720                                                            243        1e-72 
PYVX_13288                                                            253        1e-72 
PHYSO_249932                                                          235        3e-72 
H257_04453                                                            239        2e-71 
PHALS_09281                                                           241        2e-71 
SDRG_16559                                                            239        6e-71 
PYAP_18643                                                            248        8e-71 
PPTG_19375                                                            245        9e-70 
H310_12260                                                            235        9e-70 
PHYRA_53570                                                           234        9e-70 
HYAP_06818                                                            231        1e-69 
SPRG_10476                                                            228        6e-69 
PHALS_04095                                                           241        1e-68 
PHYCA_120845                                                          233        1e-68 
PHYCA_111740                                                          241        2e-68 
PYIR_21692                                                            233        2e-68 
PPTG_09003                                                            232        4e-68 
PHALS_08498                                                           240        1e-67 
PYAR_15468                                                            237        2e-67 
PYIW_14231                                                            242        3e-67 
PITG_17383                                                            228        7e-67 
CCA15913                                                              237        8e-67 
PYIW_19956                                                            228        1e-66 
PYU1_G008851                                                          234        6e-66 
PYU1_G006843                                                          226        8e-66 
CCI46709                                                              233        3e-65 
PHYCA_504114                                                          233        4e-65 
HYAP_07918                                                            231        3e-64 
PITG_15771                                                            229        8e-64 
PYAP_19741                                                            229        1e-63 
PHYRA_82545                                                           227        2e-63 
H310_06229                                                            227        3e-63 
PHYRA_73661                                                           227        6e-63 
H257_16484                                                            225        8e-63 
CCA27145                                                              218        1e-62 
PHYKE_6664                                                            224        3e-62 
PHYSO_255506                                                          227        4e-62 
PHYKE_9011                                                            223        2e-61 
PYAP_21865                                                            214        3e-61 
PYU1_G000896                                                          218        7e-61 
PYAR_16202                                                            221        8e-61 
SDRG_03266                                                            216        2e-59 
SPRG_08060                                                            215        4e-59 
PHYSO_247517                                                          214        1e-58 
PHYSO_285382                                                          202        7e-58 
PPTG_04054                                                            200        8e-58 
CCA21519                                                              213        9e-58 
PYIR_25979                                                            203        1e-57 
PYIR_24220                                                            211        2e-57 
PYVX_15061                                                            209        1e-56 
HYAP_04460                                                            208        2e-56 
H310_01493                                                            209        2e-56 
PPTG_14555                                                            205        3e-56 
H310_01496                                                            207        4e-56 
PPTG_17083                                                            194        1e-55 
PYU1_G003764                                                          206        2e-55 
HYAP_01538                                                            185        1e-54 
H257_00287                                                            202        3e-54 
PYIR_18381                                                            198        2e-53 
PHYSO_339667                                                          182        6e-53 
PHYCA_558934                                                          192        7e-53 
CCI11769                                                              188        1e-52 
SDRG_01828                                                            196        4e-52 
PPTG_18280                                                            186        5e-52 
HYAP_10418                                                            182        2e-51 
CCI45987                                                              193        4e-51 
SPRG_06288                                                            192        8e-51 
HYAP_01856                                                            180        9e-51 
PITG_21580                                                            187        7e-50 
PYVX_18450                                                            179        3e-49 
PHYSO_321565                                                          184        8e-49 
SPRG_11007                                                            177        4e-48 
PITG_03068                                                            181        5e-48 
PYAR_22140                                                            174        8e-48 
PYIW_19676                                                            181        8e-48 
PPTG_13159                                                            167        3e-47 
PHYSO_249902                                                          151        4e-42 
H310_10060                                                            152        7e-42 
PPTG_10700                                                            150        2e-41 
H257_18082                                                            150        4e-41 
PYU1_G004743                                                          148        2e-36 
PYIW_21045                                                            147        3e-36 
PYAR_13948                                                            145        2e-35 
PHALS_00479                                                           142        2e-34 
HYAP_01510                                                            129        7e-34 
PPTG_22662                                                            135        9e-34 
PPTG_17863                                                            129        1e-33 
PHYKE_7077                                                            139        2e-33 
PYAP_23247                                                            137        1e-32 
PHYSO_353741                                                          137        1e-32 
HYAP_01511                                                            127        1e-32 
PPTG_18422                                                            134        1e-31 
PITG_02259                                                            133        2e-31 
SPRG_00713                                                            132        3e-31 
HYAP_00880                                                            132        6e-31 
SDRG_01561                                                            129        3e-30 
PHYKE_585                                                             129        6e-30 
H257_18435                                                            128        6e-30 
PYIR_14416                                                            128        6e-30 
PPTG_23878                                                            128        1e-29 
PHYCA_502791                                                          127        2e-29 
PYVX_22905                                                            121        2e-27 
PHYRA_80453                                                           118        1e-26 
H310_05216                                                            118        2e-26 
PHYRA_42335                                                           102        4e-25 
PHYSO_342817                                                          100        2e-23 
PYVX_22561                                                            103        2e-22 
SPRG_17185                                                            92.0       1e-21 
HYAP_04461                                                            86.7       9e-19 
PYAP_20766                                                            90.5       5e-18 
PYVX_17117                                                            91.3       7e-18 
PHYRA_46132                                                           82.8       9e-18 
PHYRA_81377                                                           85.9       1e-16 
PHYCA_549822                                                          84.3       3e-16 
PPTG_04864                                                            85.1       3e-16 
PYIW_19781                                                            84.7       4e-16 
PHYRA_82300                                                           84.0       2e-15 
PYU1_G008203                                                          80.5       9e-15 
PYIR_20734                                                            75.1       4e-13 
CCI45196                                                              68.6       1e-12 
PHYSO_532708                                                          72.0       1e-12 
PHYKE_9691                                                            72.0       9e-12 
SPRG_08648                                                            67.8       9e-11 
PITG_03970                                                            65.1       2e-10 
SDRG_10651                                                            66.2       2e-10 
PYAR_19707                                                            59.7       4e-08 
PHYSO_383637                                                          48.9       2e-06 
PPTG_17862                                                            50.4       3e-06 
H257_09465                                                            52.0       7e-06 
PHYSO_530254                                                          47.0       8e-06 
PHYRA_54751                                                           46.2       1e-05 
H310_13261                                                            51.2       2e-05 
PPTG_09610                                                            43.5       7e-05 
PYIR_22849                                                            46.2       2e-04 
PPTG_03570                                                            42.0       0.002 
PPTG_23039                                                            41.6       0.002 
PITG_11248                                                            40.8       0.002 
PPTG_22091                                                            37.7       0.010 
PPTG_05521                                                            37.7       0.010 
PYIW_26103                                                            40.4       0.033 
SDRG_11277                                                            35.8       0.057 
PPTG_23917                                                            35.0       0.094 
CCI47104                                                              38.1       0.15  
PYIW_26201                                                            33.9       3.2   
H310_08056                                                            33.5       5.0   
PPTG_24969                                                            30.4       5.9   
PPTG_10066                                                            32.7       6.7   
H257_04365                                                            32.3       9.4   

>PHYRA_72415
Length=655

 Score = 1219 bits (3153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/616 (100%), Positives = 616/616 (100%), Gaps = 0/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID
Sbjct  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK
Sbjct  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANPILQKMY
Sbjct  601  QKELEGVANPILQKMY  616

>PHYSO_480010
Length=653

 Score = 1186 bits (3067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/616 (97%), Positives = 611/616 (99%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ  TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQT-TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMVAEAEKYKSEDEANKVR
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAYSLRNSLNDEKLKE+IPEADKKVVDDKVTETIQWLDAHQS+E EEYE+K
Sbjct  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANP+LQK+Y
Sbjct  600  QKELEGVANPVLQKVY  615

>PHYRA_72463
Length=658

 Score = 1184 bits (3064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/616 (97%), Positives = 608/616 (99%), Gaps = 0/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  360

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  480

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANKVR
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  540

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAY+LRN+LNDEKLK+QI E DKK ++DKVTETI WLDA+QSAE EEYE K
Sbjct  541  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  600

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANPILQKMY
Sbjct  601  QKELEGVANPILQKMY  616

>PHYSO_485614
Length=653

 Score = 1183 bits (3061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/616 (97%), Positives = 610/616 (99%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ  TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQT-TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPFK++SG GDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFKISSGPGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMVAEAEKYKSEDEANKVR
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAYSLRNSLNDEKLKE+IPEADKKVVDDKVTETIQWLDAHQS+E EEYE+K
Sbjct  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANP+LQK+Y
Sbjct  600  QKELEGVANPVLQKVY  615

>PHYCA_104465
Length=653

 Score = 1179 bits (3049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/616 (96%), Positives = 606/616 (98%), Gaps = 0/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M QA TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  360

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  480

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANK R
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  540

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAYSLRNSLNDEK+KE+IPEADKK VDDKVTE IQWLDA+QS E + YESK
Sbjct  541  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  600

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANP+LQKMY
Sbjct  601  QKELEGVANPVLQKMY  616

>PHYCA_104335
Length=656

 Score = 1178 bits (3047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/616 (96%), Positives = 606/616 (98%), Gaps = 0/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M QA TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  360

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  480

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANK R
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  540

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAYSLRNSLNDEK+KE+IPEADKK VDDKVTE IQWLDA+QS E + YESK
Sbjct  541  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  600

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANP+LQKMY
Sbjct  601  QKELEGVANPVLQKMY  616

>PHYSO_486085
Length=653

 Score = 1176 bits (3042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/616 (96%), Positives = 609/616 (99%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ  TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQT-TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADI+HWPFK++SG GDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIQHWPFKISSGPGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV++F QEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVEYFVQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMVAEAEKYKSEDEANKVR
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAYSLRNSLNDEKLKE+IPEADKKVVDDKVTETIQWLDAHQS+E EEYE+K
Sbjct  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANP+LQK+Y
Sbjct  600  QKELEGVANPVLQKVY  615

>PITG_11244
Length=663

 Score = 1174 bits (3038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/616 (96%), Positives = 607/616 (99%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ+  SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQS-VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK+T+GAGDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITAGAGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANKVR
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAY+LRN+LNDEKLK+QI E DKKV+DDKVTETI WLDA+QSAE EEYE K
Sbjct  540  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKVIDDKVTETINWLDANQSAEKEEYEGK  599

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANPILQKMY
Sbjct  600  QKELEGVANPILQKMY  615

>PHYSO_344705
Length=798

 Score = 1173 bits (3034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/616 (96%), Positives = 606/616 (98%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ+  SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  142  MAQS-VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  200

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQ
Sbjct  201  NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQ  260

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  261  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  320

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  321  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  380

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  381  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  440

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  441  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  500

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  501  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  560

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  561  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  620

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMVAEAEKYKSEDEANKVR
Sbjct  621  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVR  680

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAY+LRN+LNDEKLK+QI E DKK +DDKVTETI WLDA+QSAE EEYE K
Sbjct  681  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGK  740

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANPILQKMY
Sbjct  741  QKELEGVANPILQKMY  756

>PPTG_02122
Length=657

 Score = 1173 bits (3034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/616 (96%), Positives = 605/616 (98%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ+  SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQS-VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK+TSG GDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMVAEAEKYKSEDEANKVR
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAY+LRN+LNDEKLK+QI E DKK +DDKVTETI WLDA+QSAE EEYE K
Sbjct  540  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGK  599

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANPILQKMY
Sbjct  600  QKELEGVANPILQKMY  615

>PITG_11249
Length=653

 Score = 1162 bits (3005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/616 (94%), Positives = 604/616 (98%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M QA TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTQA-TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKFSDP+VQADIKHWPFK+T+G GDKPQITVQFKGE+KTFQ
Sbjct  60   NQVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV+HF QEFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNST
Sbjct  240  LVEHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ++I+RMVAEAEKYKSEDEANKVR
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSEDEANKVR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAYSLRNSLNDEK+KE+IPEADKKVVDDKVTE IQW+DAHQS+E EEYESK
Sbjct  540  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWMDAHQSSEKEEYESK  599

Query  601  QKELEGVANPILQKMY  616
            QKELE VANP+LQK+Y
Sbjct  600  QKELESVANPVLQKVY  615

>PITG_11247
Length=653

 Score = 1160 bits (3001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/616 (94%), Positives = 602/616 (98%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M QA TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTQA-TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKFSDP+VQADIKHWPFK+T+G GDKPQITVQFKGE+KTFQ
Sbjct  60   NQVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV+HF QEFKRKHRKD+T NQRALRRLRTACERAKRTLSSS+QAYIEIDSLFDG+DFNST
Sbjct  240  LVEHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFDGVDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ++I+RMVAEAEKYKS DEANK R
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSADEANKAR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAYSLRNSLNDEK+KE+IPEADKKVVDDKVTE IQWLDAHQS+E EEYESK
Sbjct  540  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDAHQSSEKEEYESK  599

Query  601  QKELEGVANPILQKMY  616
            QKELE VANP+LQK+Y
Sbjct  600  QKELESVANPVLQKVY  615

>PYAP_17334
Length=650

 Score = 1142 bits (2953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/616 (93%), Positives = 594/616 (96%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQA  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQA-VSGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPF ++ GAGDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFTVSPGAGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVL KMREVAEAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLTKMREVAEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHF  EFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFVSEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEP KSINPDEAVA+GATVQAAIL GND S+KLQDLLLLDVTPLSLGLETAGGVMTTLI 
Sbjct  360  KEPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIP  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSA+EKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYK+EDEANK+R
Sbjct  480  VTFDIDANGILNVSAIEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKIR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKN LENYAY+LRN+LNDEKLK QIPE D+K +DDKVTE I WLDAHQ++E EE+E+K
Sbjct  540  IEAKNGLENYAYNLRNTLNDEKLKSQIPEDDRKAIDDKVTEVINWLDAHQASEKEEFEAK  599

Query  601  QKELEGVANPILQKMY  616
            QKELEG+ANPILQKMY
Sbjct  600  QKELEGIANPILQKMY  615

>PHYCA_104429
Length=645

 Score = 1141 bits (2952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/616 (94%), Positives = 594/616 (96%), Gaps = 13/616 (2%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ+  SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQS-VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  348  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  407

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANKVR
Sbjct  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAY+LRN+LNDEKLK+QI E DKK ++DKVTETI WLDA+QSAE EEYE K
Sbjct  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANPILQKMY
Sbjct  588  QKELEGVANPILQKMY  603

>PYU1_G013927
Length=649

 Score = 1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/616 (92%), Positives = 596/616 (97%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQA  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQA-VAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQAD KHWPF +++G GDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADCKHWPFTVSAGPGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREV+EAFIGKEV+NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVSEAFIGKEVRNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHF QEFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNST
Sbjct  240  LVDHFVQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEP KSINPDEAVA+GATVQAAIL GND S+KLQDLLLLDVTPLSLGLETAGGVMTTLI+
Sbjct  360  KEPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIS  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMVAEAEKYK+EDE+NKVR
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKN LENYAY+LRN+L+DEKLK QI E D+  ++DKVTETI WLDA+QSAE EE+E+K
Sbjct  540  IEAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAK  599

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANPILQKMY
Sbjct  600  QKELEGVANPILQKMY  615

>SDRG_11899
Length=652

 Score = 1108 bits (2865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/609 (91%), Positives = 585/609 (96%), Gaps = 0/609 (0%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+DP  QADIKHWPFK+T GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            VLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  188  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRARFE
Sbjct  246  EFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRARFE  305

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGKEP KSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  368  NPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            NPDEAVA+GATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
            KK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKF+LD IPPMPRGVPQIDVTFDIDA
Sbjct  426  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDA  485

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNAL  547
            NGILNVSAVEKSTGKENKITITNDKGRL++ DI+RMV EAEKYKSEDEANK+RIEAKN L
Sbjct  486  NGILNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKNGL  545

Query  548  ENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGV  607
            ENYAY+LRN+LNDEKL+ +I EADKK +DDKVT+ I WLDA+QSAE EE+E+KQKELEG+
Sbjct  546  ENYAYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELEGI  605

Query  608  ANPILQKMY  616
            ANPI+QKMY
Sbjct  606  ANPIMQKMY  614

>H310_02610
Length=650

 Score = 1108 bits (2865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/609 (91%), Positives = 587/609 (96%), Gaps = 0/609 (0%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+DP++QADIKHWPFK+T GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            VLIKM+EV+EA+IG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  188  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGKEP KSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  368  NPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            NPDEAVA+GATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
            KK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKF+LD IPPMPRGVPQ+DVTFDIDA
Sbjct  426  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQVDVTFDIDA  485

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNAL  547
            NGILNVSA+EKSTGKENKITITNDKGRL++ DI+RMV EAEKYKSEDEANKVRIEAKN L
Sbjct  486  NGILNVSAIEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKVRIEAKNGL  545

Query  548  ENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGV  607
            ENYAY+LRN+LNDEKL+ ++  ADKK VDDKVTETI WLDA+QSAE EE+E+KQKELEGV
Sbjct  546  ENYAYNLRNTLNDEKLQGKLDAADKKTVDDKVTETISWLDANQSAEKEEFEAKQKELEGV  605

Query  608  ANPILQKMY  616
            ANPI+QK+Y
Sbjct  606  ANPIMQKLY  614

>SPRG_04533
Length=652

 Score = 1107 bits (2862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/609 (91%), Positives = 585/609 (96%), Gaps = 0/609 (0%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+DP  QADIKHWPFK+T GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            VLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  188  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGKEP KSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  368  NPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            NPDEAVA+GATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
            KK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKF+LD IPPMPRGVPQIDVTFDIDA
Sbjct  426  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDA  485

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNAL  547
            NGILNVSAVEKSTGKENKITITNDKGRL++ DI+RMV EAEKYKSEDEANK+RIEAKN L
Sbjct  486  NGILNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKNGL  545

Query  548  ENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGV  607
            ENYAY+LRN+LNDEKL+ +I EADKK +DDKVT+ I WLDA+QSAE EE+E+KQKELEG+
Sbjct  546  ENYAYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELEGI  605

Query  608  ANPILQKMY  616
            ANPI+QKMY
Sbjct  606  ANPIMQKMY  614

>PHYCA_532912
Length=626

 Score = 1102 bits (2849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/616 (91%), Positives = 576/616 (94%), Gaps = 30/616 (5%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M QA TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  331  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  390

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANK R
Sbjct  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKNALENYAYSLRNSLNDEK+KE+IPEADKK VDDKVTE IQWLDA+QS E + YESK
Sbjct  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570

Query  601  QKELEGVANPILQKMY  616
            QKELEGVANP+LQKMY
Sbjct  571  QKELEGVANPVLQKMY  586

>SDRG_11473
Length=636

 Score = 1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/611 (89%), Positives = 577/611 (94%), Gaps = 2/611 (0%)

Query  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            T+ YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  2    TTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKRLIGRKF D +VQADIKHWPFK+TSGA DKPQITVQFKGESKTFQPEEIS
Sbjct  62   NATNTVFDAKRLIGRKFHDAVVQADIKHWPFKVTSGAADKPQITVQFKGESKTFQPEEIS  121

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVLIKM+E++EA++G  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  122  SMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  181

Query  186  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  182  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  241

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
            T EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRAR
Sbjct  242  TAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRAR  301

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FED+C DYFRKTMEPVEKVL+DAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP K
Sbjct  302  FEDLCADYFRKTMEPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPCK  361

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
            SINPDEAVA+GATVQAAIL G+  S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTTV
Sbjct  362  SINPDEAVAFGATVQAAILSGDTQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTV  421

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTYADNQPGVLIQV+EGERSMT DNHLLGKF+LD IPPMPRGVPQ+DVTFDI
Sbjct  422  PTKKSQTFSTYADNQPGVLIQVYEGERSMTADNHLLGKFSLDGIPPMPRGVPQVDVTFDI  481

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGILNVSAVEKSTGKENKITITNDKGRLS+ DIDRMV EAEKYK++DEA+KVR+EAKN
Sbjct  482  DANGILNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRVEAKN  541

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALENYAYSLRN+LNDEK+K  I   DKK +DD V++TI WLD +  AE EE+E+KQKELE
Sbjct  542  ALENYAYSLRNTLNDEKVK--IDVNDKKRLDDMVSDTINWLDHNTHAEKEEFEAKQKELE  599

Query  606  GVANPILQKMY  616
             VANPI+QKMY
Sbjct  600  AVANPIMQKMY  610

>PYVX_15641
Length=629

 Score = 1080 bits (2794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/616 (90%), Positives = 574/616 (93%), Gaps = 25/616 (4%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQA  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQA-VSGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPF LTSG GDKPQI VQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFTLTSGPGDKPQIQVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFTQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFED+                        QVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDI------------------------QVHEVVLVGGSTRIPKVQQLLSDFFNG  335

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEP KSINPDEAVA+GATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLI 
Sbjct  336  KEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIP  395

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  396  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  455

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYK+EDEANKVR
Sbjct  456  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKVR  515

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            I+AKN LENY+Y+LRN+LNDEKLK QI E D+K +DDKVTETI WLDA+QSAE EE+E+K
Sbjct  516  IDAKNGLENYSYNLRNTLNDEKLKSQISEEDRKAIDDKVTETINWLDANQSAEKEEFEAK  575

Query  601  QKELEGVANPILQKMY  616
            QKELEG+ANPILQKMY
Sbjct  576  QKELEGIANPILQKMY  591

>SPRG_00068
Length=643

 Score = 1076 bits (2782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/611 (88%), Positives = 575/611 (94%), Gaps = 2/611 (0%)

Query  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            T+ YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAKNQVAM
Sbjct  3    TTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKNQVAM  62

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKRLIGRKF D +VQADIKHWPFK+T GA DKPQITV+FKGESKTFQPEEIS
Sbjct  63   NAANTVFDAKRLIGRKFHDAVVQADIKHWPFKVTPGAADKPQITVEFKGESKTFQPEEIS  122

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVLIKM+E++EA++G  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  123  SMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  182

Query  186  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  183  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  242

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
            T EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRAR
Sbjct  243  TAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSASAQAYIEIDSLFDGVDFNSTITRAR  302

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FED+C DYFRKTM+PVEKVL+DAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP K
Sbjct  303  FEDLCADYFRKTMDPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPCK  362

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
            SINPDEAVA+GATVQAAIL G++ S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTTV
Sbjct  363  SINPDEAVAFGATVQAAILSGDNQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTV  422

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTYADNQPGVLIQV+EGERSMT DN+LLGKF+LD IPPMPRGVPQ+DVTFDI
Sbjct  423  PTKKSQTFSTYADNQPGVLIQVYEGERSMTADNNLLGKFSLDGIPPMPRGVPQVDVTFDI  482

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGILNVSAVEKSTGKENKITITNDKGRLS+ DIDRMV EAEKYK++DEA+KVR+EAKN
Sbjct  483  DANGILNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRVEAKN  542

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALENYAY+LRN+LNDEK+K  I   DKK +DD VT+TI WLD +  AE EE+E KQKELE
Sbjct  543  ALENYAYNLRNTLNDEKVK--IDADDKKRLDDMVTDTINWLDHNSHAEKEEFEGKQKELE  600

Query  606  GVANPILQKMY  616
             VANPI+QKMY
Sbjct  601  AVANPIMQKMY  611

>PYU1_G013931
Length=663

 Score = 1073 bits (2775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/610 (86%), Positives = 573/610 (94%), Gaps = 0/610 (0%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAA+NQVAMN
Sbjct  12   TGQSVGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAARNQVAMN  71

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFDAKRLIGRKF+DP+VQAD KHWPFK+ +GA  KPQI VQFKGESKTFQPEEISS
Sbjct  72   AHNTVFDAKRLIGRKFTDPVVQADTKHWPFKVVAGAESKPQIVVQFKGESKTFQPEEISS  131

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM+E+AEA+IGK+VKNAVITVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAI
Sbjct  132  MVLTKMKEIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAI  191

Query  187  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR+V++F 
Sbjct  192  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRIVEYFV  251

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
            QEFKRKHRKD+T NQRALRRLRTACERAKRTLSSS+QAYIEIDSLF+GIDFNSTITRARF
Sbjct  252  QEFKRKHRKDMTGNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFEGIDFNSTITRARF  311

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            ED+C DYFRKTMEPVE+VLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGK+  KS
Sbjct  312  EDLCADYFRKTMEPVERVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKDLYKS  371

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            INPDEAVA+GATVQAAIL G+D S +LQDLLLLDV PLS+GLETAGGVMTTLI RNTTVP
Sbjct  372  INPDEAVAFGATVQAAILSGSDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIPRNTTVP  431

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
            TKK+QTFSTYADNQPGVLIQVFEGER+MTRDNHLLGKFNLD IPPMPRGVPQIDVTFDID
Sbjct  432  TKKSQTFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDID  491

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
            ANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMV +AE+YK +DE NK+R+EAKN+
Sbjct  492  ANGILNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVTDAERYKDQDERNKLRVEAKNS  551

Query  547  LENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEG  606
            LENYAYSLRNSL +EKL  ++   DKK++DDK+ ETI WLDA+Q+AE EE+  KQKELE 
Sbjct  552  LENYAYSLRNSLQEEKLASKLSADDKKLLDDKIAETINWLDANQAAEKEEFADKQKELES  611

Query  607  VANPILQKMY  616
             ANPILQ+MY
Sbjct  612  FANPILQRMY  621

>PYIW_16876
Length=643

 Score = 1073 bits (2775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/616 (87%), Positives = 576/616 (94%), Gaps = 1/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQA  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQA-VAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMN  NTVFDAKRLIGRKFSD +VQAD+KHWPFK+ +GA +KPQI V FKGE+KTFQ
Sbjct  60   NQVAMNPANTVFDAKRLIGRKFSDQVVQADLKHWPFKVVAGADNKPQIVVHFKGETKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREV+EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAI+GLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVSEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAISGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV+ FT EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVEFFTAEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFED+C DYFRKTMEPVE+VLRDAKLSK QV+E+VLVGGSTRIPKVQQ+LSEFFNG
Sbjct  300  ITRARFEDLCADYFRKTMEPVERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSEFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            K+  KSINPDEAVA+GATVQAAIL GND S +LQDLLLLDV PLS+GLETAGGVMTTLI 
Sbjct  360  KDLYKSINPDEAVAFGATVQAAILSGNDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIP  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGER+MTRDNH LGKF+LD IPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFSLDGIPPMPRGVPQID  479

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV EAE+YK  DE NK+R
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVEEAERYKDADERNKLR  539

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            +EAKNALENYAY LRNSL +EKL+ ++   DKK ++DK+ ETI WLDA+Q+AE +E+++K
Sbjct  540  VEAKNALENYAYGLRNSLQEEKLQAKLAADDKKTLEDKIAETIAWLDANQAAEKDEFDAK  599

Query  601  QKELEGVANPILQKMY  616
            QKELE VA+PILQKMY
Sbjct  600  QKELESVASPILQKMY  615

>CCI43221
Length=660

 Score = 1067 bits (2760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/613 (86%), Positives = 574/613 (94%), Gaps = 0/613 (0%)

Query  4    AKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  63
            A+ SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AQVSGPSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  64   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  123
            AMNA NTVFDAKRLIGR+ SDP+VQADIKHWPFK+TS  GDK  ITVQ+KGE+K+F+PEE
Sbjct  62   AMNATNTVFDAKRLIGRRCSDPVVQADIKHWPFKVTSSEGDKTMITVQYKGETKSFRPEE  121

Query  124  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  183
            ISSMVLIKMRE+AEAF+GK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
Sbjct  122  ISSMVLIKMREIAEAFLGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  181

Query  184  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  243
            AAIAYGLD+KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVD
Sbjct  182  AAIAYGLDRKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVD  241

Query  244  HFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  303
            HF  EF RKHRKDIT NQRALRRLRTACERAKRTLSSSAQA+IEIDSLF+G+DFNSTITR
Sbjct  242  HFVAEFNRKHRKDITTNQRALRRLRTACERAKRTLSSSAQAHIEIDSLFEGVDFNSTITR  301

Query  304  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP  363
            ARFED+C DYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKE 
Sbjct  302  ARFEDLCADYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEL  361

Query  364  NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNT  423
             KSINPDEAVA+GATVQAAIL G + S+KLQDLLLLDV PLSLGLETAGGVMTTLI RNT
Sbjct  362  CKSINPDEAVAFGATVQAAILSGTEQSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNT  421

Query  424  TVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTF  483
            T+PTKK+Q FSTY +NQPGV IQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQI+VTF
Sbjct  422  TLPTKKSQMFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVTF  481

Query  484  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEA  543
            DIDANGILNVSA+EKST KENKITITNDKGRLSQ+DIDRMV+EAEKYK EDEAN++RIEA
Sbjct  482  DIDANGILNVSAIEKSTNKENKITITNDKGRLSQADIDRMVSEAEKYKKEDEANRIRIEA  541

Query  544  KNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKE  603
            KN LENYA++LR++L+DEK+K QI   D+  V++KV E + WLDA+QSAE EE+E KQK+
Sbjct  542  KNGLENYAFNLRSTLDDEKIKNQISPEDRTTVENKVKEVVSWLDANQSAEKEEFEHKQKD  601

Query  604  LEGVANPILQKMY  616
            LE VANPI+QKMY
Sbjct  602  LEAVANPIMQKMY  614

>PYAP_19235
Length=643

 Score = 1063 bits (2748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/613 (86%), Positives = 570/613 (93%), Gaps = 0/613 (0%)

Query  4    AKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  63
            A  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  2    AAVSGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  64   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  123
            AMNAHNTVFDAKRLIGRKF+DP+VQAD+KHWPFK+ +GAGDKPQITV+FKGE K FQPEE
Sbjct  62   AMNAHNTVFDAKRLIGRKFTDPVVQADMKHWPFKVVTGAGDKPQITVEFKGEKKVFQPEE  121

Query  124  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  183
            ISSMVL KM+E+AEA++G +VKNAVITVPAYFNDSQRQAT+DAG IAGLNV+RIINEPTA
Sbjct  122  ISSMVLTKMKEIAEAYLGTDVKNAVITVPAYFNDSQRQATRDAGTIAGLNVMRIINEPTA  181

Query  184  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  243
            AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV+
Sbjct  182  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVE  241

Query  244  HFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  303
            +F  EFKRKH+KD+T NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDGIDFNSTITR
Sbjct  242  YFVAEFKRKHKKDLTTNQRALRRLRTACERAKRTLSSSTQAYVEIDSLFDGIDFNSTITR  301

Query  304  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP  363
            ARFEDMC DYFRKTMEPVEKVL DAK+ K QVHEVVLVGGSTRIPKVQQLL +FFNGKEP
Sbjct  302  ARFEDMCADYFRKTMEPVEKVLHDAKICKGQVHEVVLVGGSTRIPKVQQLLVDFFNGKEP  361

Query  364  NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNT  423
             KSINPDEAVA+GA VQAAIL G+D S KLQDLLLLDVTPLSLGLETAGGVMTTLI RNT
Sbjct  362  CKSINPDEAVAFGAAVQAAILSGDDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIPRNT  421

Query  424  TVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTF  483
             VPTKK+QTFSTYADNQPGVLIQVFEGERSMT+DN+LLGKF+LD IPPMPRG P+I+VTF
Sbjct  422  AVPTKKSQTFSTYADNQPGVLIQVFEGERSMTKDNNLLGKFSLDGIPPMPRGKPEIEVTF  481

Query  484  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEA  543
            DIDANGILNVSAVEKSTGK+NKITITNDKGRLSQS+IDRMV EAEKY  ED  NK R++A
Sbjct  482  DIDANGILNVSAVEKSTGKDNKITITNDKGRLSQSEIDRMVKEAEKYAKEDADNKARVDA  541

Query  544  KNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKE  603
            KN LENYAY+LRNSL+D  +K+Q+ E D+K +DD V+ETI+WLDAHQ +E +EYE KQKE
Sbjct  542  KNTLENYAYNLRNSLDDAPVKQQMNEDDRKKIDDAVSETIKWLDAHQMSEKQEYEMKQKE  601

Query  604  LEGVANPILQKMY  616
            LEG+ANPILQKMY
Sbjct  602  LEGIANPILQKMY  614

>CCI40249
Length=660

 Score = 1058 bits (2735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/607 (87%), Positives = 566/607 (93%), Gaps = 0/607 (0%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TVFDAKRLIGR FSDPIVQAD+KHWPF + +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVTFKGEKKIFQPEEISSMVL  124

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            +KMREV+EA+IGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  125  VKMREVSEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  184

Query  190  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  249
            L+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  185  LEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFVAEF  244

Query  250  KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  309
            KRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARFED+
Sbjct  245  KRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARFEDL  304

Query  310  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINP  369
            C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFN KEP KSINP
Sbjct  305  CSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKSINP  364

Query  370  DEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  429
            DEAVA+GATVQAAIL GND S+KLQDLLLLDV PLSLGLETAGGVMT LI RNTT+PTKK
Sbjct  365  DEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKK  424

Query  430  AQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANG  489
            +Q FST+ DNQ  V IQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQI+V +DIDANG
Sbjct  425  SQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANG  484

Query  490  ILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALEN  549
            ILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYK +DEANKVRIEAKN LEN
Sbjct  485  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLEN  544

Query  550  YAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVAN  609
            YAY+LRNSLNDEKLK Q+ E D+KV+DDK++ET+ WLDA+QSAE EEYE  QK+LE +AN
Sbjct  545  YAYNLRNSLNDEKLKSQLSEDDRKVLDDKISETMSWLDANQSAEKEEYEKLQKDLEAIAN  604

Query  610  PILQKMY  616
            PILQKMY
Sbjct  605  PILQKMY  611

>CCA16153
Length=663

 Score = 1056 bits (2730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/607 (86%), Positives = 565/607 (93%), Gaps = 0/607 (0%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TVFDAKRLIGR FSDPIVQAD+KHWPF + +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVIFKGEKKIFQPEEISSMVL  124

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            +KMREV+EA+IGK VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  125  VKMREVSEAYIGKTVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  184

Query  190  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  249
            L+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  185  LEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFVAEF  244

Query  250  KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  309
            KRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARFED+
Sbjct  245  KRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARFEDL  304

Query  310  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINP  369
            C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFN KEP KSINP
Sbjct  305  CSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKSINP  364

Query  370  DEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  429
            DEAVA+GATVQAAIL GND S+KLQDLLLLDV PLSLGLETAGGVMT LI RNTT+PTKK
Sbjct  365  DEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKK  424

Query  430  AQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANG  489
            +Q FST+ DNQ  V IQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQI+V +DIDANG
Sbjct  425  SQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANG  484

Query  490  ILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALEN  549
            ILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYK +DEANKVRIEAKN LEN
Sbjct  485  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLEN  544

Query  550  YAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVAN  609
            YAY+LRNSLNDEKLK Q+ E D+K++DDK++ET+ WLDA+QSAE EEYE  QK+LE +AN
Sbjct  545  YAYNLRNSLNDEKLKSQLSEDDRKILDDKISETMNWLDANQSAEKEEYEKLQKDLEAIAN  604

Query  610  PILQKMY  616
            PILQKMY
Sbjct  605  PILQKMY  611

>PITG_11252
Length=654

 Score = 1055 bits (2727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/612 (85%), Positives = 569/612 (93%), Gaps = 0/612 (0%)

Query  5    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  64
            K +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  4    KVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFD KRLIGRKF+DP VQ+DIKHWPF +  GA  KPQ+ VQFKGE KTFQPEEI
Sbjct  64   MNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFNVIRGAESKPQVVVQFKGEKKTFQPEEI  123

Query  125  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184
            SSMVLIKMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  185  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244
            AIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV+ 
Sbjct  184  AIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEF  243

Query  245  FTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304
            F  EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRA
Sbjct  244  FVTEFKRKHRKDMTSNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNSTITRA  303

Query  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPN  364
            RFED+C +YFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIPKVQQLL +FFNGKE  
Sbjct  304  RFEDLCSEYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPKVQQLLKDFFNGKELF  363

Query  365  KSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTT  424
            KSINPDEAVAYGATVQAAIL GN+SS KLQDLLLLDV PLSLGLETAGGVMT LI RNTT
Sbjct  364  KSINPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTT  423

Query  425  VPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFD  484
            VP+KK Q+FSTYADNQ GVLIQVFEGER+MTRDNH LGKFNLD IPPMPRGVPQIDVTFD
Sbjct  424  VPSKKTQSFSTYADNQSGVLIQVFEGERTMTRDNHHLGKFNLDGIPPMPRGVPQIDVTFD  483

Query  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAK  544
            +D NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVA+AEKYK +DE NK+R+E+K
Sbjct  484  VDVNGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVADAEKYKDQDERNKLRVESK  543

Query  545  NALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKEL  604
            NALENYA+SLRNS  +EK+  ++ E DKK ++DKV ET+ WLDA+Q+AE EE+++KQ+EL
Sbjct  544  NALENYAFSLRNSTREEKIAAKLSEEDKKSIEDKVAETLHWLDANQAAEKEEFDAKQQEL  603

Query  605  EGVANPILQKMY  616
            EGVANPILQK+Y
Sbjct  604  EGVANPILQKIY  615

>PYAP_17333
Length=657

 Score = 1053 bits (2722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/616 (84%), Positives = 574/616 (93%), Gaps = 0/616 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M+ A  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT TERLIGDAAK
Sbjct  1    MSDAPVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGTERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKF DP+VQAD+KHWPF++ +G  DKPQI V+FKGESK F 
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFRDPVVQADLKHWPFQVVAGPDDKPQIIVEFKGESKRFY  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
             EEISSMVL KMR++AEA+IGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  AEEISSMVLTKMRDIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV++F  EFKRKHR+D+++NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++GIDFNST
Sbjct  241  LVEYFVGEFKRKHRRDMSNNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGIDFNST  300

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFED+CGD+FRKTMEPVE+VLRD+KLSKSQV EVVLVGGSTRIPK+QQ+LS++FNG
Sbjct  301  ITRARFEDLCGDFFRKTMEPVERVLRDSKLSKSQVQEVVLVGGSTRIPKIQQMLSDYFNG  360

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE  KSINPDEAVA+GATVQAAIL G+D S KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KELYKSINPDEAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGER+MTRDNHLLGKF+LD +PPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDGLPPMPRGVPQID  480

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMV EAEKYK +DE NK+R
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVQEAEKYKDQDERNKLR  540

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            +EAKNALENYA+SLR+++ DEKL  ++ + DKK +D  V   I+WLD HQ+AE EEY++K
Sbjct  541  VEAKNALENYAFSLRSAVQDEKLVMKLDQDDKKTIDSAVNGVIEWLDQHQAAEKEEYDAK  600

Query  601  QKELEGVANPILQKMY  616
             KELEGVANPI+QK+Y
Sbjct  601  MKELEGVANPIMQKLY  616

>HYAP_01537
Length=651

 Score = 1043 bits (2698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/610 (84%), Positives = 566/610 (93%), Gaps = 0/610 (0%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVAMN  65

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFDAKRLIGRKFSDP VQ+DIKHWPFK+T  + DKPQ+ VQFKGE+K FQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPEVQSDIKHWPFKVTRDSADKPQVEVQFKGETKRFQPEEISS  125

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVLIKMRE+AEA+IGK+V+NAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI
Sbjct  126  MVLIKMREIAEAYIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185

Query  187  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
            AYGLDKKGGE NVLIFDLGGGTFDVSLLSIE+GIFEVKATAGDTHLGGEDFDNRLVDHF 
Sbjct  186  AYGLDKKGGEHNVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVDHFV  245

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
             EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSL DGIDFN+TITRARF
Sbjct  246  SEFKRKHRKDMTLNQRALRRLRTACERAKRTLSTSAQAYIEIDSLLDGIDFNTTITRARF  305

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            ED+C D+FRKTMEPV +VLRD+KLSK +VHE+VLVGGSTRIPKVQQLL +FFNGKE  KS
Sbjct  306  EDLCADFFRKTMEPVAQVLRDSKLSKGEVHEIVLVGGSTRIPKVQQLLIDFFNGKELFKS  365

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            INPDEAVAYGATVQAAIL G  +S KLQDLLLLDV PLSLGLETAGGVMT LI RNTTVP
Sbjct  366  INPDEAVAYGATVQAAILSGGGASSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVP  425

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
             KK+Q+FSTYADNQPGVLIQVFEGER+MTRDNHLLGKF+LD IPPMPRGVPQIDVTFD+D
Sbjct  426  AKKSQSFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFSLDGIPPMPRGVPQIDVTFDVD  485

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
             NGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMV +AE YK +DE NK+R+E+KN 
Sbjct  486  VNGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVNDAETYKDQDERNKLRVESKNG  545

Query  547  LENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEG  606
            LENYA+S+R S++DEK+  ++   DKK+V+DKV E +QWLDA+ SAE EE ++KQKELEG
Sbjct  546  LENYAFSVRTSVSDEKIAVKLSTDDKKIVEDKVAEILQWLDANHSAEKEEIDAKQKELEG  605

Query  607  VANPILQKMY  616
            VANPI+QK+Y
Sbjct  606  VANPIMQKIY  615

>PHYSO_482793
Length=658

 Score = 1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/610 (84%), Positives = 569/610 (93%), Gaps = 0/610 (0%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVARGPENKPQLVVQFKGESKTFQPEEISS  125

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVLIKMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI
Sbjct  126  MVLIKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185

Query  187  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV++F 
Sbjct  186  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYFV  245

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
            QEFKRKHR+D++ N RA+RRLRTACERAKRTLS+SAQAYIEIDSL DG DFNSTITRARF
Sbjct  246  QEFKRKHRRDLSVNSRAMRRLRTACERAKRTLSTSAQAYIEIDSLLDGTDFNSTITRARF  305

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            ED+C ++FRKTM+PV +VLRD+KLSK+QV+EVVLVGGSTRIPKVQQLL +FFNGKE  KS
Sbjct  306  EDLCNEFFRKTMDPVAQVLRDSKLSKNQVNEVVLVGGSTRIPKVQQLLVDFFNGKELFKS  365

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            INPDEAVAYGATVQAAIL GNDSS KLQDLLLLDV PLSLGLETAGGVMT LI RNTT+P
Sbjct  366  INPDEAVAYGATVQAAILSGNDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTIP  425

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
            +KK Q+FSTYADNQPGVLIQVFEGER+MTRDNHLLGKFNLD IPPMPRGVPQIDVTFD+D
Sbjct  426  SKKTQSFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDVD  485

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
             NGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMVA+AEKYK +DE NK+RIE+KNA
Sbjct  486  VNGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVADAEKYKDQDERNKLRIESKNA  545

Query  547  LENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEG  606
            LENYA+SLR+S  +EKL  ++ E DKK ++ KV +T+ WLDA+Q+AE EE+++KQ+ELE 
Sbjct  546  LENYAFSLRSSTREEKLAAKLSEDDKKTIEYKVADTLHWLDANQAAEKEEFDAKQQELES  605

Query  607  VANPILQKMY  616
            +ANPILQK+Y
Sbjct  606  MANPILQKVY  615

>PHALS_09802
Length=651

 Score = 1035 bits (2676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/610 (84%), Positives = 569/610 (93%), Gaps = 0/610 (0%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFD KRLIGRKF+D  VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFADSEVQSDIKHWPFKVVCGPENKPQVVVQFKGESKTFQPEEISS  125

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVLIKMRE+AEAFIGK+V+NAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI
Sbjct  126  MVLIKMREIAEAFIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185

Query  187  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
            AYGLDKKGGE +VLIFDLGGGTFDVSLL+IEEGIFEV ATAGDTHLGGEDFDNRLV++F 
Sbjct  186  AYGLDKKGGEHHVLIFDLGGGTFDVSLLTIEEGIFEVMATAGDTHLGGEDFDNRLVEYFV  245

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
             EFKRKHRKD++ NQRALRRLRTACERAKRTLS+SAQAY+EIDSLFDGIDFNSTITRARF
Sbjct  246  AEFKRKHRKDLSVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLFDGIDFNSTITRARF  305

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            ED+C +YFRKTM+PV +VLRD+KLSKSQV+E+VLVGGSTRIPKVQQ+L +FFNGK+  KS
Sbjct  306  EDLCAEYFRKTMDPVAQVLRDSKLSKSQVNEIVLVGGSTRIPKVQQMLMDFFNGKDLFKS  365

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            INPDEAVAYGATVQAAIL G++SS KLQDLLLLDV PLSLGLETAGGVMT LI RNTTVP
Sbjct  366  INPDEAVAYGATVQAAILSGSESSAKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVP  425

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
             KK Q+FSTY DNQ GVLIQVFEGER+MTRDNHLLGKF+LD IPPMPRGVPQIDVTFD+D
Sbjct  426  AKKMQSFSTYTDNQSGVLIQVFEGERTMTRDNHLLGKFSLDGIPPMPRGVPQIDVTFDVD  485

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
             NGILNVSAVEKSTGKENKITITNDKGRLSQS+IDRMVA+A+KYK +DE NK+RIE+KN+
Sbjct  486  VNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADADKYKDQDERNKLRIESKNS  545

Query  547  LENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEG  606
            LEN+A+SLR+S+NDEK+  +I   D+K++D KV ET+QWL+A+Q+AE  E+++KQ+ELEG
Sbjct  546  LENFAFSLRSSINDEKVVAKISAEDRKLIDGKVAETLQWLEANQAAEKGEFDAKQQELEG  605

Query  607  VANPILQKMY  616
            VANPI+QKMY
Sbjct  606  VANPIMQKMY  615

>H257_12958
Length=649

 Score = 1033 bits (2671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/607 (84%), Positives = 564/607 (93%), Gaps = 0/607 (0%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
            SVGIDLGTTYSCVG WQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  N
Sbjct  8    SVGIDLGTTYSCVGTWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  67

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TVFDAKRLIGRKF+DP++QADIKHWPFK+ +GAGDKPQI V+FKGE KTFQPEEISSMVL
Sbjct  68   TVFDAKRLIGRKFNDPMIQADIKHWPFKVIAGAGDKPQIVVEFKGERKTFQPEEISSMVL  127

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            IKM+EVAEA++G +V+NAVITVPAYFNDSQRQATKDAGAIAGL V+RIINEPTAAAIAYG
Sbjct  128  IKMKEVAEAYLGLDVQNAVITVPAYFNDSQRQATKDAGAIAGLTVMRIINEPTAAAIAYG  187

Query  190  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  249
            LDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  188  LDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVDEF  247

Query  250  KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  309
            KRK+RKD+  NQRALRRLRTA ERAKRTLSSS QA++EIDSLFDGID+N+TITRARFED+
Sbjct  248  KRKYRKDMKTNQRALRRLRTASERAKRTLSSSTQAHLEIDSLFDGIDYNTTITRARFEDL  307

Query  310  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINP  369
            C DYFRKTM PVE VLRDAKLSK+QV+EVVLVGGSTRIPKVQQLLS+FFNGKE  KSINP
Sbjct  308  CSDYFRKTMGPVETVLRDAKLSKNQVNEVVLVGGSTRIPKVQQLLSDFFNGKELYKSINP  367

Query  370  DEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  429
            DEAVA+GATVQAAIL G   S KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK
Sbjct  368  DEAVAFGATVQAAILSGTSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK  427

Query  430  AQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANG  489
            +QTFSTYADNQPGVLIQVFEGER MT+DN+LLGKF+LD +PPMPRG+PQ+DVTFDIDANG
Sbjct  428  SQTFSTYADNQPGVLIQVFEGERVMTKDNNLLGKFSLDGLPPMPRGMPQVDVTFDIDANG  487

Query  490  ILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALEN  549
            ILNVSAVEKSTGKENKITITNDKGRLS+ +IDRMV +AEKYK+EDE N+ RIEAKN LEN
Sbjct  488  ILNVSAVEKSTGKENKITITNDKGRLSKDEIDRMVNDAEKYKAEDEKNRARIEAKNGLEN  547

Query  550  YAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVAN  609
            YAYSLRN+LND+K+K  +  ADKK ++DKV +TI W+D + +AE +E+E+KQ+ELE VAN
Sbjct  548  YAYSLRNTLNDDKIKGAVDPADKKTLEDKVADTIAWMDRNLAAEKDEFEAKQQELESVAN  607

Query  610  PILQKMY  616
            PI+QK+Y
Sbjct  608  PIMQKLY  614

>H310_09557
Length=644

 Score = 1032 bits (2668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/607 (84%), Positives = 565/607 (93%), Gaps = 0/607 (0%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
            SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  N
Sbjct  7    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  66

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TVFDAKRLIGRKF+DP++QADIKHWPFK+ +G GDKPQI V+FKGESKTFQPEEISSMVL
Sbjct  67   TVFDAKRLIGRKFNDPMIQADIKHWPFKVVAGPGDKPQIVVEFKGESKTFQPEEISSMVL  126

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            IKM++VAEAFIG EV+NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  127  IKMKQVAEAFIGVEVQNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  186

Query  190  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  249
            LDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAG+THLGGEDFDNRLVDHFT EF
Sbjct  187  LDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGNTHLGGEDFDNRLVDHFTDEF  246

Query  250  KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  309
            KRK++ D+  NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDG+D+N+TITRARFED+
Sbjct  247  KRKYKGDLKTNQRALRRLRTACERAKRTLSSSTQAYLEIDSLFDGMDYNTTITRARFEDL  306

Query  310  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINP  369
            C DYFRKTMEPV+ VL+DAKLSK+QVHEVVLVGGSTRIPKVQQLLS+FF+GKE  KSINP
Sbjct  307  CSDYFRKTMEPVKSVLQDAKLSKNQVHEVVLVGGSTRIPKVQQLLSDFFHGKELYKSINP  366

Query  370  DEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  429
            DEAVA+GATVQAAIL G+  S KLQDLLLLDVTPLSLGLETAGGVMTTLI+RNTTVPTKK
Sbjct  367  DEAVAFGATVQAAILSGSSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLISRNTTVPTKK  426

Query  430  AQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANG  489
            +QTFSTYADNQPGVLIQV+EGER+MT DNHLLGKF+LD +PPMPRGVPQ+DVTFDIDANG
Sbjct  427  SQTFSTYADNQPGVLIQVYEGERTMTHDNHLLGKFSLDGLPPMPRGVPQVDVTFDIDANG  486

Query  490  ILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALEN  549
            ILNVSAVEKSTGKENKITITNDKGRLS+ +I+RMV +AEKYK+ED  NK R+EAKN LEN
Sbjct  487  ILNVSAVEKSTGKENKITITNDKGRLSKDEIERMVNDAEKYKAEDTKNKERVEAKNGLEN  546

Query  550  YAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVAN  609
            YAYSLRN+L +EK++  +   DKKV++DKV + I W+D + +AE +EYE KQ+ELE VAN
Sbjct  547  YAYSLRNTLQEEKIQGAMDAGDKKVLEDKVHDIISWMDRNLAAEKDEYEGKQQELESVAN  606

Query  610  PILQKMY  616
            PILQK++
Sbjct  607  PILQKVH  613

>PHYCA_104444
Length=644

 Score = 1031 bits (2667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/617 (82%), Positives = 558/617 (90%), Gaps = 2/617 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M +A T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MTEAVT-GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFKL  G   KP + VQFKGE +TFQ
Sbjct  60   NQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKLVRGPESKPLVEVQFKGEKRTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVL+KMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINE
Sbjct  120  PEEISSMVLVKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV+ F  EFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDGIDFNST
Sbjct  240  LVEFFVLEFKRKYRKDMTGNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFED+C +YFRKTM PV +VL+D+KLSK+ V+EVVLVGGSTRIPKVQQLL EFFNG
Sbjct  300  ITRARFEDLCSEYFRKTMGPVAQVLQDSKLSKNHVNEVVLVGGSTRIPKVQQLLMEFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtp-lslglETAGGVMTTLI  419
            KE  KSINPDEAVAYGATVQAAIL G+ +       LLL     LSLGLETAGGVMT LI
Sbjct  360  KELFKSINPDEAVAYGATVQAAILSGSGNMSSKLQDLLLLDVAPLSLGLETAGGVMTKLI  419

Query  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQI  479
             RNTTVP KK Q+FSTY+DNQ GVLIQVFEGERS+T+DNHLLGKFNLD IPPM RGVPQI
Sbjct  420  PRNTTVPAKKTQSFSTYSDNQSGVLIQVFEGERSLTQDNHLLGKFNLDGIPPMQRGVPQI  479

Query  480  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKV  539
            DVTFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQS+IDRMVA+AEKYK +DE NK+
Sbjct  480  DVTFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKL  539

Query  540  RIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYES  599
            RIE+KNALENYA+SLR+S+ ++KL  ++  ADKK ++DKV ET+QWLDA+Q+AE EE++S
Sbjct  540  RIESKNALENYAFSLRSSMKEDKLATKLSAADKKTIEDKVAETLQWLDANQAAEKEEFDS  599

Query  600  KQKELEGVANPILQKMY  616
            KQ+ELEGVANPI+QK+Y
Sbjct  600  KQQELEGVANPIMQKVY  616

>PHYRA_71655
Length=653

 Score = 1025 bits (2651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/610 (83%), Positives = 562/610 (92%), Gaps = 0/610 (0%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFD KRLIGRKF+DP VQ+DI+HWPFK+  G  +KP++ VQFKGE  TFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQPEEISS  125

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL+KMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAI
Sbjct  126  MVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAI  185

Query  187  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV+ F 
Sbjct  186  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEFFV  245

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
            QEFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNSTITRARF
Sbjct  246  QEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNSTITRARF  305

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            ED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPKVQQLL +FFNGK+  KS
Sbjct  306  EDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPKVQQLLIDFFNGKKLFKS  365

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            INPDEA+AYGATVQAAIL G+DSS KLQDLLLLDV PLSLGLETAGGVMT LI RNTTVP
Sbjct  366  INPDEAIAYGATVQAAILSGHDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVP  425

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
             KKAQ+FSTYADNQ GVLIQVFEGERSMT DNHLLGKFNLD IPPMPRGVPQIDVTFD+D
Sbjct  426  AKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFDVD  485

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
             NGILNVSAVEKSTGKENKI ITNDKGRLSQS+I+RMV +AEKYK +DE NK+RIE+KNA
Sbjct  486  VNGILNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLRIESKNA  545

Query  547  LENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEG  606
            LENYA+SLR+S  DEK+  ++ + DKK ++DKV ET+ WLDA+Q+A  EE+++KQ+ELEG
Sbjct  546  LENYAFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAKQQELEG  605

Query  607  VANPILQKMY  616
            V NPI+QK+Y
Sbjct  606  VTNPIMQKIY  615

>PHYKE_7016
Length=650

 Score = 1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/617 (82%), Positives = 568/617 (92%), Gaps = 1/617 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M+ +  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MSSSVVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSD  VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDLEVQSDIKHWPFKVVRGPDNKPQVVVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKK GE NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKRGEHNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV++F  +FKRKHRKD++ + RA+RRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNST
Sbjct  241  LVEYFVTDFKRKHRKDMSTSSRAMRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNST  300

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFE +C D+FRKTMEPV +VL DAKLSK  V EVVLVGGSTRIPKVQQLL++FF+G
Sbjct  301  ITRARFESLCDDFFRKTMEPVAQVLHDAKLSKGHVQEVVLVGGSTRIPKVQQLLTDFFHG  360

Query  361  KEPNKSINPDEAVAYGATVQAAIL-GGNdssdklqdlllldvtplslglETAGGVMTTLI  419
            KE  KSINPDEAVA+GATVQAAIL G  D+S KLQDLLLLDV PLSLGLETAGGVMTTLI
Sbjct  361  KELFKSINPDEAVAFGATVQAAILSGAGDTSSKLQDLLLLDVAPLSLGLETAGGVMTTLI  420

Query  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQI  479
            ARNTTVP+KK+QTFSTY+DNQPGVLIQVFEGER+MTRDNHLLGKFNLD IPPM RG+PQI
Sbjct  421  ARNTTVPSKKSQTFSTYSDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMRRGIPQI  480

Query  480  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKV  539
            DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMVAEA+K+K +D  NK+
Sbjct  481  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQDEIDRMVAEADKFKDQDARNKL  540

Query  540  RIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYES  599
            RIE+KN++ENYA+SLR+S+ +EKL  ++   DK+V++DKV E + WL+ +Q+AE EE+++
Sbjct  541  RIESKNSVENYAFSLRSSIREEKLAVKLTAEDKQVIEDKVAEVLSWLEVNQAAEKEEFDA  600

Query  600  KQKELEGVANPILQKMY  616
            KQKELE VANPI++K++
Sbjct  601  KQKELEDVANPIMEKIF  617

>PYAR_19807
Length=1613

 Score = 1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/610 (83%), Positives = 557/610 (91%), Gaps = 12/610 (2%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  8    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  67

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFDAKRLIGRKF+D +VQADIKHWPF++ + + +KPQI VQFKGE+K F  EEISS
Sbjct  68   AHNTVFDAKRLIGRKFTDAVVQADIKHWPFRVMADSANKPQIVVQFKGETKKFYAEEISS  127

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KMR+VAEAFIGK+VKNA            RQATKDAGAIAGLNVLRIINEPTAAAI
Sbjct  128  MVLTKMRDVAEAFIGKQVKNA------------RQATKDAGAIAGLNVLRIINEPTAAAI  175

Query  187  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
            AYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV++F 
Sbjct  176  AYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYFV  235

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
             EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++G+DFNSTITRARF
Sbjct  236  GEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGVDFNSTITRARF  295

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            ED+C D+FRKTMEPVE+VLRDAKLSK+QV EVVLVGGSTRIPK+QQLLS+FFNGKE  KS
Sbjct  296  EDLCADFFRKTMEPVERVLRDAKLSKNQVQEVVLVGGSTRIPKIQQLLSDFFNGKELYKS  355

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            INPDEAVA+GATVQAAIL G+D S KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVP
Sbjct  356  INPDEAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVP  415

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
            TKK+QTFSTYADNQPGVLIQVFEGER+MTRDNHLLGKF+LDA+PPMPRGVPQIDVTFDID
Sbjct  416  TKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDALPPMPRGVPQIDVTFDID  475

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
            ANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMV+EAE YK +DE NK+R+EAKN 
Sbjct  476  ANGILNVSAVEKSTGKENKITITNDKGRLSQQEIDRMVSEAETYKDQDERNKLRVEAKNG  535

Query  547  LENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEG  606
            LENYA++LRNSL D+K+  ++ + DKK + D + E + WLD HQ+AE EEY++KQKELE 
Sbjct  536  LENYAFTLRNSLQDDKVTAKLGDEDKKTLGDAIAEVVAWLDGHQAAEKEEYDAKQKELEN  595

Query  607  VANPILQKMY  616
            VA PILQKMY
Sbjct  596  VATPILQKMY  605

>CCA14967
Length=1431

 Score = 1004 bits (2596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/596 (83%), Positives = 546/596 (92%), Gaps = 0/596 (0%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
             IDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA NTV
Sbjct  22   SIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAINTV  81

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            FDAKRLIGR+ SDP+VQADIKHWPFK+TS  GDKP ITVQ+KGE+K+F+PEEISSMVLIK
Sbjct  82   FDAKRLIGRRCSDPVVQADIKHWPFKVTSCEGDKPMITVQYKGETKSFRPEEISSMVLIK  141

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            MRE+A+A++G +VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD
Sbjct  142  MREIAQAYLGNDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  201

Query  192  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  251
            +KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF  EF R
Sbjct  202  RKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVAEFNR  261

Query  252  KHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  311
            KHRKDI  NQRALRRLRTACERAKRTLSSSAQA IEIDSLF+G+DFNSTITRARFED+CG
Sbjct  262  KHRKDIATNQRALRRLRTACERAKRTLSSSAQAQIEIDSLFEGVDFNSTITRARFEDLCG  321

Query  312  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDE  371
            DYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK+  KSINPDE
Sbjct  322  DYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKDLCKSINPDE  381

Query  372  AVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQ  431
            AVA+GATVQAAIL G + S+KLQDLLLLDV PLSLGLETAGGVMTTLI RNTT+PTKK+Q
Sbjct  382  AVAFGATVQAAILSGTEKSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTLPTKKSQ  441

Query  432  TFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGIL  491
            TFSTY +NQPGV IQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQI+VTFDIDANGIL
Sbjct  442  TFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVTFDIDANGIL  501

Query  492  NVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYA  551
            NVSAVEKST KENKITITNDKGRLSQ+DID MV+EAEKYK EDEAN++R+EAKN LENY 
Sbjct  502  NVSAVEKSTNKENKITITNDKGRLSQADIDLMVSEAEKYKKEDEANRIRVEAKNGLENYT  561

Query  552  YSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGV  607
            ++LR++L+DEK+K QI   D+  +++KV E + WL   +  +T +    + + E +
Sbjct  562  FNLRSTLDDEKIKNQISPEDRTTIENKVKEVVSWLLQCREEDTNQMSKDEPKWEAL  617

>PYIR_15859
Length=626

 Score = 1003 bits (2594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/613 (83%), Positives = 548/613 (89%), Gaps = 27/613 (4%)

Query  4    AKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  63
            A+ +G +VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  7    AQVTGQTVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  66

Query  64   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  123
            AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEE
Sbjct  67   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQPEE  126

Query  124  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  183
            ISSMVLIKM+E++EA+IGK+VKNAVITVPAYFNDSQRQATKDAG IAGLN          
Sbjct  127  ISSMVLIKMKEISEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVIAGLN----------  176

Query  184  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  243
                      GGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV+
Sbjct  177  ----------GGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVE  226

Query  244  HFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  303
             FT EFKRK +KD+T NQR+LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR
Sbjct  227  FFTAEFKRKFKKDMTQNQRSLRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  286

Query  304  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP  363
            ARFED+C DYFRKTMEPVE+VLRDAKLSK QV+E+VLVGGSTRIPKVQQ+LS+FFNGK+ 
Sbjct  287  ARFEDLCADYFRKTMEPVERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSDFFNGKDL  346

Query  364  NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNT  423
             KSINPDEAVA+GATVQAAIL G D S +LQDLLLLDV PLSLGLETAGGVMTTLI    
Sbjct  347  YKSINPDEAVAFGATVQAAILSGADKSSRLQDLLLLDVAPLSLGLETAGGVMTTLIP---  403

Query  424  TVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTF  483
                    TFSTYADNQPGVLIQVFEGER+MTRDNH LGKFNLD IPPMPRGVPQIDVTF
Sbjct  404  ----XXXXTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFNLDGIPPMPRGVPQIDVTF  459

Query  484  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEA  543
            DIDANGILNVSAVEKSTGKENKITITNDKGRLSQ DIDRMVAEAEKYK  DE NK+R+EA
Sbjct  460  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQEDIDRMVAEAEKYKDADERNKLRVEA  519

Query  544  KNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKE  603
            KNALENYAY LRNSL +EK++ ++   DKK VDDK+TETI WLDA+Q+AE EE+++KQKE
Sbjct  520  KNALENYAYGLRNSLQEEKIQAKLSADDKKRVDDKITETIAWLDANQAAEKEEFDAKQKE  579

Query  604  LEGVANPILQKMY  616
            LEGVANPILQKMY
Sbjct  580  LEGVANPILQKMY  592

>PPTG_19690
Length=566

 Score = 987 bits (2552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/561 (88%), Positives = 526/561 (94%), Gaps = 0/561 (0%)

Query  5    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  64
            K +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  4    KVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  GA +KPQ+ VQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQPEEI  123

Query  125  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184
            SSMVLIKMREVAEAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  185  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244
            AIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV++
Sbjct  184  AIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEY  243

Query  245  FTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304
            F QEFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAY+EIDSL DGIDFNSTITRA
Sbjct  244  FVQEFKRKYRKDMTVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLLDGIDFNSTITRA  303

Query  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPN  364
            RFED+C DYFRKTMEPV +VLRD+KLSK+QV E+VLVGGSTRIPKVQQLL  FFNGK+  
Sbjct  304  RFEDLCSDYFRKTMEPVAQVLRDSKLSKNQVDEIVLVGGSTRIPKVQQLLMGFFNGKDLF  363

Query  365  KSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTT  424
            KSINPDEAVAYGATVQAAIL GN+SS KLQDLLLLDV PLSLGLETAGGVMT LI RNTT
Sbjct  364  KSINPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTT  423

Query  425  VPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFD  484
            VP KK QTFSTY DNQPGVLIQVFEGER+MTRDNHLLGKFNLD IPPMPRGVPQIDVTFD
Sbjct  424  VPAKKTQTFSTYTDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFD  483

Query  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAK  544
            +D NGILNVSAVEKSTGKENKITITNDKGRLSQS+IDRMVA+AEKYK +DE NK+RIE+K
Sbjct  484  VDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKLRIESK  543

Query  545  NALENYAYSLRNSLNDEKLKE  565
            NALENYA+SLRNS  +EK +E
Sbjct  544  NALENYAFSLRNSTREEKGQE  564

>CCI40247
Length=643

 Score = 986 bits (2549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/617 (78%), Positives = 552/617 (89%), Gaps = 1/617 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M +   SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AAK
Sbjct  1    MTEKAVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKF D  VQ D KHWPF++  G  DKPQI V+ KG  K F 
Sbjct  61   NQVAMNAENTVFDAKRLIGRKFHDQAVQQDTKHWPFRVVCGPEDKPQIVVEVKGAKKMFY  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
             EEIS+MVL KMRE+AEA++G++VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+NE
Sbjct  121  AEEISAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNE  180

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDNR  240

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV+HF  EFKRK+RKD++ NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNST
Sbjct  241  LVEHFLAEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNST  300

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFED+C DYFRKTMEPVEKVLRDAKL+K+Q+HE+VLVGGSTRIPKVQQ+LS+FFNG
Sbjct  301  ITRARFEDLCSDYFRKTMEPVEKVLRDAKLAKNQLHEIVLVGGSTRIPKVQQMLSDFFNG  360

Query  361  KEPNKSINPDEAVAYGATVQAAIL-GGNdssdklqdlllldvtplslglETAGGVMTTLI  419
            KE  KSINPDEAVAYGATVQAAIL GG+D S++LQ+++LLDV PLS+GLETAGGVMT LI
Sbjct  361  KELYKSINPDEAVAYGATVQAAILSGGSDQSERLQNVVLLDVAPLSMGLETAGGVMTVLI  420

Query  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQI  479
            ARNTTVPT+K+QTFSTYADNQ GVLIQV+EGERSMTRDNHLLGKFNL+ IPPMPRGVPQI
Sbjct  421  ARNTTVPTRKSQTFSTYADNQSGVLIQVYEGERSMTRDNHLLGKFNLEGIPPMPRGVPQI  480

Query  480  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKV  539
            +VTF++DANGIL+V+AVEKSTGKENKITITNDKGRLS+ +IDRMV EA+ YK +DE NK+
Sbjct  481  EVTFEVDANGILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKL  540

Query  540  RIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYES  599
            R+E+KN LE+Y + +RN++ D K+   + + DKK ++ K+ +TI WLD H +AE +E+ES
Sbjct  541  RVESKNKLESYVFQVRNTIRDGKIAGNLSDEDKKQMESKIEDTISWLDQHSAAERDEFES  600

Query  600  KQKELEGVANPILQKMY  616
            KQKE+E + NP+LQK Y
Sbjct  601  KQKEIESMVNPLLQKAY  617

>H257_17322
Length=606

 Score = 984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/609 (83%), Positives = 536/609 (88%), Gaps = 43/609 (7%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+D ++QADIKHWPFK+T GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDSVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            VLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  188  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPK                  
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPK------------------  347

Query  368  NPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
                        QAAIL GNDSS+KLQDLLLLDVTPL L LETAGGVM TLI RNTTVPT
Sbjct  348  ----------PWQAAILSGNDSSEKLQDLLLLDVTPLLLTLETAGGVMATLIQRNTTVPT  397

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
            KK+QTFST A+NQ GVLIQVF                 LD IPPMPRGVP +DVTFDIDA
Sbjct  398  KKSQTFSTCANNQSGVLIQVFRW---------------LDGIPPMPRGVPHVDVTFDIDA  442

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNAL  547
            NGILNVSA+EKSTGKENKITITNDKGRLS+ DI+RMV EAEKYKSEDEANK+RIEAKN L
Sbjct  443  NGILNVSAIEKSTGKENKITITNDKGRLSKDDIERMVQEAEKYKSEDEANKLRIEAKNGL  502

Query  548  ENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGV  607
            ENYAY+LRN+LNDEKL+ ++ EADKKVVDDKVTETI WLDA+QSAE EEYE+KQKELEGV
Sbjct  503  ENYAYNLRNTLNDEKLQGKLDEADKKVVDDKVTETINWLDANQSAEKEEYEAKQKELEGV  562

Query  608  ANPILQKMY  616
            ANPI+QK+Y
Sbjct  563  ANPIMQKLY  571

>CCA16151
Length=643

 Score = 975 bits (2520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/617 (77%), Positives = 551/617 (89%), Gaps = 1/617 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M +   SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AAK
Sbjct  1    MVETTVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKF D  VQ D KHWPF +  G  DKPQI V+  G  K F 
Sbjct  61   NQVAMNAENTVFDAKRLIGRKFHDQTVQQDTKHWPFSVVCGPEDKPQIVVEVNGAKKMFY  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
             EEIS+MVL KMRE+AEA++G++VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+NE
Sbjct  121  AEEISAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNE  180

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDNR  240

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV+HF  EFKRK+RKD++ NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNST
Sbjct  241  LVEHFLTEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNST  300

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFED+C DYFRKTM+PVE+VLRDAKLSK+Q++E+VLVGGSTRIPKVQQLLS+FFNG
Sbjct  301  ITRARFEDLCSDYFRKTMDPVERVLRDAKLSKNQLNEIVLVGGSTRIPKVQQLLSDFFNG  360

Query  361  KEPNKSINPDEAVAYGATVQAAIL-GGNdssdklqdlllldvtplslglETAGGVMTTLI  419
            KE  KSINPDEAVAYGATVQAAIL G +D S++LQ+++LLDV PLS+GLETAGGVMT LI
Sbjct  361  KELYKSINPDEAVAYGATVQAAILSGASDQSERLQNVVLLDVAPLSMGLETAGGVMTVLI  420

Query  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQI  479
             RNTTVPT+K+QTFSTYADNQPGVLIQV+EGER+MTRDNHLLGKFNL+ IPPMPRGVPQI
Sbjct  421  PRNTTVPTRKSQTFSTYADNQPGVLIQVYEGERTMTRDNHLLGKFNLEEIPPMPRGVPQI  480

Query  480  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKV  539
            +VTF++DANGIL+V+AVEKSTGKENKITITNDKGRLS+ +IDRMV EA+ YK +DE NK+
Sbjct  481  EVTFEVDANGILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKL  540

Query  540  RIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYES  599
            R+E KN LE+Y + +RN++ D+K+ +++ + +KK V+ K+ ETI WLD + +AE +E+ES
Sbjct  541  RVECKNKLESYVFHVRNTIRDDKIADKLSDEEKKQVESKIEETISWLDQNTAAERDEFES  600

Query  600  KQKELEGVANPILQKMY  616
            KQK++E + NP+LQK Y
Sbjct  601  KQKDVEDMVNPLLQKAY  617

>PYVX_22981
Length=612

 Score = 961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/610 (79%), Positives = 534/610 (88%), Gaps = 44/610 (7%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQN+RVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  13   TGQSVGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  72

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            A NTVFDAKRLIGRKF+DP+VQ DI+HWPFK+++G+  KPQITVQF+GE KTFQPEEISS
Sbjct  73   AANTVFDAKRLIGRKFNDPVVQQDIRHWPFKVSAGSDSKPQITVQFQGERKTFQPEEISS  132

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL+KMR+VAEAFIGK VKNAVITVPAYFNDSQRQATKDAG IAGLN             
Sbjct  133  MVLMKMRDVAEAFIGKPVKNAVITVPAYFNDSQRQATKDAGVIAGLN-------------  179

Query  187  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
                                           EGIFEVKATAGDTHLGGEDFDNRLV+HF 
Sbjct  180  -------------------------------EGIFEVKATAGDTHLGGEDFDNRLVEHFA  208

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
             EFKRK+RKD++++QRALRRLRTACERAKRTLSSSAQAY+EIDSL+DG+DFN+TITRARF
Sbjct  209  AEFKRKYRKDLSESQRALRRLRTACERAKRTLSSSAQAYVEIDSLYDGVDFNTTITRARF  268

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            E+MCGDYFRKTMEPVE VLRDAKL K QVHEVVLVGGSTRIPKVQQLLS+FFNGKEP KS
Sbjct  269  EEMCGDYFRKTMEPVETVLRDAKLGKGQVHEVVLVGGSTRIPKVQQLLSQFFNGKEPCKS  328

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            INPDEAVA+GATVQAAIL G+DSS KLQDLLLLDV PLSLGLETAGGVMTTLI RNTTVP
Sbjct  329  INPDEAVAFGATVQAAILSGHDSSAKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTVP  388

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
             KK+QTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLDA+PPMPRGVPQIDVTFDID
Sbjct  389  AKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDALPPMPRGVPQIDVTFDID  448

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
            ANGILNV+AVEKSTGKENKITITNDKGRLSQ+DIDRMVAEAEKYK +DE  K R+++KN+
Sbjct  449  ANGILNVTAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKQQDEVQKQRVDSKNS  508

Query  547  LENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEG  606
            LENYAY LRNSLND+K+KEQ+ + D+K VDD+VT+TI WLD++Q AE +E+++KQKEL  
Sbjct  509  LENYAYGLRNSLNDDKIKEQLSDNDRKAVDDQVTQTINWLDSNQMAEKDEFDAKQKELAD  568

Query  607  VANPILQKMY  616
            VANPILQKMY
Sbjct  569  VANPILQKMY  578

>HYAP_01540
Length=634

 Score = 948 bits (2451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/622 (80%), Positives = 525/622 (84%), Gaps = 51/622 (8%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ   S YSVGID+GT YS VGVWQND VEIIA DQGNRT+                  
Sbjct  1    MAQT-MSDYSVGIDVGTMYSRVGVWQNDSVEIIAKDQGNRTSAV----------------  43

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
              VAMNAHNTVFD KRLIGRKFSD +VQAD+KHWPFKLTSGAGDKPQITVQFKGESKTFQ
Sbjct  44   --VAMNAHNTVFDGKRLIGRKFSDAVVQADVKHWPFKLTSGAGDKPQITVQFKGESKTFQ  101

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATK------DAGAIAGLNV  174
             EEISSMVLIKMREVAEAF+GKEVK AVITVPAYFNDSQRQ  +      D+     L  
Sbjct  102  SEEISSMVLIKMREVAEAFMGKEVKKAVITVPAYFNDSQRQRRRMQGPLLDSTCSVSLTS  161

Query  175  LRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGG  234
             R+   PT              R          T+               ATAGDTHLGG
Sbjct  162  RRLRPSPTVWT-----------RRAASAMCSSSTW---------------ATAGDTHLGG  195

Query  235  EDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG  294
            EDFDNRLVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG
Sbjct  196  EDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG  255

Query  295  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  354
            IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL
Sbjct  256  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  315

Query  355  SEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGV  414
            S+FFNGKEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGV
Sbjct  316  SDFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGV  375

Query  415  MTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR  474
            MTTLIARNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPR
Sbjct  376  MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR  435

Query  475  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSED  534
            GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSED
Sbjct  436  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSED  495

Query  535  EANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAET  594
            EANK+RIEAKNALENYAY+LRN+LNDEKLK+QIPE D+K +DDKVTETI WLDA+QSAE 
Sbjct  496  EANKIRIEAKNALENYAYNLRNTLNDEKLKDQIPEDDRKAIDDKVTETINWLDANQSAEK  555

Query  595  EEYESKQKELEGVANPILQKMY  616
            EEYE+KQKE+E VANPILQKMY
Sbjct  556  EEYEAKQKEVESVANPILQKMY  577

>PYIR_15857
Length=577

 Score = 903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/616 (78%), Positives = 509/616 (83%), Gaps = 76/616 (12%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQA  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQA-VAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++ GAGDKPQITV+FKGE+KTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREV+EAFIGKE    +  V A   D+                      
Sbjct  120  PEEISSMVLIKMREVSEAFIGKE---GIFEVKATAGDTH---------------------  155

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
                                   LGG  FD  L+                H  GE     
Sbjct  156  -----------------------LGGEDFDNRLVD---------------HFVGE-----  172

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
                    FKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNST
Sbjct  173  --------FKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNST  224

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  225  ITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  284

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEP K+INPDEAVA+GATVQAAIL GND S+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  285  KEPCKAINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  344

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  345  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  404

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMVAEAEKYK+EDE+NKVR
Sbjct  405  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVR  464

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEAKN LENYAY+LRN+L+DEKLK QI E D+  ++DKVTETI WLDA+QSAE EE+E+K
Sbjct  465  IEAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAK  524

Query  601  QKELEGVANPILQKMY  616
            QKELEG+ANPILQKMY
Sbjct  525  QKELEGIANPILQKMY  540

>PHALS_04330
Length=785

 Score = 854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/446 (98%), Positives = 442/446 (99%), Gaps = 1/446 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ+  SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQS-VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPFK+TSGAGDKPQI VQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPLVQADIKHWPFKVTSGAGDKPQIVVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQ  446
            RNTTVPTKK+QTFSTYADNQPGVLIQ
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQ  445

>PHYKE_6984
Length=450

 Score = 853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/450 (97%), Positives = 443/450 (98%), Gaps = 1/450 (0%)

Query  1    MAQAKTS-GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  59
            MAQ  TS GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFKL+SGAGDKPQITVQFKGESKTF
Sbjct  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  299
            RLVDHF  EFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300

Query  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFN  359
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFN
Sbjct  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360

Query  360  GKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLI  419
            GKEP KSINPDEAVA+GATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  361  GKEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  420

Query  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFE  449
            ARNTTVPTKK+QTFSTYADNQPGVLIQVFE
Sbjct  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450

>PYIW_16873
Length=496

 Score = 825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/457 (92%), Positives = 442/457 (97%), Gaps = 0/457 (0%)

Query  160  RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  219
            RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG
Sbjct  1    RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  60

Query  220  IFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLS  279
            IFEVKATAGDTHLGGEDFDNRLVDHF  EFKRKHRKDIT NQRALRRLRTACERAKRTLS
Sbjct  61   IFEVKATAGDTHLGGEDFDNRLVDHFVGEFKRKHRKDITSNQRALRRLRTACERAKRTLS  120

Query  280  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  339
            SSAQAYIEIDSLFDG+DFNSTITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVV
Sbjct  121  SSAQAYIEIDSLFDGVDFNSTITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVV  180

Query  340  LVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdllll  399
            LVGGSTRIPKVQQLLS+FFNGKEP K+INPDEAVA+GATVQAAIL GND S+KLQDLLLL
Sbjct  181  LVGGSTRIPKVQQLLSDFFNGKEPCKAINPDEAVAFGATVQAAILSGNDQSEKLQDLLLL  240

Query  400  dvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNH  459
            DVTPLSLGLETAGGVMTTLI+RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+
Sbjct  241  DVTPLSLGLETAGGVMTTLISRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN  300

Query  460  LLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSD  519
            LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+D
Sbjct  301  LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAD  360

Query  520  IDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKV  579
            IDRMVAEAEKYK+EDE+NKVRIEAKN LENYAY+LRN+L+DEKLK QI E D+  ++DKV
Sbjct  361  IDRMVAEAEKYKAEDESNKVRIEAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKV  420

Query  580  TETIQWLDAHQSAETEEYESKQKELEGVANPILQKMY  616
            TETI WLDA+QSAE EE+E+KQKELEG+ANPILQKMY
Sbjct  421  TETINWLDANQSAEKEEFEAKQKELEGIANPILQKMY  457

>PPTG_02120
Length=1001

 Score = 806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/441 (94%), Positives = 430/441 (98%), Gaps = 0/441 (0%)

Query  176  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  235
            R +  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE
Sbjct  521  RGLYHPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  580

Query  236  DFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  295
            DFDNRLVDHFTQEFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+
Sbjct  581  DFDNRLVDHFTQEFKRKHRKDLTHNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGV  640

Query  296  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  355
            DFNSTITRARFED+C DYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLS
Sbjct  641  DFNSTITRARFEDLCADYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLS  700

Query  356  EFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVM  415
            +FFNGKEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVM
Sbjct  701  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM  760

Query  416  TTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRG  475
            TTLIARNTTVPTKK+QTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLD IPPMPRG
Sbjct  761  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRG  820

Query  476  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDE  535
            VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMVAEAEKYKSEDE
Sbjct  821  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDE  880

Query  536  ANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETE  595
            ANKVRIEAKNALENYAYSLRNSLNDEK+KE+IPEADKKVVDDKVTE IQWLDA+QSAE E
Sbjct  881  ANKVRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDANQSAEKE  940

Query  596  EYESKQKELEGVANPILQKMY  616
            EYESKQKELE VANP+LQK+Y
Sbjct  941  EYESKQKELESVANPVLQKVY  961

>PHALS_01338
Length=383

 Score = 754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/379 (95%), Positives = 373/379 (98%), Gaps = 1/379 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M QA TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTQA-TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMN+ NTVFDAKRLIGRK+SDP+V+ADIKHWPFK+T+G GDKPQITVQFKGE+KTFQ
Sbjct  60   NQVAMNSSNTVFDAKRLIGRKYSDPVVKADIKHWPFKVTAGPGDKPQITVQFKGETKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEA+IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAYIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LVDHF QEFKRKHRKD++ NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFVQEFKRKHRKDLSQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  361  KEPNKSINPDEAVAYGATV  379
            KEPNKSINPDEAVAYGAT+
Sbjct  360  KEPNKSINPDEAVAYGATI  378

>H310_09434
Length=658

 Score = 751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/618 (62%), Positives = 490/618 (79%), Gaps = 6/618 (1%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAA  59
            MAQ +  G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD A
Sbjct  23   MAQ-EPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGA  81

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            KNQ  +N  NT+FD KRLIGR ++D  VQAD K  PF + +  G +P I V+ KGE+K F
Sbjct  82   KNQATINPENTLFDVKRLIGRSYNDKSVQADKKLLPFHIVNKDG-RPFIEVKIKGEAKQF  140

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             PEE+S+M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAGL V RIIN
Sbjct  141  SPEEVSAMILTKMKTIAENYLGKEVHDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIIN  200

Query  180  EPTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  238
            EPTAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD
Sbjct  201  EPTAAAIAYGIDKKAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFD  260

Query  239  NRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  298
             R++  F ++++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF+
Sbjct  261  QRIMQFFIKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDFD  320

Query  299  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFF  358
             T+TRARFE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ +FF
Sbjct  321  ETLTRARFEELNNDLFKKTLTPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFF  380

Query  359  NGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTL  418
            NGKEP++ INPDEAVAYGA VQ  ILGG  +   L ++LLLDV PLSLG+ET GGVMT +
Sbjct  381  NGKEPSRGINPDEAVAYGAAVQGGILGGE-NDSNLNEILLLDVAPLSLGIETVGGVMTKI  439

Query  419  IARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQ  478
            I RNT VPTKK+QTFSTY DNQP V IQVFEGER+MT+DNH+LGKF L  IPP PRGVPQ
Sbjct  440  INRNTVVPTKKSQTFSTYQDNQPAVSIQVFEGERAMTKDNHILGKFELTGIPPAPRGVPQ  499

Query  479  IDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANK  538
            I+VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ +IDRMV EAE+   ED+  K
Sbjct  500  IEVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIK  559

Query  539  VRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYE  598
             RI+ +N+LE Y Y+L+N++ D KL ++I EADK  +   V E + WLD +Q A+ E+++
Sbjct  560  DRIDGRNSLEGYLYNLKNNVED-KLADKIEEADKDTLLKAVQEAMDWLDENQEADKEDFD  618

Query  599  SKQKELEGVANPILQKMY  616
            ++QK +E +ANPI+ K+Y
Sbjct  619  AQQKAIEKIANPIMAKVY  636

>PYIW_21755
Length=658

 Score = 750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/611 (62%), Positives = 477/611 (78%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  P+ + +  G KP I V  KGE KTF PEE+S+
Sbjct  89   PEQTLFDVKRLIGRGYNDKSVQADKKLLPYNIINKDG-KPLIEVSVKGEKKTFSPEEVSA  147

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            M+L KM++VAE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  148  MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  207

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQFF  267

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  327

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDELTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL V A +K TGK  KITIT +KGRLSQ +IDRMV EA +   ED+  K RI+ +N
Sbjct  507  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  566

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
             LE Y YSL+NS+ D KL ++I E DK  V   V + + WL+ +Q A+ E++E+KQKE+E
Sbjct  567  GLEGYLYSLKNSVED-KLADKIEEDDKDTVLKSVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  606  GVANPILQKMY  616
               NPI+ K+Y
Sbjct  626  KAVNPIMAKVY  636

>PHALS_00833
Length=652

 Score = 750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/611 (62%), Positives = 485/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEII NDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIPNDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P++L +  G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVVIKGEKRQFAPEEVSA  146

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLSKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    DI+ ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNIDISSDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALE Y YSL+N++ +EKL++++ + DK  V + V + + WL+ +Q A+ E+YE+KQKE+E
Sbjct  566  ALEGYLYSLKNNV-EEKLEDKLNDDDKDTVLNAVQDAMDWLEDNQEADKEDYEAKQKEVE  624

Query  606  GVANPILQKMY  616
             + NPI+ K+Y
Sbjct  625  KLVNPIMSKVY  635

>PYAR_18354
Length=1084

 Score = 749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/611 (62%), Positives = 481/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  30   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  89

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  PF + +  G KP I V  KGE K F PEEIS+
Sbjct  90   PEKTLFDVKRLIGRPYNDKSVQADKKLLPFDIVNKDG-KPFIQVTIKGEKKQFSPEEISA  148

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM+ +AEA+IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  149  MVLSKMKTIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  208

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LLSI+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  209  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLSIDAGVFEVLATNGDTHLGGEDFDQRVMQYF  268

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++RAR
Sbjct  269  IKKWKKDKNIDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALSRAR  328

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  329  FEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  388

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVA+GA VQ  ILGG    D  +D+LL+DV PLSLG+ET GGVMT LI RNT +
Sbjct  389  GVNPDEAVAFGAAVQGGILGGE-QDDTNKDILLIDVAPLSLGIETVGGVMTKLINRNTVI  447

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGERSMT+DN +LGKF L  +PP PRGVPQI+V+F++
Sbjct  448  PTKKSQTFSTYQDNQPAVLIQVFEGERSMTKDNRMLGKFELTGLPPAPRGVPQIEVSFEL  507

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL V A +K TGK  KITIT DKGRLSQ +++RMV EAE++  ED+  K RI+ +N
Sbjct  508  DANGILQVGAEDKGTGKAEKITITADKGRLSQEEVERMVKEAEEFADEDKKIKDRIDGRN  567

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALE Y YSL+NS+ D KL ++I E DK+ V   V + + WL+ +Q ++ +++E+KQKE+E
Sbjct  568  ALEGYLYSLKNSVED-KLADKIEEDDKESVLKAVQDAMDWLEDNQESDKDDFEAKQKEVE  626

Query  606  GVANPILQKMY  616
             + NPI+ K+Y
Sbjct  627  KIVNPIMSKVY  637

>PYAP_13341
Length=657

 Score = 748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/611 (62%), Positives = 483/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KGE+K F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPFIQVTIKGENKLFAPEEVSA  147

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM+++AEA+IG+EV +AV+TVPAYFND+QRQATKDAG I+G+ V RIINEPTAAAI
Sbjct  148  MVLTKMKQIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTISGMTVQRIINEPTAAAI  207

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++RAR
Sbjct  268  IKKWKKDKSIDIGKDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALSRAR  327

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLSLG+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDVTKDILLIDVVPLSLGIETVGGVMTKLINRNTVI  446

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+V+F++
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERTMTKDNRLLGKFELTGLPPAPRGVPQIEVSFEL  506

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL V A +K TGK  KITIT +KGRLSQ +I+RMV EAE++  ED+  K RI+ +N
Sbjct  507  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIERMVKEAEEFADEDKKVKDRIDGRN  566

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
             LE Y YSL+N++ D KL ++I E DK+ V   V + + WL+ +Q ++ E++E+KQKE+E
Sbjct  567  GLEGYLYSLKNNVED-KLADKIDEDDKETVLKAVQDAMDWLEDNQDSDKEDFEAKQKEVE  625

Query  606  GVANPILQKMY  616
             V NPI+ K+Y
Sbjct  626  KVVNPIMAKVY  636

>PYVX_16738
Length=658

 Score = 746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/611 (62%), Positives = 477/611 (78%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+ +    G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYADKSVQADKKLLPYHIADKQG-KPFIEVTVKGEKRQFAPEEVSA  146

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM+++AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  147  MVLTKMKQIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  206

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKSVDIGSDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  326

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQ L+ ++FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQTLIKDYFNGKEPSR  386

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGG-ADDELTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL V A +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVGAEDKGTGKAESITITAEKGRLSQEEIDRMVQEAAEFADEDKLVKERIDGRN  565

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALE Y YSL+N++ D KL ++I E DK  V   V + + WL+ +Q A  E++++KQKE+E
Sbjct  566  ALEGYLYSLKNNVED-KLADKIDEDDKDTVLTAVQDAMDWLEDNQEANKEDFDAKQKEVE  624

Query  606  GVANPILQKMY  616
             V NPI+ K+Y
Sbjct  625  KVVNPIMAKVY  635

>PYU1_G004098
Length=656

 Score = 744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/611 (62%), Positives = 478/611 (78%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KGE K F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRGYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGEKKHFSPEEVSA  146

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            M+L KM++ AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL+V RIINEPTAAAI
Sbjct  147  MILTKMKQTAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAI  206

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRVMQFF  266

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKSVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  326

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG  + D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-TDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL V A +K TGK  KITIT +KGRLSQ +IDRMV EA +   ED+  K RI+ +N
Sbjct  506  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  565

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
             LE Y YSL+N++ D K+ ++I E DK  V   V + + WL+ +Q A+ E++E KQKE+E
Sbjct  566  GLEGYLYSLKNTVED-KMADKIEEDDKDAVLKAVQDAMDWLEDNQEADKEDFEGKQKEVE  624

Query  606  GVANPILQKMY  616
             V NPI+ K+Y
Sbjct  625  KVVNPIMAKVY  635

>PPTG_08245
Length=658

 Score = 743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/611 (62%), Positives = 484/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+ L +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYNLVNKDG-KPFIEVEVKGEKRQFAPEEVSA  147

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  566

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALE Y YSL+N++ +EKL+++I E DK  V   V + + WL+ +Q A+ E++E+KQKE+E
Sbjct  567  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  606  GVANPILQKMY  616
             + NPI+ K+Y
Sbjct  626  KLVNPIMSKVY  636

>PHYCA_510696
Length=659

 Score = 743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/611 (62%), Positives = 485/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYEIVNKEG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALE Y YSL+N++ +EKL+++I E DK  V   V + + WL+ +Q A+ E++E+KQKE+E
Sbjct  566  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  624

Query  606  GVANPILQKMY  616
             + NPI+ K+Y
Sbjct  625  KLVNPIMSKVY  635

>PHYSO_286376
Length=660

 Score = 741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/611 (62%), Positives = 484/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P++L +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVEVKGEKRQFAPEEVSA  147

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKSQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  IL G    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILSGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  566

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALE Y YSL+N++ +EKL+++I E DK  V   V + + WL+ +Q A+ E++E+KQKE+E
Sbjct  567  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  606  GVANPILQKMY  616
             + NPI+ K+Y
Sbjct  626  KLVNPIMSKVY  636

>PHYRA_71042
Length=654

 Score = 740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/611 (62%), Positives = 484/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  25   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  84

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQ+D K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  85   PEKTLFDVKRLIGRKYNDKSVQSDKKLLPYEIINKDG-KPFIQVEVKGEKREFAPEEVSA  143

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  144  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  203

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  204  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  263

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  264  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  323

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  324  FEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  383

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  384  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  442

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  443  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  502

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  503  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  562

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALE Y YSL+N++ +EKL+++I E DK  V   V + + WL+ +Q A+ E++E KQKE+E
Sbjct  563  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEEKQKEVE  621

Query  606  GVANPILQKMY  616
             + NPI+ K+Y
Sbjct  622  KLVNPIMSKVY  632

>HYAP_01005
Length=660

 Score = 738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/611 (62%), Positives = 482/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQ+D K  P++L +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM+ +AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +++RAR
Sbjct  268  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTESLSRAR  327

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  328  FEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRN  566

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            +LE Y Y+L+N++ + KL ++I E DK  V   V + + WL+ +Q  + E+YE+KQKE+E
Sbjct  567  SLEGYLYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVE  625

Query  606  GVANPILQKMY  616
             V NPI+ K+Y
Sbjct  626  KVVNPIMSKVY  636

>HYAP_01004
Length=660

 Score = 738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/611 (62%), Positives = 482/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQ+D K  P++L +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM+ +AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +++RAR
Sbjct  268  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTESLSRAR  327

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  328  FEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRN  566

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            +LE Y Y+L+N++ + KL ++I E DK  V   V + + WL+ +Q  + E+YE+KQKE+E
Sbjct  567  SLEGYLYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVE  625

Query  606  GVANPILQKMY  616
             V NPI+ K+Y
Sbjct  626  KVVNPIMSKVY  636

>PHYKE_7992
Length=657

 Score = 738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/611 (62%), Positives = 478/611 (78%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+ L +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYTDKSVQADKKLLPYDLINKDG-KPFIQVEVKGEKRQFAPEEVSA  146

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQDEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            ALE Y YSL+N++ ++   +   E DK  +   V + + WL+ +Q A+ E+YE KQKE+E
Sbjct  566  ALEGYLYSLKNNVEEKLEDKLD-EDDKDTITTAVQDAMDWLEDNQEADKEDYEEKQKEVE  624

Query  606  GVANPILQKMY  616
             + NPI+ KMY
Sbjct  625  KLVNPIMSKMY  635

>PYU1_G004097
Length=663

 Score = 734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/608 (61%), Positives = 484/608 (80%), Gaps = 5/608 (1%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNAHN  69
            +GIDLGTTYSCVGV+++ +V+IIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N   
Sbjct  36   IGIDLGTTYSCVGVFKDGKVDIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATINPEK  95

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KG++K F PEEIS+MVL
Sbjct  96   TIFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGQTKLFSPEEISAMVL  154

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
             KM+++AEA++G++V++AV+TVPAYFND+QRQATKDAG IAGL+V RIINEPTAAAIAYG
Sbjct  155  GKMKQIAEAYLGRDVRDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAIAYG  214

Query  190  LDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
            +DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F ++
Sbjct  215  IDKKAQGEKNVLVFDLGGGTFDVTLLAIDNGVFEVLATNGDTHLGGEDFDQRVMQFFIKK  274

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            +K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF+ T+TRARFE 
Sbjct  275  WKQDKGVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLNGEDFSETLTRARFEK  334

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  D F+KT+ PVEKVL+DA L KSQV E+VLVGGSTRIPKVQQ++ ++FNGKEP++ +N
Sbjct  335  LNEDLFKKTLGPVEKVLKDAGLKKSQVDEIVLVGGSTRIPKVQQMIKDYFNGKEPSRGVN  394

Query  369  PDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  428
            PDEAVAYGA +Q  ILGG+   +KLQDL+L+DV PLS G+ET GGVMT LI RNT +PTK
Sbjct  395  PDEAVAYGAAIQGGILGGD-QDEKLQDLVLIDVVPLSQGIETVGGVMTKLINRNTAIPTK  453

Query  429  KAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDAN  488
            K+Q FST+ DNQ  V I+VFEGER++ + N LLGKF+L  +PP PRGVPQI+VTF+IDAN
Sbjct  454  KSQVFSTHVDNQAAVSIKVFEGERTLVKHNRLLGKFDLAGLPPAPRGVPQIEVTFEIDAN  513

Query  489  GILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALE  548
            GIL VSA +K TGK  KITIT +KGRLSQ +I+RMV +A ++  ED+  K RIE+KN+LE
Sbjct  514  GILQVSAQDKGTGKTEKITITAEKGRLSQEEIERMVQDAAEHAEEDKKVKERIESKNSLE  573

Query  549  NYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVA  608
             Y YS +N++ D KL ++I E DK +V   V + + WLD ++ A+ E++E KQK++E V 
Sbjct  574  TYLYSAKNTVED-KLSDKIEEDDKGIVLQAVKDAMDWLDDNEDADKEDFEGKQKDVEKVV  632

Query  609  NPILQKMY  616
            NPI+ K+Y
Sbjct  633  NPIMAKVY  640

>PITG_00527
Length=656

 Score = 733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/611 (62%), Positives = 485/611 (79%), Gaps = 5/611 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P++L +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+  + D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKKIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKRVKDRIDGRN  565

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
             LE Y YSL+N++ +EKL+++I E DK  V   V + + WL+ +Q A+ E++E+KQKE+E
Sbjct  566  GLEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  624

Query  606  GVANPILQKMY  616
             + NPI+ K+Y
Sbjct  625  KLVNPIMSKVY  635

>SDRG_03564
Length=658

 Score = 727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/612 (61%), Positives = 481/612 (79%), Gaps = 6/612 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
              NT+FD KRLIGR+++D  VQAD K  P+++ +  G +P I V  KGE+KTF  EE+S+
Sbjct  89   PENTLFDVKRLIGRQYNDKSVQADKKLLPYEIVNKEG-RPYIQVIVKGETKTFSAEEVSA  147

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  187  AYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244
            AYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD R++  
Sbjct  208  AYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFDQRVMQF  267

Query  245  FTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304
            F ++++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF+ T+TRA
Sbjct  268  FIKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDFDETLTRA  327

Query  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPN  364
            RFE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ +FFNGKEP+
Sbjct  328  RFEELNNDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFFNGKEPS  387

Query  365  KSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTT  424
            + INPDEAVAYGA VQ  IL G  + +  +D+LLLDV PLSLG+ET GGVMT +I RNT 
Sbjct  388  RGINPDEAVAYGAAVQGGILAG-VNDESTKDILLLDVAPLSLGIETVGGVMTKIINRNTV  446

Query  425  VPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFD  484
            VPTKK+QTFSTY DNQP V IQV+EGER+MT+DNH+LGKF L  IPP PRGVPQI+VTF+
Sbjct  447  VPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQIEVTFE  506

Query  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAK  544
            +DANGIL VSA +K TGK  KITIT +KGRLSQ +IDRMV EAE+   ED+  K RI+ +
Sbjct  507  VDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKDRIDGR  566

Query  545  NALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKEL  604
            N+LE Y Y+L+N++ D+   +   +    V+   V E + WLD +Q A+ E+++++QK +
Sbjct  567  NSLEGYLYNLKNNVEDKLADKIDDDDKDTVL-KAVQEAMDWLDENQEADKEDFDAQQKAV  625

Query  605  EGVANPILQKMY  616
            E V NPI+ K+Y
Sbjct  626  EKVVNPIMSKVY  637

>CCI50234
Length=665

 Score = 721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/612 (61%), Positives = 471/612 (77%), Gaps = 5/612 (1%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  65
            +G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  RLIGDAAKNQ   
Sbjct  34   TGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDATGTRLIGDAAKNQAVH  93

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            N   T+FD KRLIGRKF+D  VQAD K  P+++ +  G KP I V  KGE K F PEEIS
Sbjct  94   NPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTVKGEQKVFAPEEIS  152

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            +MVL KM+++AE  IG  VK+AV+TVPAYFND+QRQATKDAG+IAGL V RIINEPTAAA
Sbjct  153  AMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEPTAAA  212

Query  186  IAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244
            IAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  
Sbjct  213  IAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRVMQF  272

Query  245  FTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304
            F +++ ++   +I  ++RA++++R   ER KR LS++ QA IE++SL DGIDF+  ++RA
Sbjct  273  FIKKWNKEKTIEIEKDKRAVQKIRREAERVKRALSTNTQARIEVESLIDGIDFSDNLSRA  332

Query  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPN  364
             FE +  D FRKT+ PV+KVL+DA L KS+V EVVLVGGSTRIPKVQ+LL  +FNGKE N
Sbjct  333  LFEKLNNDLFRKTLAPVDKVLKDAGLKKSEVDEVVLVGGSTRIPKVQELLKAYFNGKELN  392

Query  365  KSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTT  424
            + +NPDEAVAYGA VQ  ILGG    D  +DLLL+DV PLS G+ET GGVMT +I RNT 
Sbjct  393  RGVNPDEAVAYGAAVQGGILGGE-QDDLNKDLLLIDVIPLSQGIETVGGVMTKIINRNTV  451

Query  425  VPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFD  484
            +PTKK+Q FST +DNQ  V I V EGER+M +DN LLGKF L  IPP PRGVPQI+VTF+
Sbjct  452  IPTKKSQVFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQIEVTFE  511

Query  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAK  544
            +DANGIL VSA +K TGK  KITIT +KGRLS+ +I RMV EAE++  ED+  K RI+ +
Sbjct  512  VDANGILQVSAEDKGTGKAEKITITAEKGRLSEEEIQRMVQEAEEFADEDKRIKERIDGR  571

Query  545  NALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKEL  604
            NALE Y Y+L++ ++D KL ++I E DK+ V + V + + WL+ +Q A+  ++E+KQKE+
Sbjct  572  NALEGYLYNLKSQVDD-KLADKIEEDDKETVSNAVQDALDWLEDNQEADKPDFEAKQKEV  630

Query  605  EGVANPILQKMY  616
            E + NPI+ K+Y
Sbjct  631  EKIVNPIMAKLY  642

>CCA24936
Length=661

 Score = 719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/612 (61%), Positives = 469/612 (77%), Gaps = 5/612 (1%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  65
            +G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  R+IGDAAKNQ   
Sbjct  30   TGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDVTGTRMIGDAAKNQAIH  89

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            N   T+FD KRLIGRKF+D  VQAD K  P+++ +  G KP I V  K E K F PEEIS
Sbjct  90   NPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTIKDEQKVFAPEEIS  148

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            +MVL KM+++AE  IG  VK+AV+TVPAYFND+QRQATKDAG+IAGL V RIINEPTAAA
Sbjct  149  AMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEPTAAA  208

Query  186  IAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244
            IAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  
Sbjct  209  IAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQF  268

Query  245  FTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304
            F +++ ++ + +I  ++RA+++LR   ER KR LS+  QA +E++SL DG DF+  ++RA
Sbjct  269  FIKKWNKEKKINIEQDKRAIQKLRRESERVKRALSTLPQARLEVESLIDGQDFSDVLSRA  328

Query  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPN  364
             FE +  D FRKT+ PVEKVL+DA L KS++ EVVLVGGSTRIPKVQ+LL  FFNGKE N
Sbjct  329  MFEKLNNDLFRKTLAPVEKVLKDAGLKKSEIDEVVLVGGSTRIPKVQELLKAFFNGKELN  388

Query  365  KSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTT  424
            + +NPDEAVAYGA VQ  ILGG    D  +DLLL+DV PLS G+ET GGVMT +I RNT 
Sbjct  389  RGVNPDEAVAYGAAVQGGILGGE-QDDLNKDLLLIDVIPLSQGIETVGGVMTKIINRNTV  447

Query  425  VPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFD  484
            +PTKKAQ FST +DNQ  V I V EGER+M +DN LLGKF L  IPP PRGVPQI+VTF+
Sbjct  448  IPTKKAQLFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQIEVTFE  507

Query  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAK  544
            +DANGIL VSA +K TGK  K+TIT +KGRLS+ +I RMV EAE++  ED+  K RI+ +
Sbjct  508  VDANGILQVSAEDKGTGKAEKVTITAEKGRLSEEEIQRMVQEAEEFADEDKRIKERIDGR  567

Query  545  NALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKEL  604
            NALE Y Y+L++ + DEKL E+I E DK+ V + V + + WL+ +Q A+  ++E+KQKE+
Sbjct  568  NALEGYLYNLKSQV-DEKLAEKIEEDDKETVTNAVQDALDWLEDNQEADKADFEAKQKEV  626

Query  605  EGVANPILQKMY  616
            E V NPI+ K+Y
Sbjct  627  EKVVNPIMAKLY  638

>H257_00007
Length=787

 Score = 685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/607 (59%), Positives = 453/607 (75%), Gaps = 16/607 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANAEGNRTTPSWVAFNETERLIGEAAKLQAAS  248

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+T G GDKP I V F+GE+K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITKGEGDKPLIEVSFRGEAKSFTPEEIS  308

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  186  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  428

Query  243  DHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  301
            D+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  429  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  488

Query  302  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK  361
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  489  TRAKFESLNDECFKRTEETVLKVLQDANMEPGQITELVLVGGSTRIPKVQNMLSGLFGGK  548

Query  362  EPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIAR  421
            E +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  422  NTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDV  481
            NT +P KK + ++T  D Q    + ++EGER+   DN+ LG+F +  I    RG P+++V
Sbjct  608  NTAIPVKKTRIYTTEEDFQTTEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEV  667

Query  482  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRI  541
            TF+IDANGIL+VS  +K TG +N+ TI+N++GRLSQ DIDRMV EAEKYK  D     RI
Sbjct  668  TFEIDANGILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRI  727

Query  542  EAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQ  601
            EA+N LE + Y         +  E   +  +   ++ + ET  WL+ H  A  +E E K+
Sbjct  728  EARNELEGFIY---------RYLEVATKKGEAAAENLLRETRDWLEDHTEATVKELEDKK  778

Query  602  KELEGVA  608
            + LE V 
Sbjct  779  RALERVC  785

>CCA20828
Length=787

 Score = 685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/611 (59%), Positives = 452/611 (74%), Gaps = 17/611 (3%)

Query  2    AQAKTSGYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  59
            A+    G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTDTERLIG+AA
Sbjct  182  AERAERGFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDTERLIGEAA  241

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q A N  NTVFDAKR+IGR F+D  VQ D +H+PFK+ SG GDKP I V++K E+K F
Sbjct  242  KIQAASNPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEYKKETKQF  301

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             PEEIS+MVL +M+E AEA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAGL+V RIIN
Sbjct  302  TPEEISAMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIIN  361

Query  180  EPTAAAIAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  235
            EPTAAA+AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGE
Sbjct  362  EPTAAALAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGE  421

Query  236  DFDNRLVDHFTQEFKRKHR-KDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG  294
            DFDN +VD+  QEFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+G
Sbjct  422  DFDNNMVDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEG  481

Query  295  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  354
            IDF+ T+TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ LL
Sbjct  482  IDFSLTVTRAKFESLNEELFKRCEETVLKVLADAAMKPGDISEIVLVGGSTRIPKVQNLL  541

Query  355  SEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGV  414
            S  FNGKE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G V
Sbjct  542  SGVFNGKELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKV  600

Query  415  MTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR  474
            M+ LI RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+F +  I    R
Sbjct  601  MSVLIKRNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISGIERARR  660

Query  475  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSED  534
            G PQ+ VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV++AEK+K +D
Sbjct  661  GEPQVKVTFEIDANGILNVSATDKKTGAKAETTISNNRGRLSQEDIDRMVSDAEKFKKDD  720

Query  535  EANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAET  594
                 RIEA+N+LE + Y   N+ N         E  +   ++ + +  +WLD H+ A  
Sbjct  721  AEMLARIEARNSLEQFIYRALNNGN---------EKCEAGAENALRDAREWLDDHEEATL  771

Query  595  EEYESKQKELE  605
             E E K++ LE
Sbjct  772  RELEDKKRTLE  782

>H310_14759
Length=787

 Score = 684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/607 (59%), Positives = 450/607 (74%), Gaps = 16/607 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  248

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK++ G GDKP I V F+GE K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKISKGEGDKPLIQVTFRGEDKSFTPEEIS  308

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL +M+E AE F+G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENFLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  186  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDSNMV  428

Query  243  DHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  301
            D    EFKRK+R  D T + R++RRLRTACE AKR LS++  A IE+D+LF+G+DF+ST+
Sbjct  429  DFLVTEFKRKNRNLDPTSSARSMRRLRTACESAKRMLSTTTSATIEVDALFEGVDFSSTM  488

Query  302  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK  361
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  489  TRAKFESLNEECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQTMLSNLFGGK  548

Query  362  EPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIAR  421
            E +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  422  NTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDV  481
            NT +P KK + ++T  D Q    + ++EGER+   DN+ LG+F +  I    RG P+++V
Sbjct  608  NTAIPVKKTRIYTTEEDFQTSEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEV  667

Query  482  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRI  541
            TF+IDANGIL+VS  +K TG +N+ TI+N++GRLSQ DIDRMV EAEKYK  D     RI
Sbjct  668  TFEIDANGILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRI  727

Query  542  EAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQ  601
            EA+N LE + Y         +  E   +  +   ++ + +   WLD H  A  +E E K+
Sbjct  728  EARNDLEGFIY---------RYLEVASKKGEAQAENALRDARDWLDEHAEATVKELEDKK  778

Query  602  KELEGVA  608
            + LE V 
Sbjct  779  RALERVC  785

>H257_18885
Length=786

 Score = 684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/604 (59%), Positives = 453/604 (75%), Gaps = 16/604 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  247

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+T+G  DKP I V FKGE+K+F PEEIS
Sbjct  248  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITAGDDDKPLIEVTFKGEAKSFTPEEIS  307

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  186  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  368  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  427

Query  243  DHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  301
            D+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  428  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  487

Query  302  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK  361
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  488  TRAKFESLNDECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQNMLSGLFGGK  547

Query  362  EPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIAR  421
            E +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI R
Sbjct  548  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKR  606

Query  422  NTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDV  481
            NT +P KK + ++T AD Q  V + ++EGER+    N+ LG+F +  I    RG PQ++V
Sbjct  607  NTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKRGEPQVEV  666

Query  482  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRI  541
            TF+IDANGILNVSA +K T  + + TI+++ GRLSQ DIDRMVA+AEKYK +D     +I
Sbjct  667  TFEIDANGILNVSAKDKKTHAKAETTISSNGGRLSQEDIDRMVADAEKYKKDDAEVLRKI  726

Query  542  EAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQ  601
            EA+N LE + Y         +  E   E      ++ + E  +WL+ H+ A   E E K+
Sbjct  727  EARNNLEGFIY---------RALEIAREKGDSQAENTIREAREWLEDHEEATLRELEDKK  777

Query  602  KELE  605
            + LE
Sbjct  778  RLLE  781

>HYAP_12660
Length=786

 Score = 683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/605 (59%), Positives = 449/605 (74%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD +V+ D KH+PFK+  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFKIKEGDDDKVLIEVEFKGEKKSFTPEEIS  306

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  366

Query  186  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKVCNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLAEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPENVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  +    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG + + TI+N++GRL+Q DIDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLTQEDIDRMVAEADKFKKDDAEMLRR  725

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N LE + Y         +  EQ  E     V+  + +   WL+ H+ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEQAREKGDTTVESAIRDARDWLEDHEEATLRELEDK  776

Query  601  QKELE  605
            ++ LE
Sbjct  777  KRMLE  781

>CCI46091
Length=787

 Score = 682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/605 (59%), Positives = 446/605 (74%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTD+ERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDSERLIGEAAKIQAAS  247

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            N  NTVFDAKR+IGR F+D  VQ D +H+PFK+ SG GDKP I V+FK E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEFKKETKQFTPEEIS  307

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            +MVL +M+E AEA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  308  AMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAA  367

Query  186  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGEDFDN +
Sbjct  368  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGEDFDNNM  427

Query  242  VDHFTQEFKRKHR-KDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            VD+  QEFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+GIDF+ T
Sbjct  428  VDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEGIDFSLT  487

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  E V KVL DA +   ++ E+VLVGGSTRIPKVQ LLS  F G
Sbjct  488  VTRAKFESLNEELFKRCEETVLKVLADAAMKPDEISEIVLVGGSTRIPKVQNLLSAVFGG  547

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  606

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+F +  I    RG PQ+ 
Sbjct  607  RNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISGIERARRGEPQVK  666

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV++AEK+K +D     R
Sbjct  667  VTFEIDANGILNVSATDKKTGAKAETTISNNRGRLSQEDIDRMVSDAEKFKKDDAEMLSR  726

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N LE + Y   N          + E       + + +  +WLD H+ A   E E K
Sbjct  727  IEARNGLEQFIYRAINI---------VQEKGDAATGNALRDAREWLDDHEDATLRELEEK  777

Query  601  QKELE  605
            ++ LE
Sbjct  778  KRMLE  782

>SDRG_05777
Length=786

 Score = 681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/605 (59%), Positives = 450/605 (74%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAAS  247

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  186  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            VD    EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  428  VDFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSST  487

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIPKVQ +LS  F G
Sbjct  488  MTRAKFESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGG  547

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIK  606

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P KK + ++T +D Q  V + ++EGER+    N+ LG+F +  +    RG PQ++
Sbjct  607  RNTAIPIKKTRVYTTESDYQTQVNVVIYEGERACVDHNNKLGEFTISGLERAKRGEPQVE  666

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K T  + + TI+N+ GRLSQ+DIDRMV EAEK+K ED     +
Sbjct  667  VTFEIDANGILNVSARDKKTNAKAETTISNNHGRLSQADIDRMVEEAEKFKKEDAEALKK  726

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N+LE++ Y         +  E   E      ++ + E  +WL+ H+ A   E E K
Sbjct  727  IEARNSLESFIY---------RALELTREKGDAAAENTIREAREWLEDHEDATLRELEEK  777

Query  601  QKELE  605
            ++ LE
Sbjct  778  KRVLE  782

>PPTG_03121
Length=786

 Score = 678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/605 (59%), Positives = 448/605 (74%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD +V+ D  H+PFK+  G  DK  I V+FKGE+K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFKIKEGDDDKVLIEVEFKGENKSFTPEEIS  306

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  186  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  +    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N LE + Y         +  E   E     V+  + +   WL+ H+ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNVESAIRDARDWLEDHEEATLRELEDK  776

Query  601  QKELE  605
            ++ LE
Sbjct  777  KRMLE  781

>PYIW_26567
Length=564

 Score = 677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/539 (63%), Positives = 430/539 (80%), Gaps = 4/539 (1%)

Query  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVA  64
            + G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  
Sbjct  28   SRGPIIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQAT  87

Query  65   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  124
            +N   T+FD KRLIGR +SD  VQAD K  P+ + +  G KP I V  KGE K F PEEI
Sbjct  88   INPEKTIFDVKRLIGRDYSDKSVQADKKLLPYHIVNKDG-KPMIEVLIKGEKKLFSPEEI  146

Query  125  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184
            S+M+L KM+++AE+++G+EV +A++TVPAYFND+QRQATKDAG IAGL V RIINEPTAA
Sbjct  147  SAMILTKMKQIAESYLGREVHDAIVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAA  206

Query  185  AIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  243
            AIAYG+DK+  GE++VL+FDLGGGTFDV+LL+IE G+FEV AT GDTHLGGEDFD R++ 
Sbjct  207  AIAYGIDKQSEGEKHVLVFDLGGGTFDVTLLAIEGGVFEVLATNGDTHLGGEDFDQRVMQ  266

Query  244  HFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  303
             F +++K+    DI  ++RAL++LR   ER KR LS+  QA +EIDSL DG DF+ T++R
Sbjct  267  FFIKKWKKDRGIDIGSDKRALQKLRREAERVKRALSTQTQARLEIDSLLDGEDFSETLSR  326

Query  304  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP  363
            ARFE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIPKVQQL+ +FFNGKEP
Sbjct  327  ARFEKLNEDLFKKTLTPVEKVLKDAGIKKSEVDEIVLVGGSTRIPKVQQLIKDFFNGKEP  386

Query  364  NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNT  423
            ++ +NPDEAVAYGA VQ  ILGG  +   L D++L+DV PLS G+ET GGVMT LI RNT
Sbjct  387  SRGVNPDEAVAYGAAVQGGILGG-MNQKDLGDIVLIDVVPLSQGIETVGGVMTKLINRNT  445

Query  424  TVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTF  483
             +P KK+Q FST+ DNQP V I+V+EGER++ +DNHLLGKF+L  IPP PRG+PQI+VTF
Sbjct  446  AIPNKKSQVFSTHVDNQPAVSIKVYEGERTLVKDNHLLGKFDLTGIPPAPRGIPQIEVTF  505

Query  484  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIE  542
            +IDANGIL VSA +K TGK  KITIT +KGRLSQ++IDR++ EAE++  ED+  K RI+
Sbjct  506  EIDANGILQVSAEDKGTGKAEKITITAEKGRLSQAEIDRIIEEAEQFAEEDKKVKERID  564

>PHYRA_47873
Length=396

 Score = 677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/357 (99%), Positives = 357/357 (100%), Gaps = 0/357 (0%)

Query  260  NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTME  319
            NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTME
Sbjct  1    NQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTME  60

Query  320  PVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATV  379
            PVEKVLRDAKLSKSQV+EVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATV
Sbjct  61   PVEKVLRDAKLSKSQVNEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATV  120

Query  380  QAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADN  439
            QAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADN
Sbjct  121  QAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADN  180

Query  440  QPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  499
            QPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKS
Sbjct  181  QPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  240

Query  500  TGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN  559
            TGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN
Sbjct  241  TGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN  300

Query  560  DEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANPILQKMY  616
            DEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANPILQKMY
Sbjct  301  DEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANPILQKMY  357

>PYIW_22144
Length=633

 Score = 677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/605 (59%), Positives = 450/605 (74%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  186  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            V++   EFKRK+R  D + + RA+RRL TACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSSSPRAMRRLHTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  E V KVL+DA +   ++ E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLQDANMKPGEITELVLVGGSTRIPKVQTMLSGLFNG  393

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+ T  N+ LG+FN+  +    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG   + TI+N+ GRLSQSDIDRMVA+AEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDDAELLRR  572

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+NALE Y Y         +  E   E     V+  + +   WL+ H+ A   E E K
Sbjct  573  IEARNALEQYIY---------RAIELSREKGDANVETAIRDARDWLEDHEEATLRELEDK  623

Query  601  QKELE  605
            ++ LE
Sbjct  624  KRALE  628

>PYIR_24387
Length=633

 Score = 676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/611 (59%), Positives = 451/611 (74%), Gaps = 17/611 (3%)

Query  2    AQAKTSGYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  59
            A+    G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AA
Sbjct  28   AKRAEKGFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAA  87

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q A NA NTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGESK F
Sbjct  88   KIQAASNATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRF  147

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             PEEISSMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIIN
Sbjct  148  TPEEISSMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIIN  207

Query  180  EPTAAAIAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  235
            EPTAAA+AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGE
Sbjct  208  EPTAAALAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGE  267

Query  236  DFDNRLVDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG  294
            DFDN +V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G
Sbjct  268  DFDNNMVEYLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEG  327

Query  295  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  354
            +DF++T+TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ +L
Sbjct  328  VDFSATVTRAKFESLGEELFKRCEETVLKVLSDANMKPEDITELVLVGGSTRIPKVQTML  387

Query  355  SEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGV  414
            S  FNGKE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G V
Sbjct  388  SGLFNGKELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKV  446

Query  415  MTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR  474
            M+ LI RNT +P +K + ++T  D Q  V + ++EGER+ T  N+ LG+FN+  +    R
Sbjct  447  MSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKR  506

Query  475  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSED  534
            G PQ++VTF+IDANGILNVSA +K TG   + TI+N+ GRLSQSDIDRMVA+AEK+K +D
Sbjct  507  GEPQVEVTFEIDANGILNVSARDKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDD  566

Query  535  EANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAET  594
                 RIEA+N+LE Y Y         +  E   E     V+  + +   WL+ H+ A  
Sbjct  567  AELLRRIEARNSLEQYIY---------RAIEIAREKGDANVETAIRDARDWLEDHEEATL  617

Query  595  EEYESKQKELE  605
             E E K++ LE
Sbjct  618  RELEDKKRVLE  628

>SPRG_10519
Length=782

 Score = 675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/605 (59%), Positives = 443/605 (73%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  183  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  242

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G GDKP I V FKGE K F PEEIS
Sbjct  243  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGEGDKPLIQVTFKGEEKNFSPEEIS  302

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  303  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  362

Query  186  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  363  LAYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  422

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            VD+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  423  VDYLITEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSST  482

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++T E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  F G
Sbjct  483  MTRAKFESLNEECFKRTEETVLKVLADANMQPGDITELVLVGGSTRIPKVQNMLSAVFGG  542

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+E  G VM+ LI 
Sbjct  543  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIK  601

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P KK + ++T  D Q    + +FEGER+   DN+ LG+F +  I    RG PQI+
Sbjct  602  RNTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISGIERAKRGEPQIE  661

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGIL+VSA +K TG +N  TI+N++GRL+Q DIDRMV EAEK+K +D     R
Sbjct  662  VTFEIDANGILHVSARDKKTGAKNATTISNNRGRLTQQDIDRMVEEAEKFKKDDAQMLKR  721

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            I+A+N LE Y Y         +  E   + +       + E   W+D ++     E E K
Sbjct  722  IDARNDLEGYLY---------RALEAASKKNDAAAQTALREARDWMDDNEELTVRELEDK  772

Query  601  QKELE  605
            ++ LE
Sbjct  773  RRVLE  777

>PITG_11913
Length=786

 Score = 675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/605 (59%), Positives = 446/605 (74%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDEDKVLIEVEFKGEKKSFTPEEIS  306

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  186  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLSEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  +    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIETAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  601  QKELE  605
            ++ LE
Sbjct  777  KRMLE  781

>PYVX_18121
Length=633

 Score = 673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/611 (58%), Positives = 447/611 (73%), Gaps = 17/611 (3%)

Query  2    AQAKTSGYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  59
            A+    G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AA
Sbjct  28   AKRAEKGFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAA  87

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q A NA NTVFDAKR+IGR FSD +V+ D  H+PFK+  G  +K  I V+FKGE+K F
Sbjct  88   KIQAASNATNTVFDAKRIIGRNFSDEVVKKDATHFPFKIVEGDDNKVLIEVEFKGEAKRF  147

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             PEEISSMVL++M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIIN
Sbjct  148  TPEEISSMVLLRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIIN  207

Query  180  EPTAAAIAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  235
            EPTAAA+AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGE
Sbjct  208  EPTAAALAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGE  267

Query  236  DFDNRLVDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG  294
            DFDN +V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G
Sbjct  268  DFDNNMVEHLLTEFKRKNRSLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEG  327

Query  295  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  354
            +DF+ST+TRA+FE +  + F++  E V KVL DA +    V E+VLVGGSTRIPKVQ +L
Sbjct  328  VDFSSTVTRAKFESLNEELFKRCEETVLKVLSDANMKPEDVTELVLVGGSTRIPKVQTML  387

Query  355  SEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGV  414
            S  F GKE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G V
Sbjct  388  STLFGGKELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKV  446

Query  415  MTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR  474
            M+ LI RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  I    R
Sbjct  447  MSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDSNNKLGEFNISGIERAKR  506

Query  475  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSED  534
            G PQ++VTF+IDANGILNVSA +K TG   + TI+N++GRL+Q DIDRMV EAEK+K +D
Sbjct  507  GEPQVEVTFEIDANGILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVQEAEKFKKDD  566

Query  535  EANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAET  594
                 RIEA+N LE + Y         +  E   E     V++ + +   WL+ H+ A  
Sbjct  567  AEMLRRIEARNDLEQFIY---------RAIETAREKGDANVENAIRDARDWLEDHEEATL  617

Query  595  EEYESKQKELE  605
             E E K++ LE
Sbjct  618  RELEDKKRMLE  628

>PYAP_22238
Length=633

 Score = 673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/611 (58%), Positives = 449/611 (73%), Gaps = 17/611 (3%)

Query  2    AQAKTSGYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  59
            A+    G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AA
Sbjct  28   AKRAEKGFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAA  87

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q A N  NTVFDAKR+IGR FSD IV+ D  H+PFK+T G  +K  I V+FKGE+K+F
Sbjct  88   KIQAASNPSNTVFDAKRIIGRNFSDEIVKKDATHFPFKITEGDDNKVLIQVEFKGETKSF  147

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             PEEISSMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIIN
Sbjct  148  TPEEISSMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIIN  207

Query  180  EPTAAAIAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  235
            EPTAAA+AYGLD   G+     NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGE
Sbjct  208  EPTAAALAYGLDTNAGQSGKGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGE  267

Query  236  DFDNRLVDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG  294
            DFDN +VD+   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G
Sbjct  268  DFDNNMVDYLLSEFKRKNRGLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEG  327

Query  295  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  354
            +DF++TITRA+FE +  + F++  E V KVL DA +    + EVVLVGGSTRIPKVQ +L
Sbjct  328  VDFSTTITRAKFESLNEELFKRCEETVVKVLSDANMKPEDITEVVLVGGSTRIPKVQTML  387

Query  355  SEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGV  414
            S  F GKE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G V
Sbjct  388  SAQFGGKELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKV  446

Query  415  MTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR  474
            M+ LI RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  I    R
Sbjct  447  MSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDANNKLGEFNISGIERAKR  506

Query  475  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSED  534
            G PQ++VTF+IDANGILNVSA +K TG   + TI+N++GRL+Q DIDRMVAEAEKYK +D
Sbjct  507  GEPQVEVTFEIDANGILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVAEAEKYKKDD  566

Query  535  EANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAET  594
                 +IEA+N LE + Y         +  E   E  +   ++ + +   WL+ H+ A  
Sbjct  567  AELLRKIEARNELEQFIY---------RAIEIAREKGETEAENAIRDARDWLEDHEDASL  617

Query  595  EEYESKQKELE  605
             E E K++ LE
Sbjct  618  RELEDKKRMLE  628

>PHYKE_10815
Length=786

 Score = 673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/605 (58%), Positives = 446/605 (74%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEMVKKDAKHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL++M+E AEAF+G+++  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQKIGQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  186  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  427  VEHLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  486

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVTKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  +    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  601  QKELE  605
            ++ LE
Sbjct  777  KRMLE  781

>PHYRA_78193
Length=786

 Score = 672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/605 (58%), Positives = 446/605 (74%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FKG+ K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDDDKVLIEVEFKGDKKSFTPEEIS  306

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  186  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGTACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  + V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEDTVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  +    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIETAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  601  QKELE  605
            ++ LE
Sbjct  777  KRMLE  781

>PYU1_G001540
Length=633

 Score = 672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/605 (59%), Positives = 446/605 (74%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  93

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NAHNTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGE K F PEEIS
Sbjct  94   NAHNTVFDAKRIIGRNFNDEIVKKDAKHFPFKIVEGDDNKVLIEVEFKGEQKRFTPEEIS  153

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  186  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGNNGQKTNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  273

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLADANMKPEDITELVLVGGSTRIPKVQTMLSSLFNG  393

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+ T  N+ LG+FN+  +    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG   + TI+ + GRLSQ DIDRMVAEAEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISQNAGRLSQDDIDRMVAEAEKFKKDDAELLRR  572

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N LE + Y         +  +   E     V+  + +   WL+ H+ A   E E K
Sbjct  573  IEARNDLEQFIY---------RAIDIAREKGDSNVETSIRDARDWLEEHEEATLRELEDK  623

Query  601  QKELE  605
            ++ LE
Sbjct  624  KRSLE  628

>PHALS_02079
Length=786

 Score = 671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/605 (58%), Positives = 444/605 (73%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  246

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NT+FDAKR+IGR FSD +V+ D  H+PF +  G  DK  I V FKGE K+F PEEIS
Sbjct  247  NATNTIFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVDFKGEKKSFTPEEIS  306

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQNISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  186  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LSS+  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLSEFKRKNRNMDPSTSARAMRRLRTACESAKRMLSSTTSASVEVDSLFEGVDFSST  486

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  +    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEIAREKGDTNTESAIRDARDWLEDHEEATLRELEDK  776

Query  601  QKELE  605
            ++ LE
Sbjct  777  KRMLE  781

>SPRG_00333
Length=615

 Score = 669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/612 (58%), Positives = 453/612 (74%), Gaps = 49/612 (8%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
              NT+FD KRLIGR+++D  VQAD K  PF++ +  G +P I V+ KGE+KTF  EE+S+
Sbjct  89   PENTLFDVKRLIGRQYNDKSVQADKKLLPFEIINKEG-RPYIQVKVKGETKTFSAEEVSA  147

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  187  AYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244
            AYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD R++  
Sbjct  208  AYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFDQRVMQF  267

Query  245  FTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304
            F ++++++ + DI+ ++RAL++LR   E+  R                            
Sbjct  268  FIKKWQKQKKIDISSDKRALQKLRREAEQDAR----------------------------  299

Query  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPN  364
                           PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ +FFNGKEP+
Sbjct  300  ---------------PVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFFNGKEPS  344

Query  365  KSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTT  424
            + INPDEAVAYGA VQ  IL G  + D  +D+LLLDV PLSLG+ET GGVMT +I RNT 
Sbjct  345  RGINPDEAVAYGAAVQGGILAG-VNDDGTKDILLLDVAPLSLGIETVGGVMTKIINRNTV  403

Query  425  VPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFD  484
            VPTKK+QTFSTY DNQP V IQV+EGER+MT+DNH+LGKF L  IPP PRGVPQI+VTF+
Sbjct  404  VPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQIEVTFE  463

Query  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAK  544
            +DANGIL VSA +K TGK  KITIT +KGRLSQ +IDRMV EAE+   ED+  K RI+ +
Sbjct  464  VDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKDRIDGR  523

Query  545  NALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKEL  604
            N+LE Y Y+L+N++ D KL ++I + DK  V   V E + WLD +Q A+ E+++++QK +
Sbjct  524  NSLEGYLYNLKNNVED-KLADKIDDEDKDTVLKAVQEAMDWLDENQEADKEDFDAQQKAV  582

Query  605  EGVANPILQKMY  616
            E V NPI+ K+Y
Sbjct  583  EKVVNPIMSKVY  594

>PHYCA_509820
Length=786

 Score = 667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/605 (58%), Positives = 443/605 (73%), Gaps = 17/605 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD +V+ D  H+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  186  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            IAYGLD   G      NVLIFDLGGGTFDVSLLSIEEGIF VK+T GDT+LG EDFDN +
Sbjct  367  IAYGLDTNAGTDGKACNVLIFDLGGGTFDVSLLSIEEGIFGVKSTGGDTYLGSEDFDNNM  426

Query  242  VDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  +    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  601  QKELE  605
            ++ LE
Sbjct  777  KRMLE  781

>SPRG_10477
Length=762

 Score = 647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/599 (58%), Positives = 432/599 (72%), Gaps = 28/599 (5%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A NA NT
Sbjct  184  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAASNATNT  243

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
            VFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEISSMVL 
Sbjct  244  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDDDKPLIQVSFKGEDKRFTPEEISSMVLT  303

Query  131  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  190
            +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  304  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  363

Query  191  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
            D   G    + N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLG +  D  L     
Sbjct  364  DTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGVQAQDKGL-----  418

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
                     D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+TRA+F
Sbjct  419  ---------DPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSSTMTRAKF  469

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            E +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIPKVQ +LS  F GKE +KS
Sbjct  470  ESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGGKELSKS  529

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            INPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI RNT +P
Sbjct  530  INPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIP  588

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
             KK + ++T  D Q  V + ++EGER+    N+ LG+F +  I    RG PQ+ VTF+ID
Sbjct  589  VKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGIERAKRGEPQVQVTFEID  648

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
            ANGILNVSA++K T  + + TI N+ GRL+Q DIDRMVA+AEK+K +D     +IEA+N+
Sbjct  649  ANGILNVSALDKKTNAKAETTINNNNGRLTQEDIDRMVADAEKFKKDDAEVLKKIEARNS  708

Query  547  LENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
            LE++ Y         +  E   E      ++ + E  +WL+ H+ A   E E K++ LE
Sbjct  709  LESFIY---------RALELTREKGDAAAENTIREAREWLEDHEDATLRELEEKKRVLE  758

>PHYRA_41888
Length=586

 Score = 645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/347 (87%), Positives = 327/347 (94%), Gaps = 0/347 (0%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFD KRLIGRKF+DP VQ+DI+HWPFK+  G  +KP++ VQFKGE  TFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQPEEISS  125

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL+KMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAI
Sbjct  126  MVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAI  185

Query  187  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV+ F 
Sbjct  186  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEFFV  245

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
            QEFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNSTITRARF
Sbjct  246  QEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNSTITRARF  305

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
            ED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPKVQQ 
Sbjct  306  EDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPKVQQF  352

 Score = 312 bits (799),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 171/192 (89%), Gaps = 0/192 (0%)

Query  425  VPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFD  484
            VP KKAQ+FSTYADNQ GVLIQVFEGERSMT DNHLLGKFNLD IPPMPRGVPQIDVTFD
Sbjct  364  VPAKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFD  423

Query  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAK  544
            +D NGILNVSAVEKSTGKENKI ITNDKGRLSQS+I+RMV +AEKYK +DE NK+RIE+K
Sbjct  424  VDVNGILNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLRIESK  483

Query  545  NALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKEL  604
            NALENYA+SLR+S  DEK+  ++ + DKK ++DKV ET+ WLDA+Q+A  EE+++KQ+EL
Sbjct  484  NALENYAFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAKQQEL  543

Query  605  EGVANPILQKMY  616
            EGV NPI+QK+Y
Sbjct  544  EGVTNPIMQKIY  555

>PHYRA_47865
Length=381

 Score = 629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/337 (98%), Positives = 336/337 (99%), Gaps = 0/337 (0%)

Query  280  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  339
            SSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTMEPVEKVLRDAKLSKSQV+EVV
Sbjct  2    SSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTMEPVEKVLRDAKLSKSQVNEVV  61

Query  340  LVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdllll  399
            LVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLL
Sbjct  62   LVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLL  121

Query  400  dvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNH  459
            DVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNH
Sbjct  122  DVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNH  181

Query  460  LLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSD  519
            LLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSD
Sbjct  182  LLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSD  241

Query  520  IDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKV  579
            IDRMVAEAEKYKSED+ANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKV
Sbjct  242  IDRMVAEAEKYKSEDKANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKV  301

Query  580  TETIQWLDAHQSAETEEYESKQKELEGVANPILQKMY  616
            TETI WLDA+QSAETEEYESKQKELEGVANPILQKMY
Sbjct  302  TETINWLDANQSAETEEYESKQKELEGVANPILQKMY  338

>PYIR_16737
Length=511

 Score = 607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/491 (63%), Positives = 389/491 (79%), Gaps = 3/491 (1%)

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            M+L KM++VAE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  1    MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  60

Query  187  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  61   AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQFF  120

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  121  IKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  180

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ ++FNGKEP++
Sbjct  181  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  240

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             +NPDEAVAYGA VQ  ILGG    D  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  241  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  299

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            PTKK+QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L  +PP PRGVPQI+VTF+I
Sbjct  300  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  359

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKN  545
            DANGIL V A +K TGK  KITIT +KGRLSQ +IDRMV EA +   ED+  K RI+ +N
Sbjct  360  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  419

Query  546  ALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
             LE Y YSL+N+++D KL ++I E DK  V   V + + WL+ +Q A+ E++E+KQKE+E
Sbjct  420  GLEGYLYSLKNTVDD-KLADKIEEDDKDSVLKAVQDAMDWLEDNQEADKEDFEAKQKEVE  478

Query  606  GVANPILQKMY  616
             + NPI+ K+Y
Sbjct  479  KIVNPIMAKVY  489

>H310_02604
Length=312

 Score = 574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/296 (92%), Positives = 287/296 (97%), Gaps = 0/296 (0%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+DP++QADIKHWPFK+T GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            VLIKM+EV+EA+IG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  188  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGG+DFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGKDFDNRLVDHFTA  245

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  303
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT+
Sbjct  246  EFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITQ  301

>PHYRA_72238
Length=601

 Score = 567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/615 (51%), Positives = 413/615 (67%), Gaps = 30/615 (5%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M  +   G  VGIDLGTT++ VGVWQN+RVEI+ +  G+ +TPSYVAFT+T RLIG AAK
Sbjct  1    MVLSTPEGPVVGIDLGTTFARVGVWQNNRVEIVPSCDGSYSTPSYVAFTETSRLIGHAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
             Q+  NA NTVF   +L+GRKFSDP VQ  +KHWPFK+  G  D P++ VQF+GE+KTFQ
Sbjct  61   YQLTRNARNTVFGMNQLVGRKFSDPEVQRSMKHWPFKVICGQNDNPEVEVQFRGETKTFQ  120

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            P EI +M+L ++RE+AE   GK VK  V+TVP+ FN SQR+A KDAG IAGLNVLR +N 
Sbjct  121  PVEILAMLLAELRELAEKHTGKTVKEVVLTVPSCFNHSQRRAMKDAGEIAGLNVLRFVNP  180

Query  181  PTAAAIAYGLDK--KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  238
             TAA+IAYG DK    GE +VL+FDLGGG  DVS+++IE+GI+EVKA   D  LGG+  D
Sbjct  181  ATAASIAYGFDKDWTDGEHDVLVFDLGGGMLDVSVVTIEQGIYEVKAAVTDARLGGQVLD  240

Query  239  NRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  298
            NRLV+H   +F+R H K++  N RA+ RLR ACE+AKR LSSS + YIE+D+L DGID+ 
Sbjct  241  NRLVEHCVTDFERVHDKNLRVNLRAITRLRLACEQAKRALSSSTETYIELDALHDGIDYY  300

Query  299  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFF  358
            +TITRA  E++  D F K ++ V+KVLRDA+++K +V EVV+ GGS R PK+ QLL +FF
Sbjct  301  ATITRAEMENLSADLFDKALQLVQKVLRDARVAKDRVREVVVGGGSARSPKMLQLLKDFF  360

Query  359  NGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTL  418
            + K  +  I PDE  A+G TVQAAIL    +S  L D ++LDVTPLSL  E  G     +
Sbjct  361  SDKALSSPIRPDEGAAFGVTVQAAILNC-VASPTLYDFIMLDVTPLSLWAEVDGTNSLVV  419

Query  419  IARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQ  478
            I R+TTVPTK+   FST  DNQ  + +++FEGE S    N LLG   +D IP  PRG  +
Sbjct  420  IYRHTTVPTKRTVPFSTSEDNQAVMRVRIFEGEHSDMSANCLLGTIEVDNIPLKPRGESE  479

Query  479  IDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANK  538
            I+VT DI+A+ I+NVS  E STG E  ++I                         D   +
Sbjct  480  IEVTLDINADDIVNVSVKEISTGLEKNLSI-----------------------GTDAREE  516

Query  539  VRIEAKNALENYAYSLRNS--LNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEE  596
            +R+ +K ALE+YA ++ +S   N  +LK  I  AD + + D  T+T+ WL+ + SAE E 
Sbjct  517  LRLGSKTALESYANAVCSSATANIAELKRSI--ADMQAIKDSATDTLHWLNGNHSAEKEA  574

Query  597  YESKQKELEGVANPI  611
            ++ K+++LE VA P+
Sbjct  575  FDVKRQKLEEVATPV  589

>PYU1_G003754
Length=650

 Score = 529 bits (1363),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 306/624 (49%), Positives = 397/624 (64%), Gaps = 27/624 (4%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  20   MFSAAAGSEVIGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPA  79

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +K+ SG   K    V+ KG  K +
Sbjct  80   KRQAVTNPENTFYAVKRLIGRKFQDKETQEVSKVVSYKIVSGPNGK-DAWVEAKG--KKY  136

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             P +I SMVL KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  137  SPSQIGSMVLTKMKETADGFLGKSVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  196

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  197  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  255

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  296
             L+     EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  256  ELLRFLVGEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  313

Query  297  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
                N  ITRA+FE + G    +TM P +K ++DA L K  ++EV+LVGG +R+PKVQ  
Sbjct  314  PKHLNMKITRAQFEKLVGHLIERTMTPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTS  373

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            + EFF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  374  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  427

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
            V T LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP P
Sbjct  428  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  487

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSE  533
            RGVPQI+V+FDIDANGI+NV+A +K+TGKE  I I +  G LS +DI+RMVAEAE     
Sbjct  488  RGVPQIEVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG-LSDADIERMVAEAEMNAEA  546

Query  534  DEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAE  593
            D+  K  IEAKN  ++ +Y+      ++ LKE   + DK+ V ++V   ++ L      E
Sbjct  547  DQKRKELIEAKNEADSVSYT-----TEKTLKEHEDKLDKETV-EQVKAGLENLRTKAEGE  600

Query  594  -TEEYESKQKELEGVANPILQKMY  616
              EE ++  +E++ ++  I + +Y
Sbjct  601  NAEEIKAALEEVQKLSLKIGEAVY  624

>PYAP_19738
Length=648

 Score = 529 bits (1362),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 294/557 (53%), Positives = 366/557 (66%), Gaps = 20/557 (4%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  69
            +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  29   IGIDLGTTNSCVAVMEGKTPRVIENAEGARTTPSVVAILENDERLVGMPAKRQAVTNPDN  88

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  89   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVPGPNGK-DAWVEAKG--KKYSPSQIGSMVL  145

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
             KM+E A++F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  146  TKMKETADSFLGKSVSQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  205

Query  190  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  249
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EF
Sbjct  206  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVAEF  264

Query  250  KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  303
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  265  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  322

Query  304  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP  363
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PKVQQ + EFF GK+P
Sbjct  323  ATFEKLVSGLVERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFF-GKKP  381

Query  364  NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNT  423
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  382  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  436

Query  424  TVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTF  483
            T+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP PRGVPQI+VTF
Sbjct  437  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVTF  496

Query  484  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEA  543
            DIDANGI+NVSA +KSTGKE  I I +  G LS +DI+RMV EAE     D+  K  IEA
Sbjct  497  DIDANGIVNVSARDKSTGKEQSIVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIEA  555

Query  544  KNALENYAYSLRNSLND  560
            KN  ++ AY+   +L +
Sbjct  556  KNEADSVAYTTEKTLKE  572

>PYVX_15051
Length=632

 Score = 526 bits (1354),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 296/583 (51%), Positives = 376/583 (64%), Gaps = 26/583 (4%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  A
Sbjct  1    MFSAAAGAEVIGIDLGTTNSCVAVMEGKAPRVIENSEGARTTPSVVAILENDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF+D   Q   K   +++ SG   K    V+ KG  K +
Sbjct  61   KRQAVTNPQNTFYAVKRLIGRKFTDKETQEVSKVVSYEIVSGPNGK-DAWVEAKG--KKY  117

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             P +I SMVL KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETAEGFLGKSITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYGLDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD 
Sbjct  178  EPTAAALAYGLDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDE  236

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  296
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVSEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  297  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
                N  ITRA FE +  +   +T+ P +K ++DA L K  ++EV+LVGG +R+PKVQQ 
Sbjct  295  PKHLNMKITRATFEKLVANLIDRTIGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQS  354

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            + +FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEDFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
            V T LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAP  468

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSE  533
            RGVPQI+V FDIDANGI+NVSA +K+T KE  I I +  G LS SDI+RMV EAE     
Sbjct  469  RGVPQIEVAFDIDANGIVNVSARDKATNKEQSIVIQSSGG-LSDSDIERMVQEAEMNAEA  527

Query  534  DEANKVRIEAKNALENYAYSLRNSLN------DEKLKEQIPEA  570
            D+  K  IE+KN  ++ AY++  +L       D++ KEQ+  A
Sbjct  528  DQKRKELIESKNEADSVAYNVEKTLKEHEDKLDDETKEQVKTA  570

>H310_06631
Length=651

 Score = 522 bits (1344),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 296/622 (48%), Positives = 394/622 (63%), Gaps = 29/622 (5%)

Query  4    AKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ  62
            A +    +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q
Sbjct  21   AASGAEVIGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQ  80

Query  63   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQIT-VQFKGESKTFQP  121
               N  NT++  KRLIGRK+ D   Q   K   +K+ +G    P  T    + + + + P
Sbjct  81   AVTNPFNTLYAVKRLIGRKYQDKETQDVSKVVSYKIVAG----PNGTDAWVEAQGQKYSP  136

Query  122  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  181
             +I SMVL KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEP
Sbjct  137  SQIGSMVLTKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEP  196

Query  182  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            TAAA+AYGLDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L
Sbjct  197  TAAALAYGLDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEEL  255

Query  242  VDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID-----  296
            + H   EFKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D     
Sbjct  256  LRHLVSEFKRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPK  313

Query  297  -FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  355
              N  ITRA+FE + G    +T+ P +K ++DA ++K +++EV+LVGG +R+PKVQ  + 
Sbjct  314  HLNIKITRAQFEKLVGHLIERTLNPCKKCVKDAGVTKEEINEVILVGGMSRMPKVQTSVE  373

Query  356  EFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVM  415
            EFF GK P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV 
Sbjct  374  EFF-GKRPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVF  427

Query  416  TTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRG  475
            T LI RNTT+PTKK+Q FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG
Sbjct  428  TKLIPRNTTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRG  487

Query  476  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDE  535
            +PQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+ +I+RMV EAE     D 
Sbjct  488  IPQIEVSFDIDANGIVNVGARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADA  546

Query  536  ANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWL-DAHQSAET  594
              K  IEAKN  ++  Y+   +L + + K      D  +V D V  ++Q + DA +  + 
Sbjct  547  KRKELIEAKNEADSLVYTTEKTLTEHEAK-----LDAALV-DSVKASLQGVRDAIEKDDL  600

Query  595  EEYESKQKELEGVANPILQKMY  616
            E  ++  +EL   +  I + +Y
Sbjct  601  ETLKAALEELNKTSMKIGEAIY  622

>H257_01277
Length=652

 Score = 520 bits (1340),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 283/561 (50%), Positives = 369/561 (66%), Gaps = 20/561 (4%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  69
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N +N
Sbjct  28   IGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPYN  87

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            T++  KRLIGRKF D   Q   K   +K+ +G  +     V+ +G+   + P +I SMVL
Sbjct  88   TLYAVKRLIGRKFQDKETQEVAKVVSYKIVAGT-NGTDAWVEAQGQK--YSPSQIGSMVL  144

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
             KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  145  TKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  204

Query  190  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  249
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H   EF
Sbjct  205  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHLVSEF  263

Query  250  KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  303
            KR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  ITR
Sbjct  264  KRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKITR  321

Query  304  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP  363
            A+FE +      +T+ P +K ++DA ++K +++EV+LVGG +R+PKVQ  + EFF GK P
Sbjct  322  AQFEKLVNHLIERTLNPCKKCVKDAGVTKDEINEVILVGGMSRMPKVQTSVEEFF-GKRP  380

Query  364  NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNT  423
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  381  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  435

Query  424  TVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTF  483
            T+PTKK+Q FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG+PQI+V+F
Sbjct  436  TIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRGIPQIEVSF  495

Query  484  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEA  543
            DIDANGI+NV A +K+TGKE  I I +  G LS+ +I+RMV EAE     D   K  IEA
Sbjct  496  DIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEDEIERMVREAEVNAEADAKRKELIEA  554

Query  544  KNALENYAYSLRNSLNDEKLK  564
            KN  ++  Y+   +L + + K
Sbjct  555  KNEADSLVYTTEKTLTEHEAK  575

>PITG_15786
Length=633

 Score = 517 bits (1331),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 299/623 (48%), Positives = 394/623 (63%), Gaps = 25/623 (4%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  1    MFSAAAGSEVIGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   +
Sbjct  61   KRQAVTNPENTFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--Y  117

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             P +I SMVL KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  178  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  236

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  296
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVNEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  297  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
                N  ITRA FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  
Sbjct  295  PKHLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTT  354

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            + EFF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
            V T LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  468

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSE  533
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+++I++MVA+AE   + 
Sbjct  469  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAA  527

Query  534  DEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAE  593
            D+  K  IEAKN  ++  YS      ++ LKE   + D + ++   T         +   
Sbjct  528  DQQRKELIEAKNDADSTLYS-----TEKTLKEHEDKIDAETLEQVKTALTDLRTKSEGDN  582

Query  594  TEEYESKQKELEGVANPILQKMY  616
            TEE ++  +E++ ++  I + +Y
Sbjct  583  TEEIKAALEEVQKLSMKIGEAVY  605

>PHYKE_9008
Length=650

 Score = 517 bits (1332),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 303/624 (49%), Positives = 397/624 (64%), Gaps = 27/624 (4%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  18   MFSAAAGSEVIGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAIIDNDERLVGMPA  77

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKFSD   Q   K   +K+  G   K    V+ KG+   +
Sbjct  78   KRQAVTNPENTFYAVKRLIGRKFSDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--Y  134

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             P +I SMVL KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  135  SPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  194

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  195  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  253

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  296
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  254  ELLRYLVDEFKKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  311

Query  297  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
                N  ITRA FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  
Sbjct  312  PKHLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTT  371

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            + +FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  372  VEDFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  425

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
            V T LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP P
Sbjct  426  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAP  485

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSE  533
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS ++I++MVA+AE   + 
Sbjct  486  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAA  544

Query  534  DEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAE  593
            D+  K  IEAKN  ++ AY       ++ LKE   + D + V +KV   +  L      E
Sbjct  545  DQERKELIEAKNDADSTAYQ-----TEKTLKEHEDKIDAETV-EKVKAALADLQKKAEGE  598

Query  594  -TEEYESKQKELEGVANPILQKMY  616
             TEE ++  +E++ ++  I + +Y
Sbjct  599  NTEEIKAALEEVQKLSMKIGEAVY  622

>PHYRA_71123
Length=633

 Score = 516 bits (1328),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 301/625 (48%), Positives = 398/625 (64%), Gaps = 29/625 (5%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  1    MFSAAAGSEVIGIDLGTTNSCVAVMEGKAARVIENSEGARTTPSVVAILDNDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K +
Sbjct  61   KRQAVTNPENTFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKY  117

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             P +I SMVL KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  178  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  236

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  296
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVDEFKKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  297  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
                N  ITRA FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  
Sbjct  295  PKHLNMKITRATFEQLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTT  354

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            + EFF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
            V T LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAP  468

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSE  533
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+S+I++MVA+AE   + 
Sbjct  469  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSESEIEKMVADAEANAAA  527

Query  534  DEANKVRIEAKNALENYAYSLRNSL--NDEKLKEQIPEADKKVVDDKVTETIQWLDAHQS  591
            D   K  IEAKN  ++  Y+   +L  +++K+  +  E  K  + D  T++       ++
Sbjct  528  DLERKELIEAKNDADSTLYTTEKTLKEHEDKIDAETLEKVKAALADLRTKS-------ET  580

Query  592  AETEEYESKQKELEGVANPILQKMY  616
              TEE ++  +E++ ++  I + +Y
Sbjct  581  DNTEEIKAALEEVQKMSMKIGEAVY  605

>PHYSO_525429
Length=610

 Score = 514 bits (1325),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 292/601 (49%), Positives = 394/601 (66%), Gaps = 28/601 (5%)

Query  17   TTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKR  76
            TT   VGVW N+ V ++ +D   R  PS+VAFTDTERL+GD AK QVA N +NTVF   R
Sbjct  3    TTCLRVGVWVNNNVAVLTSD---RPLPSFVAFTDTERLVGDVAKRQVATNVNNTVFGTTR  59

Query  77   LIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVA  136
            LIGRKFSD  VQ D+KHWPFK+  G  D P + VQ  G++KTF+P EI +M+L + RE  
Sbjct  60   LIGRKFSDLEVQEDLKHWPFKVVGGPNDGPLVEVQAAGQTKTFRPVEILAMLLAEARETV  119

Query  137  EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK--KG  194
            E  +GK V+NAV+TVPA FN +QRQA KDAGA+AGLNV R+I+  TAAAIA+GL+   K 
Sbjct  120  ETHLGKRVENAVVTVPASFNYAQRQAIKDAGAVAGLNVARLISASTAAAIAHGLENKTKA  179

Query  195  GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHR  254
            G+RN+L+ DLGGGT DVSL++IEE I+EV ATAG+ HLGGEDFD+RLV+H   EFKR HR
Sbjct  180  GQRNLLVLDLGGGTLDVSLVAIEEEIYEVLATAGNAHLGGEDFDSRLVEHCVAEFKRMHR  239

Query  255  KDITDNQRALRRLRTACERAKRTL--SSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGD  312
            KD++ N RA+ RLR ACE AKR L    S +  IE+D+L++GIDF++ ITRA+FE +C D
Sbjct  240  KDLSTNARAMMRLRMACESAKRALFAPESVEKLIELDALYEGIDFHTKITRAQFEKLCAD  299

Query  313  YFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEA  372
                 M PV++VL DA + +S+V EVV+VGGS RI KV++LL EFFNGK+  +S + +E 
Sbjct  300  LSDDIMLPVQQVLSDASVLRSKVDEVVMVGGSMRITKVEELLKEFFNGKKIIRSRHEEEL  359

Query  373  VAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTT-LIARNTTVPTKKAQ  431
               GAT+ AA+L    S  K  +  +L                T+ +I R+TT+PT+K +
Sbjct  360  NVLGATMHAAMLTDELSVIKPLEEFMLLDVTPLSLGVKIDDTNTSVMIPRSTTIPTRKTR  419

Query  432  TFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGIL  491
            TFST  DNQ  V I++ EGE     DN ++GK   D +P  PRG  +I+VT ++DANG +
Sbjct  420  TFSTSQDNQSVVQIELLEGEDG---DNRVIGKLKGDGLPLEPRGEFKIEVTVEVDANGCI  476

Query  492  NVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYA  551
             V   ++STG+  K+ ++ D   LS  +IDRM     K  S+ E           LENYA
Sbjct  477  TVLIADESTGQSKKLEVSGDC--LSALEIDRMRKSVMKDASKIE-----------LENYA  523

Query  552  YSLRNSLNDE--KLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVAN  609
             S+R++      +LK  I E   + V+++ TET+ WL+ + S    + + K+++LE  A 
Sbjct  524  NSVRSTAAKRIAELKRSIEEM--QAVEEQATETLHWLNRNHSVGRADIDVKRRKLEEAAT  581

Query  610  P  610
            P
Sbjct  582  P  582

>PPTG_18274
Length=648

 Score = 516 bits (1328),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 301/625 (48%), Positives = 397/625 (64%), Gaps = 29/625 (5%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  17   MFSAAAGSEVIGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPA  76

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG    +
Sbjct  77   KRQAVTNPENTFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGTK--Y  133

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             P +I SMVL KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  134  SPSQIGSMVLTKMKETADGFLGKPVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  193

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  194  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  252

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  296
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  253  ELLRYLVDEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  310

Query  297  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
                N  ITRA FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  
Sbjct  311  PKHLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTT  370

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            + EFF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  371  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  424

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
            V T LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP P
Sbjct  425  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  484

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSE  533
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+++I++MVA+AE   + 
Sbjct  485  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAA  543

Query  534  DEANKVRIEAKNALENYAYSLRNSL--NDEKLKEQIPEADKKVVDDKVTETIQWLDAHQS  591
            D+  K  IEAKN  ++  YS   +L  +++K+  +  E  K  + D  T++       + 
Sbjct  544  DQQRKELIEAKNEADSTLYSTEKTLKEHEDKIDAETLEKVKAALADLRTKS-------EG  596

Query  592  AETEEYESKQKELEGVANPILQKMY  616
              TEE ++  +E++ ++  I + +Y
Sbjct  597  DNTEEIKAALEEVQKMSMKIGEAVY  621

>PHYCA_541134
Length=633

 Score = 513 bits (1321),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 299/625 (48%), Positives = 396/625 (63%), Gaps = 29/625 (5%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  1    MFSAAAGSEVIGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   +
Sbjct  61   KRQAVTNPENTFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--Y  117

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             P +I SMVL KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  178  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  236

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  296
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVDEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  297  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
                N  ITRA FE + G    +TM P +K ++DA L KS ++EV+LVGG +R+PKVQ  
Sbjct  295  PKHLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQTS  354

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            + EFF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
            V T LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  468

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSE  533
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS ++I++MVA+AE   + 
Sbjct  469  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAA  527

Query  534  DEANKVRIEAKNALENYAYSLRNSL--NDEKLKEQIPEADKKVVDDKVTETIQWLDAHQS  591
            D+  K  IEAKN  ++  Y+   +L  +++K+  +  E  K  + D  T++       + 
Sbjct  528  DQQRKELIEAKNEADSTLYTTEKTLTEHEDKIDAETLEKVKAALADLRTKS-------EG  580

Query  592  AETEEYESKQKELEGVANPILQKMY  616
              TEE ++  +E++ ++  I + +Y
Sbjct  581  DNTEEIKAALEEVQKMSMKIGEAVY  605

>PHYSO_500480
Length=633

 Score = 513 bits (1321),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 298/625 (48%), Positives = 398/625 (64%), Gaps = 29/625 (5%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  1    MFSAAAGSEVIGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   +
Sbjct  61   KRQAVTNPENTFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--Y  117

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             P +I SMVL KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETADGFLGKHVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  178  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  236

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  296
             L+ +   EF+++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVDEFRKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  297  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
                N  I+RA FE + G+   +TM P +K ++DA L KS ++EV+LVGG +R+PKVQ  
Sbjct  295  PKHLNMKISRATFEKLVGNLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQST  354

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            + EFF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
            V T LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  468

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSE  533
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+++I++MVA+AE   + 
Sbjct  469  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAA  527

Query  534  DEANKVRIEAKNALENYAYSLRNSL--NDEKLKEQIPEADKKVVDDKVTETIQWLDAHQS  591
            D+  K  IEAKN  ++  Y+   +L  +++K+  +  E  K  + D  T++       + 
Sbjct  528  DQQRKELIEAKNEADSTLYTTEKTLKEHEDKIDAETLEKVKAALADLRTKS-------EG  580

Query  592  AETEEYESKQKELEGVANPILQKMY  616
              TEE ++  +E++ ++  I + +Y
Sbjct  581  DNTEEIKAALEEVQKMSMKIGEAVY  605

>SDRG_11043
Length=649

 Score = 513 bits (1321),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 281/562 (50%), Positives = 367/562 (65%), Gaps = 22/562 (4%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  69
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGA-GDKPQITVQFKGESKTFQPEEISSMV  128
            T++  KRLIGRKF+D   Q   K   +K+  G  G    +  Q     + + P +I SMV
Sbjct  87   TLYAVKRLIGRKFNDKETQEVSKVVSYKIVPGTNGSDAWVEAQ----GQKYSPSQIGSMV  142

Query  129  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  188
            L KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AY
Sbjct  143  LTKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAY  202

Query  189  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
            G+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     E
Sbjct  203  GMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGE  261

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTIT  302
            FKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  IT
Sbjct  262  FKRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKIT  319

Query  303  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKE  362
            RA+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PKVQQ + +FF GK 
Sbjct  320  RAQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPKVQQSVEDFF-GKR  378

Query  363  PNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARN  422
            P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RN
Sbjct  379  PSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRN  433

Query  423  TTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVT  482
            TT+PTKK+Q FST +DNQ  V I+V +GER M  DN  LG F+L  IPP PRG+PQI+V+
Sbjct  434  TTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQNIPPAPRGIPQIEVS  493

Query  483  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIE  542
            FDIDANGI+NVSA +K+TGKE  I I +  G LS+ +I+RMV EAE     D   K  IE
Sbjct  494  FDIDANGIVNVSARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIE  552

Query  543  AKNALENYAYSLRNSLNDEKLK  564
             KN  ++  Y+   +L++ + K
Sbjct  553  VKNEADSLVYNAEKTLSEHESK  574

>PHALS_07616
Length=677

 Score = 512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 300/625 (48%), Positives = 398/625 (64%), Gaps = 29/625 (5%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  45   MFSAAAGSEVIGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPA  104

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K +
Sbjct  105  KRQAVTNPENTFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKY  161

Query  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
             P +I SMVL KM+E A+ F+GK +  AVITVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  162  SPSQIGSMVLTKMKETADGFLGKPITQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIIN  221

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  222  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  280

Query  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  296
             L+ +   EFK++   +++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  281  ELLRYLVSEFKKETSINLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASG  338

Query  297  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
                N  ITRA FE + G    +TM P +K ++DA LSKS ++EV+LVGG +R+PKVQ  
Sbjct  339  PKHLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLSKSDINEVILVGGMSRMPKVQAS  398

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            + EFF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  399  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  452

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
            V T LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN LLG F+L  IPP P
Sbjct  453  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  512

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSE  533
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+++I++MVA+AE   + 
Sbjct  513  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAA  571

Query  534  DEANKVRIEAKNALENYAYSLRNSL--NDEKLKEQIPEADKKVVDDKVTETIQWLDAHQS  591
            D+  K  IEAKN  ++  Y+   +L  +++K+  ++ E  K  + D  T+        + 
Sbjct  572  DQQRKELIEAKNDADSTIYTTEKTLKEHEDKIDAELLEKVKTALADLRTKA-------EG  624

Query  592  AETEEYESKQKELEGVANPILQKMY  616
              TE+ ++  +E++ ++  I + +Y
Sbjct  625  DNTEDIKAALEEVQKMSMKIGEAVY  649

>CCI45982
Length=661

 Score = 508 bits (1309),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 292/617 (47%), Positives = 385/617 (62%), Gaps = 30/617 (5%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  65
            SG  +GIDLGTT SCV   +     +I N +G RTTPS VA  D  ERL+G  AK Q   
Sbjct  32   SGAVIGIDLGTTNSCVATMEGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQAVT  91

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            N  +T +  KRLIGRK++D       +   +K+  G   K    V+ KG+   + P +I 
Sbjct  92   NPESTFYAVKRLIGRKYNDGETNKVKEVVSYKIVPGPNGK-DAWVETKGQK--YSPSQIG  148

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL KM+E A++F+G+ V  AVITVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA
Sbjct  149  SMVLAKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAA  208

Query  186  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            +AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H 
Sbjct  209  LAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHL  267

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNS  299
              +FK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N 
Sbjct  268  VSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASGPKHLNM  325

Query  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFN  359
             ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PKVQQ + +FF 
Sbjct  326  KITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQAVEDFF-  384

Query  360  GKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLI  419
            GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI
Sbjct  385  GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLI  439

Query  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQI  479
             RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN  LG F+L  IPP PRGVPQI
Sbjct  440  PRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQI  499

Query  480  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKV  539
            +V+FDIDANGI+NV+A +K+TGKE  I I +  G LS++DI+RMV EAE   + D+  K 
Sbjct  500  EVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG-LSEADIERMVQEAEMNATADQQRKE  558

Query  540  RIEAKNALENYAYSLRNSLND----------EKLKEQIPEADKKVVDDKVTETIQWLDAH  589
             IE KN  +   YS   +L +          E++K  + +   K   D V E    L+  
Sbjct  559  LIELKNDADGVIYSTEKTLKEYEDKIEATLVEQVKTDLADLRSKAEGDSVDEIKAALEKV  618

Query  590  QSAETEEYESKQKELEG  606
            Q +  +  E+  K  +G
Sbjct  619  QQSSLKIGEAVYKAQQG  635

>CCA21514
Length=659

 Score = 507 bits (1306),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 283/564 (50%), Positives = 365/564 (65%), Gaps = 20/564 (4%)

Query  4    AKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ  62
            A  SG  +GIDLGTT SCV         +I N +G RTTPS VA  D  ERL+G  AK Q
Sbjct  28   AAGSGAVIGIDLGTTNSCVATMDGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQ  87

Query  63   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  122
               N  +T +  KRLIGRK++D       +   +K+  G+  K    V+ KG+   + P 
Sbjct  88   AVTNPESTFYAVKRLIGRKYNDHETNKVKEVVSYKIVPGSNGK-DAWVETKGQK--YSPS  144

Query  123  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  182
            +I SMVL KM+E A++F+G+ V  AVITVPAYFNDSQRQATKDAG IAGL VLRIINEPT
Sbjct  145  QIGSMVLGKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPT  204

Query  183  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            AAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+
Sbjct  205  AAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELL  263

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------  296
             H   +FK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D      
Sbjct  264  RHLVSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASGPKH  321

Query  297  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSE  356
             N  ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PKVQQ + E
Sbjct  322  LNMKITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQAVEE  381

Query  357  FFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMT  416
            FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T
Sbjct  382  FF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFT  435

Query  417  TLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGV  476
             LI RNTT+PTKK+Q FST AD+Q  V I+V +GER M  DN  LG F+L  IPP PRGV
Sbjct  436  KLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGV  495

Query  477  PQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEA  536
            PQI+V+FDIDANGI+NV+A +K+TGKE  I I +  G LS +DI+RMV EAE   + D+ 
Sbjct  496  PQIEVSFDIDANGIVNVAARDKATGKEQNIIIQSSGG-LSDADIERMVQEAEMNAAADQQ  554

Query  537  NKVRIEAKNALENYAYSLRNSLND  560
             K  IE KN  ++  YS   +L +
Sbjct  555  RKEVIELKNDADSVIYSTEKTLKE  578

>SDRG_05816
Length=479

 Score = 494 bits (1273),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 270/484 (56%), Positives = 344/484 (71%), Gaps = 15/484 (3%)

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+
Sbjct  1    MVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAAL  60

Query  187  AYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  61   AYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  120

Query  243  DHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  301
            D    EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  121  DFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSSTM  180

Query  302  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK  361
            TRA+FE +  + F++T E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  181  TRAKFESLNEECFKRTEETVLKVLADANMQPGDITELVLVGGSTRIPKVQNMLSAVFGGK  240

Query  362  EPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIAR  421
            E +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  241  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  299

Query  422  NTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDV  481
            NT +P KK + ++T  D Q    + +FEGER+   DN+ LG+F +  I    RG PQI+V
Sbjct  300  NTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISGIERAKRGEPQIEV  359

Query  482  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRI  541
            TF+IDANGIL+VSA +K TG +N  TI+N++GRL+Q DIDRMV EAEK+K +D     RI
Sbjct  360  TFEIDANGILHVSARDKKTGAKNATTISNNRGRLTQQDIDRMVEEAEKFKKDDAQMLKRI  419

Query  542  EAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQ  601
            +A+N LE Y Y         +  E   + +       + E   W+D ++     E E K+
Sbjct  420  DARNDLEGYLY---------RALEAASKKNDAAAQTALCEARDWMDDNEELTVRELEDKR  470

Query  602  KELE  605
            + LE
Sbjct  471  RVLE  474

>PYAR_22188
Length=634

 Score = 498 bits (1282),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 296/610 (49%), Positives = 378/610 (62%), Gaps = 57/610 (9%)

Query  32   IIANDQGNRTTPSYVAFTDTE-RLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQAD  90
            +I N +G RTTPS VA  D E RL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENAEGARTTPSVVAILDNEERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  91   IKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVIT  150
             K   +K+ +G   K    V+ KG  K + P +I SMVL KM+E A+ F+GK +  AV+T
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKPITQAVVT  124

Query  151  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  210
            VPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  211  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTA  270
            VS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVTEFKKETSIDLSGDNLAMQRLREA  243

Query  271  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  324
             E+AKR L   AQ  I +   F   D       N  ITRA FE + G+   +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVGNLVERTMGPCKKC  301

Query  325  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAIL  384
            ++DA L K  ++EV+LVGG +R+PKVQQ + EFF GK+P+K +NPDE VA GA +Q  +L
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFF-GKKPSKGVNPDEVVAMGAAIQGGVL  360

Query  385  GGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVL  444
             G+     L D+  L +       ET GGV T LI RNTT+PTKK+Q FST AD+Q  V 
Sbjct  361  RGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVG  415

Query  445  IQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKEN  504
            I+V +GER M  DN  LG F+L  IPP PRGVPQI+VTFDIDANGI+NVSA +KSTGKE 
Sbjct  416  IKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSARDKSTGKEQ  475

Query  505  KITITNDKGRLSQSDIDRMVAEAE-------KYKS------------------EDEANKV  539
             I I +  G LS +DI+RMV EAE       K K+                   D+  K 
Sbjct  476  SIVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIXXXXERMVQEAEMNAEADQKRKA  534

Query  540  RIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWL--DAHQSAETEEY  597
             IEAKN  ++ AYS   SL + + K          +D + +ET++    +    AE E+ 
Sbjct  535  LIEAKNEADSVAYSTEKSLKEHEDK----------IDAETSETVKTAIQNLRTQAEGEDA  584

Query  598  ESKQKELEGV  607
            E+ +  +E V
Sbjct  585  EAIKAAVEEV  594

>PYIR_19697
Length=608

 Score = 496 bits (1277),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 288/593 (49%), Positives = 379/593 (64%), Gaps = 27/593 (5%)

Query  32   IIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQAD  90
            +I N +G RTTPS VA  D  ERL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  91   IKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVIT  150
             K   +K+ +G   K    V+ KG  K + P +I SMVL KM+E A+ F+GK +  AV+T
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKTITQAVVT  124

Query  151  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  210
            VPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  211  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTA  270
            VS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEFKKETSIDLSSDNLAMQRLREA  243

Query  271  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  324
             E+AKR L   AQ  I +   F   D       N  ITRA FE +      +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVSHLIERTMTPCKKC  301

Query  325  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAIL  384
            ++DA L K  ++EV+LVGG +R+PKVQ  + EFF GK+P+K +NPDE VA GA +Q  +L
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQTTVEEFF-GKKPSKGVNPDEVVAMGAAIQGGVL  360

Query  385  GGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVL  444
             G+     L D+  L +       ET GGV T LI RNTT+PTKK+Q FST AD+Q  V 
Sbjct  361  RGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVG  415

Query  445  IQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKEN  504
            I+V +GER M  DN  LG F+L  IPP PRGVPQI+V+FDIDANGI+NV+A +K+TGKE 
Sbjct  416  IKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVAARDKATGKEQ  475

Query  505  KITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLK  564
             I I +  G LS S+I+RMV EAE     D+  K  IE KN  ++ AY+      ++ LK
Sbjct  476  NIVIQSSGG-LSDSEIERMVQEAEMNAEADQKRKELIETKNEADSVAYT-----TEKTLK  529

Query  565  EQIPEADKKVVDDKVTETIQWLDAHQSAE-TEEYESKQKELEGVANPILQKMY  616
            E   + DK+ V ++V   ++ L +    E  EE ++  +E++ ++  I + +Y
Sbjct  530  EHEEKLDKETV-EQVKAGLENLRSKAEGENAEEIKAALEEVQKLSLKIGEAVY  581

>PHYSO_339666
Length=585

 Score = 483 bits (1244),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 274/608 (45%), Positives = 382/608 (63%), Gaps = 38/608 (6%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            VGIDLGTT S VGVW+N+RVE I N Q    TPSYVAFT+T  L+G+AAK Q+  N  NT
Sbjct  5    VGIDLGTTGSRVGVWRNERVEFIPNRQQAYWTPSYVAFTETALLVGEAAKRQLTTNPENT  64

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
            VFD  + +GRKFS+  ++  +  WPFK+  G  D PQ+ VQ+KGE+K+F P EI +++L 
Sbjct  65   VFDLTQFVGRKFSE--LRESVIDWPFKVECGPEDTPQVVVQYKGETKSFMPVEIMAILLY  122

Query  131  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  190
            +MR++AE ++ +EV  AV TVP  FN  QRQA KDAGAIAGL+V+R++N  T A I YG 
Sbjct  123  EMRKIAEIYLDQEVTKAVFTVPGSFNYFQRQAMKDAGAIAGLDVIRLVNSATVACIEYGF  182

Query  191  DK---KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            +    + GE NVL+ D G  + +                          FD+RLV+HF  
Sbjct  183  NTLVGRVGELNVLVVDYGASSLN--------------------------FDSRLVEHFAA  216

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
            EF+R+H KD+  +  A+ RLRTACE AKR LSSS +A+IE+D+L DGI+F S I     E
Sbjct  217  EFQRRHGKDLRSDSSAVMRLRTACEHAKRALSSSMEAFIELDALHDGINFYSMIRCVWME  276

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
             +C D F K +  VEK+LR+A+L K QV E+VLVGGST +PKVQQ L +FFNGK    S+
Sbjct  277  RLCADLFDKMLRLVEKLLREARLRKDQVDEIVLVGGSTHVPKVQQKLKDFFNGK--MLSL  334

Query  368  NPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTL-IARNTTVP  426
              DEA A+G  VQ   LGG   S KL + +LLD   L   +E    +M  + +++N+T+P
Sbjct  335  RQDEAAAFGVAVQGDFLGG-LPSPKLDEYMLLDTASLEFSVEIDDCMMKEVPVSKNSTLP  393

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
             +K++TF T   N+  + I+ FEGE +    N LL +F +D I   P  + +I+V  D+D
Sbjct  394  MRKSRTFLTANANKSTMRIKAFEGEATTVATNRLLCEFEMDGITMTPGRLSEIEVAIDVD  453

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
            ANG L VSAVEKSTGKE KITI  +  RLS S+++RM +  E+   + E  ++RI++K  
Sbjct  454  ANGSLTVSAVEKSTGKEKKITI--NCSRLSTSEVERMHSNIEETFLDPE-EELRIQSKAV  510

Query  547  LENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEG  606
            LE YA S+ +S      K +   A +  ++    E +QWLD + SA+ E +++K+++L  
Sbjct  511  LERYANSVCSSAAKRIAKLKRSLAKEYTIESSAMEALQWLDTNPSAKKEHFDAKRQKLGE  570

Query  607  VANPILQK  614
            +A P  Q+
Sbjct  571  MATPSGQR  578

>SPRG_02294
Length=634

 Score = 481 bits (1239),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 275/561 (49%), Positives = 359/561 (64%), Gaps = 35/561 (6%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  69
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            T++  KRLIGRKFSD   Q   K   + + +G   +       + + + + P +I SMVL
Sbjct  87   TLYAVKRLIGRKFSDKETQEVSKVVSYNIVAGTNGQ---DAWVEAQGQKYSPSQIGSMVL  143

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  144  TKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  203

Query  190  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  249
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     EF
Sbjct  204  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGEF  262

Query  250  KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  303
            KR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  ITR
Sbjct  263  KRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKITR  320

Query  304  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP  363
            A+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PKVQQ + +FF GK P
Sbjct  321  AQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPKVQQSVEDFF-GKRP  379

Query  364  NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNT  423
             +       V  G      +L               DVTPLSLG+ET GGV T LI RNT
Sbjct  380  RRG-----GVLRGDVKDILLL---------------DVTPLSLGIETLGGVFTKLIPRNT  419

Query  424  TVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTF  483
            T+PTKK+Q FST +DNQ  V I+V +GER M  DN  LG F+L  IPP PRG+PQI+V+F
Sbjct  420  TIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQNIPPAPRGIPQIEVSF  479

Query  484  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEA  543
            DIDANGI+NVSA +K+TGKE  I I +  G LS+ +I+RMV EAE     D   K  IE 
Sbjct  480  DIDANGIVNVSARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIEV  538

Query  544  KNALENYAYSLRNSLNDEKLK  564
            KN  ++  Y+   +L++ + K
Sbjct  539  KNEADSLVYNAEKTLSEHESK  559

>PITG_15370
Length=474

 Score = 446 bits (1148),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 243/289 (84%), Positives = 261/289 (90%), Gaps = 3/289 (1%)

Query  149  ITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGT  208
            +TVPAYFNDSQRQAT  AGAIAGLNVLRIINEPTAAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  150  VTVPAYFNDSQRQATIYAGAIAGLNVLRIINEPTAAAIAYGLDKKGGEHNVLIFDLGGGT  209

Query  209  FDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLR  268
            FDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV+ F  EFKRKHRKD+T NQRALRRLR
Sbjct  210  FDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEFFVTEFKRKHRKDMTSNQRALRRLR  269

Query  269  TACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDA  328
            TACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRARFED+C DYFRKTM+PV +VLRD+
Sbjct  270  TACERAKRTLSTSAQAYIEIDSLFDGVDFNSTITRARFEDLCSDYFRKTMDPVAQVLRDS  329

Query  329  KLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNd  388
            KLSK+QV+E+VLVG STR  KVQQLL +FFNGKE  KSINPDEAVAYGATVQAAIL GN+
Sbjct  330  KLSKNQVNEIVLVGSSTR-SKVQQLLKDFFNGKELFKSINPDEAVAYGATVQAAILSGNE  388

Query  389  ssdklqdlllldvtplslglETAGGVMTTLIARN--TTVPTKKAQTFST  435
            SS KLQDLLLLDV PLSLGLETAGGVMT LI RN  T   T K ++ ST
Sbjct  389  SSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNNSTLSLTGKYRSLST  437

>PYAR_19930
Length=625

 Score = 444 bits (1142),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 245/417 (59%), Positives = 306/417 (73%), Gaps = 10/417 (2%)

Query  137  EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  196
            E  IG+  K    + P     + RQ+TKDAGAIAGL+V RIINEPTAAA+AYGLD   G+
Sbjct  214  ERLIGEAAKIQAASNPT----NTRQSTKDAGAIAGLDVKRIINEPTAAALAYGLDTNAGQ  269

Query  197  R----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRK  252
                 NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ LVD    EFKRK
Sbjct  270  SGAGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNLVDFLVTEFKRK  329

Query  253  HRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  311
            ++  D T + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST+TRA+ E +  
Sbjct  330  NKGLDPTGSARAMRRLRTACESAKRMLSTTTSAAVEVDSLFEGVDFSSTLTRAKLESLNE  389

Query  312  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDE  371
            D F++  E V+KVL DAK+    + EVVLVGGSTRIPKVQ LLS  F GKE +KSINPDE
Sbjct  390  DLFKRCEETVQKVLADAKMKPDDITEVVLVGGSTRIPKVQSLLSALFGGKELSKSINPDE  449

Query  372  AVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQ  431
            AVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI RNT +P +K +
Sbjct  450  AVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVRKTR  508

Query  432  TFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGIL  491
             ++T  D Q  V + ++EGER+    N+ LG+FN+  I    RG PQ++VTF+IDANGIL
Sbjct  509  VYTTEEDYQTSVDVCIYEGERAHVDSNNKLGEFNISGIERAKRGEPQVEVTFEIDANGIL  568

Query  492  NVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALE  548
            NVSA +K TG   + TI+N++GRL+Q DIDRMV++AEK+K +D     +IEA+N LE
Sbjct  569  NVSARDKKTGARAETTISNNRGRLTQEDIDRMVSDAEKFKKDDAELLRKIEARNELE  625

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 2/65 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D ERLIG+AAK Q A 
Sbjct  168  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDQERLIGEAAKIQAAS  227

Query  66   NAHNT  70
            N  NT
Sbjct  228  NPTNT  232

>PPTG_02121
Length=222

 Score = 424 bits (1089),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 208/212 (98%), Gaps = 1/212 (0%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            M QA TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTQA-TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKFSDPIVQADIKHWPFK+TSG GDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAANTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  212
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVS
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  211

>PYAP_16216
Length=564

 Score = 431 bits (1108),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 216/517 (42%), Positives = 338/517 (65%), Gaps = 5/517 (1%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+G+T+ CVGVWQN +V IIANDQG RTTP++V F   E ++GD A N++  +A NTV
Sbjct  5    GIDIGSTHGCVGVWQNGKVNIIANDQGFRTTPAFVCFEGEEVIVGDTAVNKLHSHAANTV  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KR++G+   +   +  +  W F+LT GA           GE+    P +  S+++  
Sbjct  65   FHLKRVLGKNHEEIASRDFVSEWSFELTKGADGLAVAKTARNGEAHEVSPVDFVSILIKN  124

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            ++++AE F G+ V + VI +PA+  +SQ++  + A   AG+NV+  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGETVDSIVINIPAHAGESQKELIRAAATKAGVNVMSYLSEPLAAAIAYGLD  184

Query  192  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
               K       L+FD+GG T DV+LLS+++G+FE+ AT+G+  LGGEDF   + +H  + 
Sbjct  185  ENTKNSHAEYALVFDIGGATHDVTLLSVDKGLFEIVATSGNDALGGEDFTKAIFEHCAKS  244

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            F+RK + ++ DNQ+A  RLR ACE AKR+LS+ +Q  IE+DSL +G DF   ++R RFE+
Sbjct  245  FQRKTKLNVKDNQKASSRLRAACETAKRSLSTQSQVNIEVDSLMEGEDFALKLSRPRFEE  304

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  D+ + +++ VEK+L +A++ K+ +  V+L+GGS+RIP VQ  + +FF+GK+ +  I+
Sbjct  305  LIADFVKDSLKEVEKLLEEAEIEKADIDHVILIGGSSRIPLVQNSVKKFFDGKKTHMHIS  364

Query  369  PDEAVAYGATVQAAILGG-NdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            PDE VA+GAT++AA +G      +       ++VTPL+L +  A G ++ +I R+T +PT
Sbjct  365  PDEVVAHGATLEAAAIGDIAALGEPKSAQNDVNVTPLTLSVALANGSVSEVIHRDTVLPT  424

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
               + F+T  DNQ  + IQV+EGER M +DN LL +  +  I P+P+G  +I+VTF I +
Sbjct  425  SATEVFTTSVDNQDSIFIQVYEGERVMAKDNTLLAQLKVTGISPLPKGEAEIEVTFAISS  484

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
             G+L V+A E S GK+  + + ND  RL+ +D+  ++
Sbjct  485  KGVLTVTANEASAGKKT-LEVKNDAKRLTAADVAAVI  520

>PHYSO_552116
Length=570

 Score = 425 bits (1092),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 220/520 (42%), Positives = 335/520 (64%), Gaps = 11/520 (2%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+  +D   +  +K WPF +T+GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVADRDFVKEWPFDITAGADGVAQAETQRNGEKHPVSPVEFMALLLQN  124

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            ++++AE F G+++++ VI+ PA+ +DS  +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVISKPAHTDDSYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  184

Query  192  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   + +H  + 
Sbjct  185  EAANNAKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAAVFEHCAKS  244

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            F RK + D+  NQ+A  RLR ACE AK+TLS+  QA IE+D+L +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRIACEVAKKTLSTQTQANIEVDTLMEGEDFSLKLSRPRFEE  304

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  DY  +T+  +E +L + +L K  +  +VLVGGSTRIP VQ L+ +FF+GK  +  ++
Sbjct  305  LITDYVHETITEIEAILEENELEKEDIDHIVLVGGSTRIPLVQNLVKKFFDGKNVHTQLS  364

Query  369  PDEAVAYGATVQ----AAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTT  424
            PDEAVAYGAT++    A ++G          L +++V PL+L +  A G ++ LI R+T 
Sbjct  365  PDEAVAYGATIEGSGLAELVG---VPAPKNPLNMVNVVPLNLSVALANGSVSELIQRDTV  421

Query  425  VPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFD  484
            +P    + F+T  DNQ  V +Q++EG+R M +DN L+ + ++  I P+P+G  +I+VTF 
Sbjct  422  LPATATELFTTSEDNQEAVYLQIYEGQRLMAKDNTLVAQLSVAGITPLPKGDAEIEVTFT  481

Query  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
            +   G+L V+A E+  GK++ + +T D  RL+ +D+  +V
Sbjct  482  VSTKGVLTVTASERKAGKKS-LEVTQDSKRLTPADVAAIV  520

>HYAP_01993
Length=569

 Score = 422 bits (1084),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 220/529 (42%), Positives = 337/529 (64%), Gaps = 9/529 (2%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVWQN +V IIANDQG RTTP+YV F   E ++GD A N++A +A NT+
Sbjct  5    GIDIGTTHGCVGVWQNGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKLASHADNTI  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+  +D   +  +K WPF +T GA    Q   Q  GE     P E   ++L  
Sbjct  65   FHLKRLLGKAHADVKDREFVKEWPFGVTEGADGVAQAETQRNGEKHAVDPVEFMMLLLQN  124

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            ++++AE F G+++++ VI  PA+ ++   +    A    G+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVINKPAHTDEKYTELLDAAAKKVGVNVLTYLSEPLAAAIAYGLD  184

Query  192  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G+  LGGEDF   + +H  + 
Sbjct  185  EAANNDKPEFVLVFDIGGATHDVTLLNADKGLFEVVASKGNDTLGGEDFTAAIFEHCAKS  244

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  245  FLRKTKLDVKPNQKASSRLRLACEAAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  304

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  D  +KT+  +E +L+D +L K  +  VVLVGGS+RIP VQ L+ +FF  K  +  ++
Sbjct  305  LINDDVQKTITEIEAILKDNELEKEDIDHVVLVGGSSRIPLVQTLIKKFFENKTLHTQLS  364

Query  369  PDEAVAYGATVQAAILG---GNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
            PDEAVA+GAT++A+ L    G+++  K  +++ +    LS+ L  A G ++ LI R+T +
Sbjct  365  PDEAVAFGATIEASCLAELLGSEAPAKPLNMVNVVPLTLSVAL--ANGSVSELIQRDTIL  422

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            P    + F+T +DNQ    +Q++EG+R M +DN L+ + ++  I P+P+G  +IDVTF +
Sbjct  423  PASATEVFTTSSDNQEAAFLQIYEGQRLMAKDNTLVAQLSVAGITPLPKGDAEIDVTFTV  482

Query  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSED  534
               G+L V+A E+  G ++ + + +D  RL+ +D+  +V +A+    ED
Sbjct  483  STKGVLTVTASERKAGSKS-LEVMHDSTRLTPADVAAVVKKADDAADED  530

>PPTG_10122
Length=569

 Score = 419 bits (1076),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 218/517 (42%), Positives = 334/517 (65%), Gaps = 6/517 (1%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+  +D   +  +K WPF +T GA +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVKDRDFVKEWPFDVTQGA-EGAQVETQRSGEKHPVTPVEFMAVLLQN  123

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            ++E+AE F G+++++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  183

Query  192  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H  + 
Sbjct  184  EAANNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKASSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP VQ L+ ++F+GK     ++
Sbjct  304  LISDYVHETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFDGKNVRTQMS  363

Query  369  PDEAVAYGATVQAAILGGNd-ssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            PDEAVAYGAT++A+ L       +  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAYGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
               + F+T  DNQ  V +Q++EG+R M +DN L+ + ++  I P+P+G  +I+V F +  
Sbjct  424  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPLPKGDAEIEVIFTVST  483

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
             G+L V+A E+  GK++ + +T+D  RL+ +D+  +V
Sbjct  484  KGVLTVTASERKAGKKS-LEVTHDSKRLTPADVAAIV  519

>PITG_05721
Length=302

 Score = 407 bits (1047),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 224/292 (77%), Positives = 246/292 (84%), Gaps = 12/292 (4%)

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            +L K +      I  + K + +TVPAYFNDSQ QATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  1    MLQKCKPTTHRKIKNKTKTSEVTVPAYFNDSQHQATKDAGAIAGLNVLRIINEPTAAAIA  60

Query  188  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            YGLD+KGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGG DFDNR+V+ F  
Sbjct  61   YGLDEKGGENNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGGDFDNRMVEFFVT  120

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
            E K  HR            LRTACER KRTLS+SAQAYIEIDSLFDG+DFNSTITRARFE
Sbjct  121  EVKPLHR------------LRTACERTKRTLSTSAQAYIEIDSLFDGVDFNSTITRARFE  168

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
            D+C DYFRKTM+PV +VLRD+KLSK+Q +E+VLVGGSTRIPKVQQLL +FFNGKE  KS+
Sbjct  169  DLCSDYFRKTMDPVAQVLRDSKLSKNQGNEIVLVGGSTRIPKVQQLLKDFFNGKELFKSV  228

Query  368  NPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLI  419
            NPDEAVAYGATVQAAIL GN+SS KLQDLLLLDV PLSLGLETAG VMT LI
Sbjct  229  NPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGSVMTKLI  280

>PYU1_G006940
Length=565

 Score = 417 bits (1071),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 214/517 (41%), Positives = 330/517 (64%), Gaps = 5/517 (1%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLHSHAENTI  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KR++G+   D +    I+ W FK++              GE     P E  S+++  
Sbjct  65   FHLKRVLGKNHEDVVDHDYIQEWSFKVSKADDGAVHAATSRNGEPHHVTPVEFVSLLIKN  124

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            ++++AE F G+ V + V+++PA+  + Q++  ++A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEAVDSVVLSIPAHATEKQKELLQEAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  192  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
               K      VL+FD+GG T DV+L++ ++G+FE+ A+AG+  LGGEDF   LV+H  + 
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVASAGNDKLGGEDFTKALVEHCAKA  244

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            F+RK + ++ DN++A  RLR ACE AKRTLS+  Q  IEIDSL +G DF+  ++R RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQTQVNIEIDSLMEGEDFSLKLSRPRFEE  304

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  DY    ++ V+ +L  A + K  V  V+LVGGS+RIP +Q  + ++F+GK  +  ++
Sbjct  305  LINDYVTAALKEVDALLESADVEKEHVDHVILVGGSSRIPLLQNAVKKYFDGKTTHLHLS  364

Query  369  PDEAVAYGATVQAAILGG-NdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            PDE VA+GATV+A++     +     + L  ++VTPL+L +  A G +T LI R T +P 
Sbjct  365  PDEVVAHGATVEASLRADLANFEAPKKALDNVNVTPLTLSVALANGSVTELIHRETVLPA  424

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
               +TF+T  DNQ  + +Q++EGER M +DN LL    +  I P P+G  +I+VTF ++ 
Sbjct  425  TATETFTTSQDNQTAIFLQIYEGERVMAKDNTLLASLAVSGIAPAPKGEAEIEVTFAVNT  484

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
             G L ++AVE++ GK+  + ++ND  RLS +D+  ++
Sbjct  485  KGALTITAVEQTAGKKT-LEVSNDPKRLSAADVAVII  520

>PHYRA_71591
Length=570

 Score = 416 bits (1069),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 219/517 (42%), Positives = 330/517 (64%), Gaps = 5/517 (1%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+  +D   +  +K WPF +T+GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVSDRDYVKEWPFNVTAGADGVAQAETQRNGEKHPVTPVEFMALLLQN  124

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            ++E+AE F G+++++ VI  PA+ ++S  +    A A AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGEKLEHVVINKPAHTDESYTELLDAAAAKAGVNVLTYLSEPLAAAIAYGLD  184

Query  192  KKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   L +H  + 
Sbjct  185  EASNNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFSAALFEHCAKS  244

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G D +  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRSLSTQTQANIEVDSLMEGEDLSLKLSRPRFEE  304

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  DY  +T+  ++ +L +  L K  +  VVLVGGSTRIP VQ L+ ++F GK  +  ++
Sbjct  305  LISDYVHETITEIDAILEENDLEKDDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVHTQLS  364

Query  369  PDEAVAYGATVQAAILGGNd-ssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            PDEAVA+GAT++A+ L       +  + L L++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAFGATIEASGLAELVGVPEPKKPLNLVNVVPLNLSVALANGSVSELIQRDTVLPA  424

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
               + F+T  DNQ  V +Q++EG+R M +DN L+ + ++  I P  +G  +I+V F +  
Sbjct  425  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPKAKGEVEIEVDFTVST  484

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
             G+L V+A E+  GK++ + +T D  RL+ +D+  +V
Sbjct  485  KGVLTVTASERKAGKKS-LEVTQDSKRLTPADVAAIV  520

>PYAR_14487
Length=467

 Score = 408 bits (1048),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 216/246 (88%), Positives = 232/246 (94%), Gaps = 0/246 (0%)

Query  371  EAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKA  430
            EAVA+GATVQAAIL GND S+KLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK 
Sbjct  184  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243

Query  431  QTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGI  490
            QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGI
Sbjct  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303

Query  491  LNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENY  550
            LNVSAVEKSTGKENKITITNDKGRLSQ+DI+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363

Query  551  AYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANP  610
            AY+LRN+LNDEKL+ QIPE D+K +DDKVTE I WLDAHQ++E EE+E+KQKELEG+ANP
Sbjct  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423

Query  611  ILQKMY  616
            ILQKMY
Sbjct  424  ILQKMY  429

 Score = 340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/246 (74%), Positives = 187/246 (76%), Gaps = 41/246 (17%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MAQ+ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQSVT-GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NT                                     ITV FKGESKTFQ
Sbjct  60   NQVAMNAENT-------------------------------------ITVTFKGESKTFQ  82

Query  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
            PEEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  83   PEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV---KATAGDTHLGGEDF  237
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE     AT     L G D 
Sbjct  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQ  202

Query  238  DNRLVD  243
              +L D
Sbjct  203  SEKLQD  208

>PITG_03546
Length=569

 Score = 410 bits (1053),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 214/517 (41%), Positives = 331/517 (64%), Gaps = 6/517 (1%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F   R++G+  +D   +  +K WPF +T G+ +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLNRILGKAHADIKDRDFVKEWPFDVTQGS-EGAQVETQRNGEKHPVTPVEFMAVLLQN  123

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            ++E+AE F G+++++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGLD  183

Query  192  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H  + 
Sbjct  184  EATSNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            F RK + D+  NQ+   RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKTSSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP VQ L+ ++F GK     ++
Sbjct  304  LITDYVNETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVRTQMS  363

Query  369  PDEAVAYGATVQAAILGGNd-ssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            PDEAVA+GAT++A+ L       +  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAFGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
               + F+T  DNQ  V +Q++EG+R M +DN L+ + ++  I P P+G  +I+VTF + +
Sbjct  424  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPQPKGDAEIEVTFTVSS  483

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
             G+L V+A E+  GK++ + +T D  RL+ +D+  +V
Sbjct  484  KGVLTVTAAERKAGKKS-LEVTQDSKRLTPADVAAIV  519

>PYIR_24123
Length=567

 Score = 409 bits (1052),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 208/517 (40%), Positives = 328/517 (63%), Gaps = 5/517 (1%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E ++GD A N+++ +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIVGDTAVNKLSSHAENTI  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KR++G+   + + +  I+ W FK+               GE+    P E  S+++  
Sbjct  65   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSEDGAVHAATSRNGEAHHVTPVEFVSLLIKN  124

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            ++++AE F G+ V N V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGESVDNVVLSIPAHVTEKQKELLQAAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  192  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
               K      VL+FD+GG T DV+L++ ++G+FE+ AT+G  +LGGEDF   L +H  + 
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVATSGKDNLGGEDFTKALFEHCAKA  244

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            F+RK + ++ DN++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  304

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP +Q  + + F+GK  +  ++
Sbjct  305  LISDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVKKHFDGKTTHLHLS  364

Query  369  PDEAVAYGATVQAAILGG-NdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            PDE VA+GAT++A++     +     + L  ++VTPL+L +  A G +  +I R+T +P 
Sbjct  365  PDEVVAHGATIEASLRADLANFESPKKALNHVNVTPLTLSVALANGSVAEVIHRDTVLPA  424

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
               +TF+T  DNQ  + +QV+EGER M +DN LL   ++  I P P+G  +I+VTF ++ 
Sbjct  425  TATETFTTSQDNQTAIFLQVYEGERVMAKDNTLLASLSVAGIAPAPKGEAEIEVTFTVNT  484

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
             G+L ++AVE++ GK+  + + ND  RL+  D+  ++
Sbjct  485  KGVLTITAVEQAAGKKT-LEVKNDPKRLTAKDVADII  520

>PHYKE_64
Length=569

 Score = 409 bits (1050),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 212/517 (41%), Positives = 327/517 (63%), Gaps = 5/517 (1%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A +T+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADSTI  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            +  KRL+G+  +D   +  +K WPF +  GA           GE     P +  +++L  
Sbjct  65   YHLKRLLGKSHADVASRDFVKSWPFDVMEGAKGGAHAETVRNGEKHEVSPVDFMALLLQN  124

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            ++E+AE F G+ +++ VI+ PA+ ++  ++    A   AG+ VL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGETLEHVVISKPAHADEKHQELLNAAAEKAGVKVLTYLSEPLAAAIAYGLD  184

Query  192  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
            +         VL+FD+GG T DV+LL+ ++G+FEV ++ G   LGGEDF N + +H  + 
Sbjct  185  EAANNPKPEYVLVFDIGGATHDVTLLNADKGLFEVLSSKGKDTLGGEDFTNAVFEHCAKS  244

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
            F RK + D+  NQ+A  RLR ACE AKRTLS+  Q+ IE+DSL +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRTLSTQTQSNIEVDSLMEGEDFSLKLSRPRFEE  304

Query  309  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
            +  DY    M+ V+ +L + +L K  +  VVLVGGSTRIP VQ ++ + F GK  +  + 
Sbjct  305  LIIDYVTDIMKEVDAILEENELEKDDIDHVVLVGGSTRIPLVQSMIKKSFEGKTTHLQMP  364

Query  369  PDEAVAYGATVQAAILGGNd-ssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
            PDE +AYGAT++A+ L     + +  + + +++V PL+L +  A G ++ LI R T +P 
Sbjct  365  PDEVIAYGATIEASGLAELVDAPEPKKPVNMVNVVPLNLSVALANGSVSELIQRETILPA  424

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDA  487
               + F+T  DNQ  V +Q++EG+R M +DN L+ + ++  IPPM +G  +I+VTF +  
Sbjct  425  THTELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVAGIPPMSKGDAEIEVTFTVST  484

Query  488  NGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
             G+L+V+A E+  GK+  + +TND  RLS +D+  +V
Sbjct  485  KGVLSVTASERKAGKKT-LEVTNDPKRLSTADVAAIV  520

>SDRG_10038
Length=565

 Score = 408 bits (1048),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 217/512 (42%), Positives = 323/512 (63%), Gaps = 6/512 (1%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
             +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA N
Sbjct  3    CIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAAN  62

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TV+  KR++G+K SD      IK W F + + A       V  K   +     E +S+VL
Sbjct  63   TVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKRDVSATEFASLVL  122

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
             K++ +AE + G +VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AAAIAYG
Sbjct  123  GKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAYG  182

Query  190  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
             D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV+H  +
Sbjct  183  FDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALVEHCVK  242

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
             F+R+ + D+ DN RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D    ++R+RFE
Sbjct  243  TFERQKKVDLKDNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRFE  302

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
            +M GD+ RK +  +E +L +A L K  +  V+L GGSTRIPKVQ  +  FF+GK+ + +I
Sbjct  303  EMIGDHVRKMVTDIETLLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKKASSTI  362

Query  368  NPDEAVAYGATVQAAILG--GNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             PDE +AYGATV+AA L       +     L +++  PL+L L  A G +  +I RNT +
Sbjct  363  VPDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVL  422

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            P    + F+T+ DNQ  V +Q++EG+R M RDN LL    +  IPPM +G P+I+V+F++
Sbjct  423  PATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNV  482

Query  486  DANGILNVSA-VEKSTGKENK-ITITNDKGRL  515
                +L V A +  + G ++K +T+ +D  R+
Sbjct  483  TRKSVLTVKAHLRNAEGAKSKALTVESDSKRV  514

>PPTG_16727
Length=217

 Score = 393 bits (1009),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 194/204 (95%), Gaps = 0/204 (0%)

Query  5    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  64
            K +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  4    KVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  GA +KPQ+ VQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQPEEI  123

Query  125  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184
            SSMVLIKMREVAEAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  185  AIAYGLDKKGGERNVLIFDLGGGT  208
            AIAYGLDKKGGE NVLIFDLGGGT
Sbjct  184  AIAYGLDKKGGEHNVLIFDLGGGT  207

>SPRG_11133
Length=676

 Score = 405 bits (1042),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 224/439 (51%), Positives = 299/439 (68%), Gaps = 18/439 (4%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +GIDLGTT   VGVW++ +VE++ ND GN +TPS VAFTD  RL+GD AK+Q   NA NT
Sbjct  10   IGIDLGTTTCSVGVWRHGQVEMVRNDNGNLSTPSCVAFTDAGRLVGDFAKSQAPRNAPNT  69

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
            VF+  R+IGR++ +   +        ++  G  + P I V  KGE+K   PEEI + +++
Sbjct  70   VFNIMRIIGRRYDEVRKKT-------QVVCGPKNNPMIRVVEKGETKELHPEEILAELVV  122

Query  131  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  190
            K+++    +    +++AV+TVP  FN  QRQA +DA AIAGL   RI + PT AA+A+  
Sbjct  123  KLKDDVVTYTNARIEHAVVTVPTGFNLLQRQAVRDACAIAGLAKYRISDAPTTAAVAH-T  181

Query  191  DKKGGER---NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
              KG  R   + ++ D+GGG   VSLL+IE+GIFEVKA AGD  LGGEDFD+ L DHF  
Sbjct  182  SIKGAPRCEVHDMVVDMGGGHLSVSLLAIEDGIFEVKAVAGDACLGGEDFDDVLFDHFAA  241

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
            EF R++RKD+T   RA+RRLRTACE+AKR LS S  A +E++ LF  IDF S+ITRARFE
Sbjct  242  EFARQYRKDMTTCDRAVRRLRTACEKAKRDLSISNTATLELEVLFGSIDFRSSITRARFE  301

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS-  366
            D+C   FRK  +P+EKVLRDAK+ KSQV +VVL GGS R+PK+QQLLS FF  +  +K  
Sbjct  302  DLCSGLFRKVTQPIEKVLRDAKIDKSQVRDVVLAGGSMRMPKMQQLLSSFFGERYADKKL  361

Query  367  ----INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARN  422
                +N +EA A+GATV AA+   +++S     LL+L V P S+G+ET GGVMTTLI+RN
Sbjct  362  CHSILNNNEAAAHGATVMAAL--NDETSPDDMHLLVLHVVPYSVGIETGGGVMTTLISRN  419

Query  423  TTVPTKKAQTFSTYADNQP  441
            TT+P+KK++ F       P
Sbjct  420  TTIPSKKSEKFKISQPQSP  438

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 51/108 (47%), Gaps = 9/108 (8%)

Query  445  IQVFEGERSMTRDNHLLGKFNLDAI-PPMPRGVPQIDVTFDIDANGILN-VSAVEKSTGK  502
            I++F GERSM RDN  L    +     P  R     DV FDID +G+L  +       G 
Sbjct  523  IKIFTGERSMVRDNTPLHTIAIHGFYDPTARS----DVAFDIDGDGLLTAIVTYTPHIGT  578

Query  503  ENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENY  550
               I +  DKG LSQ D+ R+    E   + D+  + R+ A   L+ Y
Sbjct  579  NETIVVKLDKGYLSQHDVKRLTTNFE--AAADDRTRRRV-AHEELQTY  623

>PHALS_00390
Length=569

 Score = 396 bits (1017),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 219/544 (40%), Positives = 337/544 (62%), Gaps = 9/544 (2%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+   +   +  +K W F +   A +   +  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKNHDEIKDRNFVKEWSFSVAQNA-EGVTVETQRNGEKHHVTPVEFMALLLQN  123

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAI-AGLNVLRIINEPTAAAIAYGL  190
            ++E+AE F G+++++ VI+ PA+  DS+     DA A  AG+NVL  ++EP AAAIAYG 
Sbjct  124  LKELAEDFTGEKLEHVVISKPAH-TDSRYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGF  182

Query  191  DKKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            D+         VL+FD+GG T DV+LL++++G+F+V A+ G   LGGE+F   + DH  +
Sbjct  183  DEAVNNEKPEYVLVFDIGGATHDVTLLNVDKGLFQVVASKGKDTLGGENFTAAVFDHCAK  242

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
             F RK + DI  NQ+A  RLR ACE AKR+LS+  Q+ IE+DSL +G DF   ++R RFE
Sbjct  243  AFLRKTKLDIKSNQKASSRLRIACEAAKRSLSTQTQSNIEVDSLMEGEDFALKLSRPRFE  302

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
            ++  ++  +T+  ++ +L +  L K  +  ++LVGGSTRIP VQ ++ ++F GK     +
Sbjct  303  ELISNFVNETITEIDVILEENDLEKDDIDHIILVGGSTRIPLVQNVVKKYFEGKNVRTQL  362

Query  368  NPDEAVAYGATVQAAILGGNd-ssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            +PDEAVA+GAT++A+ L      S  ++ + ++++ PL+L L  A G +  LI R T +P
Sbjct  363  SPDEAVAFGATIEASCLVELVGVSKPIEPVNMVNMVPLNLSLALANGSVAELIHRETILP  422

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID  486
                + F+T  DNQ  V +Q++EG+R M +DN L+ +  +  I P+P+G   I+VTF + 
Sbjct  423  ATVTEIFTTSCDNQETVYLQIYEGQRIMAKDNTLVAQLKVSGITPLPKGDAAIEVTFTVS  482

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIE-AKN  545
              G+L V+A E+  G ++ I +T D  RL+ +D+  +V  AE    ED+     +E A+ 
Sbjct  483  TKGVLTVTASERMAGTKS-IQVTQDSKRLTPADVAAIVKNAEDAADEDDVLLGELEDAEK  541

Query  546  ALEN  549
            A EN
Sbjct  542  AAEN  545

>PHYCA_532207
Length=1118

 Score = 407 bits (1046),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 216/519 (42%), Positives = 331/519 (64%), Gaps = 7/519 (1%)

Query  11    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
             +GID+GTT+ CVGVW N +V +IANDQG RTTP+YV F   E ++GD A N++  +A NT
Sbjct  552   IGIDIGTTHGCVGVWHNGKVNVIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNT  611

Query  71    VFDAKRLIGRKFSDPIVQAD-IKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
             +F  KRL+G K  D I   D +K WPF +T GA    Q   +  GE     P E  +++L
Sbjct  612   IFHLKRLLG-KAHDEIKDRDFVKEWPFDVTEGAEGVAQAETKRNGEKHPVTPVEFMTLLL  670

Query  130   IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
               ++++AE F G+++++ VI+ PA+ ++   +    A   AG+NVL  ++EP AAAIAYG
Sbjct  671   QNLKDLAEDFTGEKLEHVVISKPAHTDEKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYG  730

Query  190   LDKKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
             LD+         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   + +H  
Sbjct  731   LDEAANNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAAVFEHCA  790

Query  247   QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
             + F RK + D+  NQ+A  RLR ACE AKRTLS+  QA IE+D+L +G DF   ++R RF
Sbjct  791   KSFLRKTKLDVKTNQKASSRLRIACETAKRTLSTQTQANIEVDTLMEGEDFALKLSRPRF  850

Query  307   EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
             E++  DY  +T+  ++ +L + +L K  +  +VLVGGSTRIP VQ L+ ++F GK  +  
Sbjct  851   EELINDYVHETITEIDAILEENELEKEDIDHIVLVGGSTRIPLVQTLVKKYFEGKTVHTQ  910

Query  367   INPDEAVAYGATVQAAILGGNd-ssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             ++PDEAVAYGAT++A+ L       +  + L +++V PL+L +  A G ++ LI R+T +
Sbjct  911   LSPDEAVAYGATIEASGLAELVDVPEPKKPLNMVNVVPLNLSVALANGSVSELIQRDTIL  970

Query  426   PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
             P    + F+T  DNQ  V +Q++EG+R M +DN L+ + ++  I P+P+G  +I+VTF +
Sbjct  971   PATATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPLPKGDAEIEVTFTV  1030

Query  486   DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
                G+L V+A E+  G ++ + +  D  RL+ +D+  +V
Sbjct  1031  STKGVLTVTASERKAGNKS-LEVAQDAKRLTPADVAAIV  1068

>PYVX_17692
Length=551

 Score = 390 bits (1003),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 210/525 (40%), Positives = 329/525 (63%), Gaps = 13/525 (2%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            GIDLG+T+ CVGVW N +V IIANDQG RTTP++V F   E ++GD A +++  +A +TV
Sbjct  5    GIDLGSTHGCVGVWHNGKVNIIANDQGFRTTPAFVCFEGDEVIVGDTAVHKLPAHADSTV  64

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KR++G+  +D   +  ++ WPF + +G G     T Q  G +    P +  +++L  
Sbjct  65   FHLKRVLGKSQADVASRPFVQDWPFDVAAGEGGAAVATTQKNGAAHQVAPVDFLALLLRN  124

Query  132  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
            +R++A+ F G+ V++ V++VP + +++ R   +DA A A +NVL  I EPT         
Sbjct  125  LRDLAQDFTGETVEHVVLSVPPHADEAHRALIRDAAAAAEVNVLAYIPEPTPEP------  178

Query  192  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  251
                 + VL+FD+GG T DV+LL+ ++G+F+V AT GD  LGGEDF + + +H  + F+R
Sbjct  179  -----QYVLVFDIGGATHDVTLLTADKGLFDVTATQGDDALGGEDFTSAVFEHCAKAFQR  233

Query  252  KHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  311
            K + D+  NQ+A  RLR ACE AKR+LS+  Q  IE+DSL +G DF+  ++R RFE++  
Sbjct  234  KTKLDVRGNQKASSRLRLACETAKRSLSTQTQVTIEVDSLLEGEDFSLKLSRPRFEELIN  293

Query  312  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDE  371
            DY +K ++ VE +L   +L K  +  VVL+GGSTRIP VQ  +  FF+GK  +  ++PDE
Sbjct  294  DYVKKALDEVEALLEAQELDKEDIDHVVLIGGSTRIPLVQSSVKSFFDGKRTHLHLSPDE  353

Query  372  AVAYGATVQAAILGGNd-ssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKA  430
             VA+GAT++AA  G      D  +    ++ TPL+L +  A G ++ L+ R+T +P    
Sbjct  354  VVAHGATIEAAGRGDLVGVPDPKKPANQVNATPLTLSVALANGSVSELVHRDTVLPASAT  413

Query  431  QTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGI  490
            +TF+T AD+Q  V +Q++EGER M +DN LL +  +  I  +P+G  +IDVTF +   G+
Sbjct  414  ETFTTSADDQTAVFLQIYEGERLMAKDNTLLAQLAVTGITALPKGEAEIDVTFTVSTKGV  473

Query  491  LNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDE  535
            L V+A E+S GK+  + + +D  RL+ +D+  +V + +    ED+
Sbjct  474  LTVTAEERSAGKKT-LEVKHDDKRLTAADVAAIVQKGKDAAEEDD  517

>H310_12765
Length=560

 Score = 389 bits (1000),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 211/511 (41%), Positives = 313/511 (61%), Gaps = 7/511 (1%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCMVSFASDDVVVGDSAVAKLHNNAAN  62

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TV+  KR++G+K  D      +K W F L +     P    +    S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKDVHAHEYVKDWSFDLAADKHGAP--IAKILDGSRDIHAVEFCTIVL  120

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
             K++ +AE + G  VKN+V+TVP  ++D Q+   ++A + A LNVLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGSSVKNSVLTVPEGYSDEQKALLQEAASAADLNVLRYISEPIAAAIAYG  180

Query  190  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            LD  KK   +  ++ D+GG + D++LLS+++G+F V ATA D  LGGE F N +V+H  +
Sbjct  181  LDEDKKNESKLAVVVDIGGASTDLTLLSVDKGLFNVIATASDHALGGEVFTNSVVEHCIK  240

Query  248  EFKRKHRKDIT-DNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
             F+R+ +  I  DN RAL R++ A E+AK++LS+  Q  IE+DSL DG D    ++R+RF
Sbjct  241  TFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQTQVTIEVDSLADGQDLIVKLSRSRF  300

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            EDM  D+ RK  + +  +L  A   K  +  V+L+GGSTRIPKVQ  + +FF+GK+   +
Sbjct  301  EDMVIDHIRKVTKDIAALLEGAGYEKDSIDHVLLIGGSTRIPKVQTAVEDFFDGKKALVT  360

Query  367  INPDEAVAYGATVQAAILGGNds-sdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
            I PDEAVA+GATV++  L      +     L  ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESGTLSETADWTLPEDPLNNVEAVPLNLSLGLADGTVYDMIHRGTIL  420

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            P    + F+T  DNQ  V +QV+EG+R + +DN LL    L  IPP P+G  +++V+F +
Sbjct  421  PANHQEVFTTQVDNQHAVYLQVYEGQRVLKKDNTLLANLTLTGIPPAPKGESEVEVSFTV  480

Query  486  DANGILNVSA-VEKSTGKENKITITNDKGRL  515
               G L V A V  + G    + + +D  R+
Sbjct  481  TRKGQLTVKAHVRNAEGGSKALVVASDSKRV  511

>SPRG_15695
Length=581

 Score = 387 bits (994),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 212/512 (41%), Positives = 315/512 (62%), Gaps = 16/512 (3%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
             +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA N
Sbjct  29   CIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAAN  88

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TV+  KR++G+K SD      IK W F + + A       V  K   +     E +S+VL
Sbjct  89   TVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKREISATEFASLVL  148

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
             K++ +AE + G +VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AAAIAYG
Sbjct  149  GKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAYG  208

Query  190  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
             D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV+H  +
Sbjct  209  FDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALVEHCVK  268

Query  248  EFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  307
             F+R+ + D+ +N RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D           
Sbjct  269  TFERQKKVDLKNNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLI---------  319

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
             M GD+ RK +  +E +L +A L K  +  V+L GGSTRIPKVQ  +  FF+GK+ + +I
Sbjct  320  -MIGDHVRKMITDIEALLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKKASSTI  378

Query  368  NPDEAVAYGATVQAAILG--GNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
             PDE +AYGATV+AA L       +     L +++  PL+L L  A G +  +I RNT +
Sbjct  379  VPDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVL  438

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            P    + F+T+ DNQ  V +Q++EG+R M RDN LL    +  IPPM +G P+I+V+F++
Sbjct  439  PATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNV  498

Query  486  DANGILNVSA-VEKSTGKENK-ITITNDKGRL  515
                +L V A +  + G ++K +T+ +D  R+
Sbjct  499  TRKSVLTVKAHLRNAEGAKSKALTVESDSKRV  530

>H257_07650
Length=563

 Score = 382 bits (980),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 209/490 (43%), Positives = 307/490 (63%), Gaps = 6/490 (1%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCIVSFASDDVVVGDSAVAKLHNNAAN  62

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TV+  KR++G+K  +      +K W F L +     P    +    S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKEVHEHDYVKDWSFDLAADTHGAP--IAKILDGSRDISSVEFCTIVL  120

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
             K++ +AE + G  VKNAV+TVP  ++D Q+   ++A   A L+VLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGVVVKNAVLTVPEGYSDEQKALLEEAATAADLSVLRYISEPIAAAIAYG  180

Query  190  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  247
            LD  KK   + V++ D+GG + D++LLSI++G+F V ATA D  LGGE F N +V+H  +
Sbjct  181  LDEDKKNESKLVVVVDIGGASTDLTLLSIDKGLFNVIATASDHALGGEVFTNSIVEHCVK  240

Query  248  EFKRKHRKDIT-DNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
             F+R+ +  I  DN RAL R++ A E+AK++LS+ +Q  IE+DSL DG D    ++R+RF
Sbjct  241  AFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRF  300

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
            EDM  D+ RK  + +  +L  A  +K  +  V+LVGGS+RIPK Q  + +FF+GK+   S
Sbjct  301  EDMVSDHVRKVTKDIAALLDGAGYAKDTIDHVLLVGGSSRIPKAQSAVEDFFDGKKALVS  360

Query  367  INPDEAVAYGATVQAAILGGNds-sdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
            I PDEAVA+GATV++A L      +        ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESATLSETADWTLPTDPHNNVEAVPLTLSLGLADGTVYEMIHRGTVL  420

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDI  485
            P    + F+T ADNQ  V +QV+EG+R + +DN LL    L  IPP P+G  +++V+F++
Sbjct  421  PANVQEVFTTNADNQDAVYLQVYEGQRVLKKDNTLLANLTLSGIPPAPKGESEVEVSFNV  480

Query  486  DANGILNVSA  495
               G L V A
Sbjct  481  TRKGQLTVKA  490

>PYAR_24704
Length=525

 Score = 378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 198/495 (40%), Positives = 299/495 (60%), Gaps = 12/495 (2%)

Query  27   NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPI  86
            N +V IIANDQG RTTP+YV F   E ++GD A N+V  +A NT+F  KR++G+   D  
Sbjct  1    NGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKVHSHAANTIFHLKRVLGKNHEDVA  60

Query  87   VQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKN  146
                +  W F +  GA           G      P E  S++L  ++ +AE F G+ V +
Sbjct  61   ASDFVSEWSFDVAKGADGAVVAKTSRNGADHEVTPVEFLSILLKNLKNLAEDFTGETVDS  120

Query  147  AVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD---KKGGERNVLIFD  203
             VI++ A+  ++Q++    A A AG+NVL  ++EP AAAIAYGLD   K       ++ D
Sbjct  121  VVISLSAHGGENQKELISAAAAKAGVNVLSYLSEPLAAAIAYGLDENTKNSHAEYAVVVD  180

Query  204  LGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRA  263
            +GG T DV+L+SI++G+FE+  T G+  LGGEDF   + +H  + F+RK + ++ DN +A
Sbjct  181  IGGATHDVTLVSIDKGLFEIVGTHGNDSLGGEDFTKAVFEHCVKAFQRKTKLNVKDNAKA  240

Query  264  LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEK  323
              RLR ACE AKRTLS+ +Q  IE+D+L +G DF   ++R RFE++  DY + +++ VEK
Sbjct  241  SSRLRVACEAAKRTLSTQSQVNIEVDTLMEGEDFALKLSRPRFEELIVDYVKTSLKEVEK  300

Query  324  VLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAI  383
            VL DA + KS V  V+L+GGS+RIP VQ  + +FF+GK+ +  ++PDE VA+GAT++AA 
Sbjct  301  VLEDADVDKSDVDHVILIGGSSRIPLVQTSVKKFFDGKKTHMHMSPDEVVAHGATLEAAA  360

Query  384  LG--GNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQP  441
            +    N    + +   +             G V  T++      PT   + F+T ADNQ 
Sbjct  361  ISELANFDPAESEQNNVAVTPLTLSVALANGSVSETVL------PTSATEVFTTSADNQD  414

Query  442  GVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTG  501
             + IQV+EGER+M +DN LL +  +D I P+P+G  +I+VTF + + G+L V+A E + G
Sbjct  415  AIFIQVYEGERAMAKDNTLLAQLRVDGISPLPKGEAEIEVTFAVSSKGVLTVTANEAAAG  474

Query  502  KENKITITNDKGRLS  516
            K+  + + ND  RL+
Sbjct  475  KKT-LEVKNDGARLT  488

>PYIR_16738
Length=555

 Score = 376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 189/328 (58%), Positives = 258/328 (79%), Gaps = 1/328 (0%)

Query  289  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  348
            DSL DG DF+ T++RARFE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIP
Sbjct  194  DSLLDGEDFSETLSRARFEKLNEDLFKKTLGPVEKVLKDAGVKKSEVDEIVLVGGSTRIP  253

Query  349  KVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslgl  408
            KVQQL+ ++FNGKEP++ +NPDEAVAYGA VQ  IL G    + L D++L+DV PLS G+
Sbjct  254  KVQQLIKDYFNGKEPSRGVNPDEAVAYGAAVQGGILSG-AEQEGLGDMVLIDVVPLSQGI  312

Query  409  ETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDA  468
            ET GGVMT LI +NT +PTKK+Q FST+ DNQP V I+V+EGER++ +DNHLLGKF+L  
Sbjct  313  ETVGGVMTKLINKNTAIPTKKSQVFSTHVDNQPAVSIKVYEGERALVKDNHLLGKFDLTG  372

Query  469  IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAE  528
            IPP PRGVPQI VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ +IDR++ EAE
Sbjct  373  IPPAPRGVPQIQVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRIIREAE  432

Query  529  KYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDA  588
            ++  ED+  K RI+++NALE+Y Y+++NS+ D+K+  ++ + DK  V   V + + WL+ 
Sbjct  433  QFAEEDKRVKERIDSQNALESYLYNVKNSVEDDKVAAKMEDEDKDAVLKSVQDAMDWLED  492

Query  589  HQSAETEEYESKQKELEGVANPILQKMY  616
            +Q A+ +++++KQKE+E + NPI++K+Y
Sbjct  493  NQEADKDDFDAKQKEVEKIVNPIMKKVY  520

 Score = 211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 126/160 (79%), Gaps = 2/160 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  31   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  90

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  P+K+    G KP I V  KGE K F PEEIS+
Sbjct  91   PEQTLFDVKRLIGRSYNDKSVQADKKLLPYKIVDKDG-KPAIEVPIKGEKKLFSPEEISA  149

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDA  166
            M+L KM+++AE ++GK++ +AV+TVPAYFND+QRQATKDA
Sbjct  150  MILTKMKQIAEGYLGKDIHDAVVTVPAYFNDAQRQATKDA  189

>SDRG_05778
Length=618

 Score = 360 bits (923),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 199/240 (83%), Gaps = 6/240 (3%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  247

Query  66   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  126  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  186  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

 Score = 157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 120/196 (61%), Gaps = 9/196 (5%)

Query  410  TAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAI  469
            T G VM+ LI RNT +P KK + ++T  D Q  V + ++EGER+    N+ LG+F +  I
Sbjct  428  TVGRVMSVLIKRNTAIPIKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGI  487

Query  470  PPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEK  529
                RG PQ+ VTF+IDANGILNVSA++K T  + + TI N+ GRL+Q DIDRMVA+AEK
Sbjct  488  ERAKRGEPQVQVTFEIDANGILNVSALDKKTNAKAETTINNNNGRLTQEDIDRMVADAEK  547

Query  530  YKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAH  589
            +K +D     +IEA+N+LE++ Y         +  E   E      ++ + E  +WL+ H
Sbjct  548  FKKDDAEVLKKIEARNSLESFIY---------RALELTREKGDAAAENTIREAREWLEDH  598

Query  590  QSAETEEYESKQKELE  605
            + A   E E K++ LE
Sbjct  599  EDATLRELEEKKRVLE  614

>CCI47582
Length=582

 Score = 356 bits (914),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 203/553 (37%), Positives = 314/553 (57%), Gaps = 20/553 (4%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHADN  62

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFK--GESKTFQPEEISSM  127
             VF  +RL+G+K+ +      +  W FK+     D+ Q     K  GE       E  ++
Sbjct  63   IVFHLRRLLGKKYEEIAENPHVNEWFFKVEKDGKDEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            +L  ++ +A+ + G  +  AV+T   +  D Q+Q    A   A L+++  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVLTTSIHCTDRQQQLLTQAAKEAQLDIMSYLPDPIAAAIA  182

Query  188  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  237
            YG D       KK  +     +L+ D+GG T  ++LLS+++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPNNYKKANQCQADLILVVDIGGATTAITLLSVDKGLFEIVADGGHEGRGGEDL  242

Query  238  DNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  297
               +VDH  Q F RK + DI  N++A+ RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAQSFLRKTKVDIHKNRKAMIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  298  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEF  357
            +  ++R RFE++   + R   E ++KVL +A   K  V  ++LVGGS RIP +Q+ +  +
Sbjct  303  SMKLSRPRFEELIQKHVRFIFEEIDKVLVNADTEKENVDHIILVGGSCRIPLIQEKIQSY  362

Query  358  FNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGV---  414
            F     +  ++PDE VA GAT++AA L          D L   V   ++ L  + G+   
Sbjct  363  FKDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLDQHVNVNAVPLSLSVGLVHG  422

Query  415  -MTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
             + TLI R+  +P K  +TF+T+ DNQ  VLI+++EGER++   N LL +  +  I P+P
Sbjct  423  NVHTLIHRDAILPAKMTETFTTWEDNQTEVLIEIYEGERAIAEKNTLLARMCVSGIAPLP  482

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKIT-ITNDKGRLS-QSDIDRMVAEAEKYK  531
            +G  +I +   + + G+L V A     G+E KI  I  D+ RL+ +  +D++V  A    
Sbjct  483  KGEAEIILQVQVSSKGVLTVKA--SMNGEEKKILEIHTDEARLADKKQLDQIVEAANDAI  540

Query  532  SEDEANKVRIEAK  544
             ED+     IE K
Sbjct  541  DEDDTFLTEIENK  553

>PYIW_19165
Length=1124

 Score = 368 bits (945),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 192/516 (37%), Positives = 306/516 (59%), Gaps = 26/516 (5%)

Query  12    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
             GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  585   GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLTSHAENTI  644

Query  72    FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
             F  KR++G+   + + +  I+ W FK+               G++    P E  S+++  
Sbjct  645   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSDDGAVHAATSRNGDAHHVTPVEFVSLLIKN  704

Query  132   MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  191
             ++++AE F G+ V + V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  705   LKDLAEDFTGETVDDVVLSIPAHATEKQKELLQAAADKAGVNVLTFISEPIAAAIAYGLD  764

Query  192   ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
                K     +VL+FD+GG T DV+L++ ++G+FE+ AT+G   LGGEDF   L +H  + 
Sbjct  765   DSAKGSHPESVLVFDIGGATHDVTLINADQGLFEIVATSGKDDLGGEDFTKALFEHCAKT  824

Query  249   FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  308
             F+RK   D+  N++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  825   FQRKTTLDVKKNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  884

Query  309   MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN  368
             +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP +Q  + + F+GK  +  ++
Sbjct  885   LIYDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVMKHFDGKTTHLHLS  944

Query  369   PDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  428
             PDE VA+GAT++A++                         E+    +  +   N T P  
Sbjct  945   PDEVVAHGATIEASL------------------RADIANFESPKKPLNHV---NVT-PLT  982

Query  429   KAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDAN  488
              +   +  +DNQ  + +QV+EGER M +DN LL   ++  I   P+   +I+VTF +   
Sbjct  983   LSVALANGSDNQTAIFLQVYEGERVMAKDNTLLASLSVTGIAAAPKSEAEIEVTFTVSTK  1042

Query  489   GILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMV  524
             G+L+++AVE++ G +  + + +D  RL+ +D+  ++
Sbjct  1043  GVLSITAVEQAAGTKT-LEVKSDPKRLTAADVAAII  1077

>CCA20229
Length=583

 Score = 350 bits (899),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 203/553 (37%), Positives = 314/553 (57%), Gaps = 20/553 (4%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHAEN  62

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFK--GESKTFQPEEISSM  127
             VF   RL+G+   +    A +  W FK+   + ++ Q     K  GE       E  ++
Sbjct  63   IVFHLGRLLGKSHEEVAENAHVNEWFFKVEKDSKNEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            +L  ++ +A+ + G  +  AVI+   +    Q+Q    A   A LNV+  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVISTSIHCTTEQKQVLAQAAKDAELNVMSYLPDPIAAAIA  182

Query  188  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  237
            YG D       KK  +     +L+ D+GG T  V+LL++++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPKNYKKANQSTAQLILVVDIGGATTAVTLLNVDKGLFEIVADGGSEFRGGEDL  242

Query  238  DNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  297
               +VDH  + F RK +  I +N++A  RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAKSFLRKTKVAIQNNRKATIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  298  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEF  357
            +  ++R RFE++  D+ R   E ++ VL  A + K  V  V+LVGGS RIP +Q+ +  +
Sbjct  303  SMKLSRPRFEELIQDHVRFIFEEIDAVLEKADVDKENVDHVILVGGSCRIPLIQEKIQTY  362

Query  358  FNGKEPNKSINPDEAVAYGATVQAA----ILGGNdssdklqdlllldvtplslglETAGG  413
            F     +  ++PDE VA GAT++AA    +L      D L+    ++  PLSL +  A G
Sbjct  363  FGDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLEQHANVNAVPLSLSVGLAHG  422

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
             + TLI R+  +P K  +TF+T+ DNQ   LI+++EGER++   N LL +  +  I P+P
Sbjct  423  NVHTLIHRDVVLPAKMMETFTTWEDNQTEALIEIYEGERAIAEKNTLLAQMCISGITPLP  482

Query  474  RGVPQIDVTFDIDANGILNVSAVEKSTGKENK-ITITNDKGRLSQS-DIDRMVAEAEKYK  531
            +G  +I +   + + G+L V A+    G+E K + I  D+ RL+ +  +D +V  A    
Sbjct  483  KGEAEIIIELQVSSQGLLTVRAI--LNGEEKKMLEIHTDQARLADAKKLDHIVEAANAAM  540

Query  532  SEDEANKVRIEAK  544
             ED+     IE K
Sbjct  541  DEDDTFLTEIENK  553

>PITG_15111
Length=186

 Score = 333 bits (853),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  7    PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR  66

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            LV+ F  EFKRKHRKD+T NQRALRRLRTACERAKRTL +SAQAYIEIDSL+DG+DFNST
Sbjct  67   LVEFFVTEFKRKHRKDMTSNQRALRRLRTACERAKRTLFTSAQAYIEIDSLYDGVDFNST  126

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ITRARFED+C DYFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIPKVQQLL +FFNG
Sbjct  127  ITRARFEDLCSDYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPKVQQLLKDFFNG  186

>PYAR_24687
Length=618

 Score = 344 bits (882),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 207/543 (38%), Positives = 311/543 (57%), Gaps = 12/543 (2%)

Query  6    TSGYSVGIDLGTTYSCVGVWQND--RVEIIANDQGNRTTPSYVAFTDT--ERLIGDAAKN  61
            ++ + + ID GT+ +   V +N   +VEII ND+G+  TP+YV +     E ++G  AK 
Sbjct  35   SAHHMIAIDFGTSNTRAAVVRNTTGQVEIIPNDKGHSATPTYVTWDSVTGEVIVGRDAKQ  94

Query  62   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  121
            Q  +   NT FD K+L+GR F    VQ+ I   P+ +     +KP I V+ KGE++ F  
Sbjct  95   QALLQPKNTAFDFKQLLGRSFDSKEVQSAIAQLPYTIID-RDNKPFIQVEMKGETREFSV  153

Query  122  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  181
            EE+++MVL +M++ AEA++G+E++NAV+TVPA F D+QR+A K A A+AGL   R++NEP
Sbjct  154  EEVTAMVLTRMKQFAEAYLGEEIENAVVTVPASFEDAQREAMKAACAMAGLTTRRVLNEP  213

Query  182  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            TAA + +G+  K   ER VL+    GG  D +LL I+EGI EV  T   +H  G++   R
Sbjct  214  TAATMGFGIKPKTQHERKVLVVHFDGGALDATLLEIDEGIVEVLVT--KSHRIGDEVTQR  271

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
            ++DH   ++K     DI+ + R L+RLR   ER +  LS   +A + I+S         +
Sbjct  272  VMDHCISQWKYDKHVDISTDPRMLQRLRLEAERVQHALSEQTEAVVTIESSSGSAVLTQS  331

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
             +RA  E M  D     +E VE  L +  ++K +V  +V  GG++RIP ++QL+ E F  
Sbjct  332  FSRATLETMTRDLAEPLVEIVEIALMNGGVAKQEVDGIVFAGGASRIPMLRQLMVERFGW  391

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
             E    ++ +E V +GA   A I+ G  + D   +L +L     SLG+ETAGGVM  +++
Sbjct  392  IELQCDVDEEEVVVHGAAAIADIIHGQ-AVDATAELNILPWIVNSLGVETAGGVMLPVLS  450

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480
            R+   PT+  QT ST   NQ  + I+VFEGER +T+DNH +G+  L  + P P+GVP+I+
Sbjct  451  RHRLTPTRATQTVSTLHANQLDITIRVFEGERLLTKDNHFIGQLRLSGLAPAPQGVPRIE  510

Query  481  VTFDIDANG-ILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKV  539
            V F+ DA G  L  +A  + T   + +TI   K      +  R     E  K ED   K 
Sbjct  511  VEFETDAMGETLFATARVEGTNLADSLTIQVAKHAFEHDEAVRKA--GEDAKDEDTKVKA  568

Query  540  RIE  542
            RIE
Sbjct  569  RIE  571

>PHYSO_549561
Length=361

 Score = 330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/366 (51%), Positives = 249/366 (68%), Gaps = 11/366 (3%)

Query  241  LVDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  299
            +V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+S
Sbjct  1    MVEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSS  60

Query  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFN  359
            T+TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F 
Sbjct  61   TVTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFG  120

Query  360  GKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLI  419
            GKE +KSINPDEAVAYGA VQ AIL G   +D    LLL+DVTPLSLG+ET G VM+ LI
Sbjct  121  GKELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLI  179

Query  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQI  479
             RNT +P +K + ++T  D Q  V + ++EGER+    N+ LG+FN+  +    RG PQ+
Sbjct  180  KRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQV  239

Query  480  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKV  539
            +VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVAEA+K+K +D     
Sbjct  240  EVTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLR  299

Query  540  RIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYES  599
            RIEA+N LE + Y         +  E   E     V+  + +   WL+ H+ A   E E 
Sbjct  300  RIEARNDLEQFIY---------RAIEMAREKGDTNVESAIRDARDWLEDHEEATLRELED  350

Query  600  KQKELE  605
            K++ LE
Sbjct  351  KKRMLE  356

>PYIW_17145
Length=443

 Score = 330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 190/391 (49%), Positives = 251/391 (64%), Gaps = 18/391 (5%)

Query  190  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  249
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  1    MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEF  59

Query  250  KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  303
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  60   KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  117

Query  304  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP  363
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  118  ATFEKLVNHLIERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTTVEDFF-GKKP  176

Query  364  NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNT  423
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  177  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLITRNT  231

Query  424  TVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTF  483
            T+PTKK+Q FST AD+Q  V I+V +GER M  DN  LG F+L  IPP PRGVPQI+V+F
Sbjct  232  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSF  291

Query  484  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEA  543
            DIDANGI+NV+A +K+TGKE  I I +  G LS S+I+RMV EAE     D   K  IEA
Sbjct  292  DIDANGIVNVAARDKATGKEQNIVIQS-SGGLSDSEIERMVQEAEMNAEADLKRKELIEA  350

Query  544  KNALENYAYSLRNSL--NDEKLKEQIPEADK  572
            KN  ++ AY+   +L  ++EKL ++  EA K
Sbjct  351  KNEADSVAYTTEKTLKEHEEKLDKETVEAVK  381

>PHYKE_2977
Length=220

 Score = 318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)

Query  447  VFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  506
            VFEGERSMTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI
Sbjct  1    VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  60

Query  507  TITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQ  566
            TITNDKGRLSQ+DIDRMVAEAEKYKSEDEANK+RIEAKNALENYAY+LRN+LNDEKLK+Q
Sbjct  61   TITNDKGRLSQADIDRMVAEAEKYKSEDEANKIRIEAKNALENYAYNLRNTLNDEKLKDQ  120

Query  567  IPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANPILQKMY  616
            I E DKK +DDKVTETI WLDA+QSAE EE+E KQKELEGVANPILQKMY
Sbjct  121  ITEDDKKAIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMY  170

>PITG_16528
Length=561

 Score = 325 bits (832),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 213/505 (42%), Positives = 299/505 (59%), Gaps = 29/505 (6%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTER--LIGDAAKN-Q  62
             +GIDLGTT SCVG+W  DR  V+I  N  D+G RTTPS V F    +   +G+ A   +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKIFKNHLDRG-RTTPSVVRFDPKSQSVAVGNVAVGLE  80

Query  63   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQP  121
             +    NT+   KRL+G+KF    V     +  +++   A     + V  +G+ K   QP
Sbjct  81   TSEPVENTIRSVKRLMGQKFDSKAVDVARIYASYEVAPTAQGNVAVQV-VRGQKKVQVQP  139

Query  122  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
            EE+S+ VL +++  A+A+     K  N VITVPAYF+D+QR+AT  + ++AG   +R++N
Sbjct  140  EEVSACVLRELKASADAYFDGHTKLDNVVITVPAYFSDTQRKATIASASMAGFKAVRLLN  199

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYGL    G + V +FD GGGT DVSLLSIE+G FEV    GDT+LGGED +N
Sbjct  200  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIEDGKFEVLGIGGDTNLGGEDINN  258

Query  240  RLVDHFTQEFKRKH---RKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  296
             L+DH      R+H   R  +   Q  + RL+   E+AK  LS    A I +  + D   
Sbjct  259  TLLDHVLDVLYRRHNVTRAQV--GQADMVRLKREVEKAKIELSEQEDAEISVHDIADVST  316

Query  297  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSE  356
            F  T+TR +FE +C   ++K +  V  VLRDA++  S + EV+LVGGSTRIP ++  +SE
Sbjct  317  FTYTLTRRKFEQLCDAIWKKCLRIVSSVLRDAEVEPSDIDEVILVGGSTRIPVLRTKISE  376

Query  357  FFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMT  416
             FNGKE   S+N DE V  GA +QAAIL G       +D+L++DV PL +GLETA G M 
Sbjct  377  AFNGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSME  435

Query  417  TLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR--  474
             ++ RN  +PT   + F TY D Q G+ ++V+EGE+ + ++N  +  FN      +PR  
Sbjct  436  VILLRNARIPTTVTKYFQTYEDEQRGLTVEVYEGEKEVAKENDHICYFNF----ALPRDK  491

Query  475  ----GVPQIDVTFDIDANGILNVSA  495
                G     VTF ++A+GIL V A
Sbjct  492  VGKAGEFAHPVTFTMNASGILQVQA  516

>PHYSO_493381
Length=562

 Score = 322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 211/505 (42%), Positives = 300/505 (59%), Gaps = 28/505 (6%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERL--IGDAA-KNQ  62
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  T +   +G+AA + +
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVRFEPTTQRADVGNAAVQLE  80

Query  63   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQP  121
                  NTV   KRL+G+KF          +  +K+ S A     + V   G+ K   QP
Sbjct  81   TQEPVGNTVRSVKRLMGQKFESKAADVARIYATYKVVSTAQGNAAVQVARGGQKKVHVQP  140

Query  122  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
            EE+S+ VL +++  AEA+    VK  N VITVPAYF+DSQR+AT  + ++AG   +R++N
Sbjct  141  EEVSACVLAELKASAEAYFDGSVKLDNVVITVPAYFSDSQRKATITSASMAGFKAVRLLN  200

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYGL   G  + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +N
Sbjct  201  EPTAAAMAYGLFLSG-TKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDINN  259

Query  240  RLVDHFTQEFKRKHRKDITDNQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  296
             LVDH  +   + H  D+   Q     + RL+   E+AK  LS+   A IE+  +     
Sbjct  260  ILVDHLLEVLYKHH--DVARAQVGEGDMVRLKREVEKAKIELSAEDYAEIELQGIAGVKT  317

Query  297  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSE  356
            F  T+ R +FE +C   ++K +  V  VL++A++    + EV+LVGGSTRIP ++  +SE
Sbjct  318  FTYTLMRRKFEQLCDPIWKKCLRIVTSVLKEAEVEAVDIDEVILVGGSTRIPILRTKISE  377

Query  357  FFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMT  416
             F GKE   S+N DE V  GA +QAAIL G       +D+L++D  PL +GLETA G M 
Sbjct  378  AFGGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDALPLPIGLETADGSME  436

Query  417  TLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR--  474
             ++ RN  +PT   + F T+ D+Q G+ ++V+EGE+ + ++N  +  FN      +PR  
Sbjct  437  VILPRNARIPTTVTKYFQTFEDDQLGLTVEVYEGEKEIAKENDHICYFNF----ALPRDK  492

Query  475  ----GVPQIDVTFDIDANGILNVSA  495
                G     VTF ++A+GIL V A
Sbjct  493  IGKAGEFAHPVTFTMNASGILQVQA  517

>PHYRA_79054
Length=563

 Score = 320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 206/506 (41%), Positives = 300/506 (59%), Gaps = 30/506 (6%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F D      D     VA+
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRSDRG-RTTPSVVRF-DPSSQAADVGNAAVAL  79

Query  66   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQ  120
                   NT+   KRL+G+KF          +  +++   A     + V   G+     Q
Sbjct  80   ETCEPLGNTIRSVKRLMGQKFDSKAADVARIYAGYRVLPTAQGNVAVQVLRGGKRDIQVQ  139

Query  121  PEEISSMVLIKMREVAEAFI--GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  178
            PEE+S+ VLI+++  AEA+   G+ ++N VITVPAYF+DSQR+AT  + ++AG   +R++
Sbjct  140  PEEVSACVLIELKASAEAYFEDGRRLENVVITVPAYFSDSQRKATITSASMAGFKAVRLL  199

Query  179  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  238
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  200  NEPTAAAMAYGL-FLSGRKVVTVFDFGGGTLDVSLLSIDDGKFEVLGIGGDTNLGGEDIN  258

Query  239  NRLVDHFTQEFKRKHRKDITDNQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  295
            N L DH  +   + H  D+T  Q     + RL+   E+AK  LS+   A + +  +    
Sbjct  259  NTLCDHLLEVLYKHH--DVTRAQVGDVDMVRLKREVEKAKIELSTEEYADVTVHGIAGVK  316

Query  296  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  355
             F  ++ R++FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP ++  +S
Sbjct  317  TFTYSLLRSKFEQLCDPIWKKCLRIVSSVLKEAEMEAADIDEVILVGGSTRIPILRTKIS  376

Query  356  EFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVM  415
            E FNGKE   S+N DE V  GA +QAAIL G       +D+L++DV PL +GLETA G M
Sbjct  377  EAFNGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSM  435

Query  416  TTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR-  474
              ++ RN  +PT   + F T+ D+Q G+ ++V+EGE+ + ++N  +  FN      +PR 
Sbjct  436  EVILPRNARIPTTVTKNFQTFEDDQRGLTVEVYEGEKDIAKENDHICYFNF----ALPRD  491

Query  475  -----GVPQIDVTFDIDANGILNVSA  495
                 G     VTF ++A+GIL V A
Sbjct  492  KIGKAGEFAHPVTFTMNASGILQVQA  517

>PYU1_G002895
Length=561

 Score = 317 bits (813),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 208/505 (41%), Positives = 303/505 (60%), Gaps = 26/505 (5%)

Query  8    GYSVGIDLGTTYSCVGVWQNDR--VEII--ANDQGNRTTPSYVAF---TDTERLIGDAAK  60
            G  +GIDLGTT SC+G+W  +R  V+I+  A D+  RTTPS V F   ++    +G AA 
Sbjct  21   GLCIGIDLGTTNSCIGMWHVERNHVKILKSAKDR-KRTTPSVVRFDPASEHAYEVGHAAI  79

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120
             Q      NTV   KRL+G+K++   V+       + + S       + V    +    Q
Sbjct  80   AQETQPVGNTVRSIKRLMGQKYASKAVEVAKSFGTYTVASTKQGNAAVQVVRNEKPALLQ  139

Query  121  PEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
            PEE+S+ +L  ++  AEA+  GK + N VITVPAYF+DSQR+AT  + ++AG  V+R++N
Sbjct  140  PEEVSACILSDLKASAEAYFDGKRIDNVVITVPAYFSDSQRKATITSASMAGFKVIRLMN  199

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N
Sbjct  200  EPTAAAMAYGL-FVAGTKIVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNN  258

Query  240  RLVDHFTQEFKRKH---RKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  296
             ++DH ++   + H   R  +T N   + +L+T  ERAK  LS+   A I +  +     
Sbjct  259  VIIDHLSELLHKHHDVARSRLTMND--MIQLKTQAERAKIELSNEDTAKIRLRDVAGIPA  316

Query  297  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSE  356
            F  T+TR +FE +C   ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +S+
Sbjct  317  FEYTLTRHKFEQLCESIWKKCLRIVSSVLKEAEVEVADVDEVVMVGGSTRIPILRSKISD  376

Query  357  FFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMT  416
            FFNGKE   S+N DE V  GA +QAAIL G       +D+L++DV PL +GLETA G M 
Sbjct  377  FFNGKELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETADGRME  435

Query  417  TLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR--  474
             +I +N  +P    + F T+ DNQ G+ I+V+EGE  + ++N  +  FN      +PR  
Sbjct  436  VIIPKNARIPVSLTKYFQTFEDNQRGLTIEVYEGENEVAKENDHICYFNFT----LPRDK  491

Query  475  ----GVPQIDVTFDIDANGILNVSA  495
                G     VTF ++A+G+L V A
Sbjct  492  VGKAGEFAHPVTFTMNASGVLQVQA  516

>SDRG_17122
Length=361

 Score = 310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/370 (47%), Positives = 241/370 (65%), Gaps = 20/370 (5%)

Query  76   RLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREV  135
            R+IGR++ +    A +         G+ + P I V  KG++K   PEE+ + +++K+++ 
Sbjct  2    RIIGRRYDEVRKTAQV-------VRGSMNNPIIRVIEKGDAKELHPEEVLAELVVKLKDD  54

Query  136  AEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY----GLD  191
              A+    +++A++TVP  FN  QRQA +DA AIAGL   RI +  T AA+ +    G+ 
Sbjct  55   VAAYTNARIEHAIVTVPTGFNLLQRQAVRDACAIAGLTNYRIKDVSTTAAVGHTSIKGMP  114

Query  192  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  251
            ++ G    ++ DLGGG   V LL IE GIFEV+A AG T LGGEDFD+ L DHF  EF R
Sbjct  115  RREGHD--MVVDLGGGHLSVPLLMIENGIFEVEAVAGITCLGGEDFDDHLYDHFVAEFSR  172

Query  252  KHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  311
            KHRKD+T   RA+RRLRTACE+ KR LS S  A +E++ LF  IDF S+ITRARFE +C 
Sbjct  173  KHRKDMTTCNRAVRRLRTACEKVKRDLSVSNTATLELEMLFGDIDFCSSITRARFEALCS  232

Query  312  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS-----  366
            + F K  + +EKVLRDAK++KSQV +VVL GGS R+PK+QQLLS FF G   +K      
Sbjct  233  ELFSKVTKLIEKVLRDAKINKSQVRDVVLAGGSMRMPKMQQLLSTFFGGANVDKKLCHSI  292

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
            +N +EA A+GATV AA + G   +      L+LD    S+G+ET GGV+T+LI+RNTT+P
Sbjct  293  LNNNEAAAHGATVMAAAVYGE--TWPDSRFLVLDAVSDSVGIETDGGVLTSLISRNTTIP  350

Query  427  TKKAQTFSTY  436
             KK++ F  +
Sbjct  351  AKKSKKFEIF  360

>PPTG_05819
Length=561

 Score = 316 bits (809),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 207/506 (41%), Positives = 299/506 (59%), Gaps = 31/506 (6%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + + D     V +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKILKNSLDRG-RTTPSVVRFDPKSQSV-DVGNVAVGL  79

Query  66   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQ  120
                   NT+   KRL+G++F +  V     +  +++   A     + V  +G  K   Q
Sbjct  80   ETSEPVGNTIRSVKRLMGQRFENKAVDVARIYASYEVAPTAQGNVAVQV-VRGHKKVQVQ  138

Query  121  PEEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  178
            PEE+S+ VL +++  AEA+   + K  N VITVPAYF+D+QR+AT  + ++AG   +R++
Sbjct  139  PEEVSACVLRELKASAEAYFDGQTKLDNVVITVPAYFSDAQRRATITSASMAGFKAVRLL  198

Query  179  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  238
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  199  NEPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDIN  257

Query  239  NRLVDHFTQEFKRKH---RKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  295
            N L+DH      ++H   R  +   Q  + R++   E+AK  LS    A I +  +    
Sbjct  258  NTLLDHLLDVLYKRHNVTRAQV--EQGDMVRVKREVEKAKIELSEQESADITVYEIAGVS  315

Query  296  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  355
             F  T+TR +FE +C   ++K +  V  VL+ A++  + + EV+LVGGSTRIP ++  +S
Sbjct  316  TFKYTLTRRKFEQLCDPIWKKCLRIVASVLKHAEVDAADIDEVILVGGSTRIPVLRTKIS  375

Query  356  EFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVM  415
            E FNGKE  KS+N DE V  GA +QAAIL G       +D+L++DV PL +GLETA G M
Sbjct  376  EAFNGKELCKSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGTM  434

Query  416  TTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR-  474
              ++ RN  +PT   + F TY D+Q G+ ++V+EGE+ + ++N  +  FN      +PR 
Sbjct  435  EVILPRNARIPTTVTKYFQTYEDDQRGLTVEVYEGEKEIAKENDHICYFNF----ALPRD  490

Query  475  -----GVPQIDVTFDIDANGILNVSA  495
                 G     VTF ++A+GIL V A
Sbjct  491  KIGKAGEFAHPVTFTMNASGILQVQA  516

>PHYCA_6458
Length=560

 Score = 315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 209/508 (41%), Positives = 300/508 (59%), Gaps = 35/508 (7%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLI--GDAAKN-Q  62
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + +  G+ A   +
Sbjct  21   CLGIDLGTTNSCVGMWHVDRHHVKILKNRLDRG-RTTPSVVRFNPQSQSVDVGNVAIGLE  79

Query  63   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQ---FKGESKT-  118
             +    NT+   KRL+G+KF+         +  +++       PQ  V     +G+ K  
Sbjct  80   TSEPVGNTIRSVKRLMGQKFASKATDVARIYASYEVAP----TPQGNVAAQVVRGQKKVQ  135

Query  119  FQPEEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLR  176
             QPEE+S+ +L +++  AE +   +VK  N VITVPAYF+DSQR+AT  A ++AG   +R
Sbjct  136  VQPEEVSACILTELKASAEGYFDGQVKLDNVVITVPAYFSDSQRKATITAASMAGFKAVR  195

Query  177  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGED  236
            ++NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED
Sbjct  196  LLNEPTAAAMAYGL-FLSGTKMVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGED  254

Query  237  FDNRLVDHFTQEFKRKHRKDITDNQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFD  293
             +N LVDH  +   + H+  +T  Q     + RL+ A E+AK  LS      I +  +  
Sbjct  255  INNVLVDHLLEVLYKHHK--VTRAQVGEADMVRLKRAVEKAKIELSEEEDVEITVHDIAG  312

Query  294  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
               F  T+TR +FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP ++  
Sbjct  313  VEKFAFTLTRRKFEQLCDPIWKKCLRIVSSVLKEAQVEAADIDEVILVGGSTRIPILRTK  372

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            +S+ FNGKE   S+N DE V  GA +QAAIL G       +D+L++DV PL +GLETA G
Sbjct  373  ISDAFNGKELCLSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETADG  431

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
             M  ++ RN  +PT   + F TY D Q G+ ++V+EGE+   ++N  +  FN      +P
Sbjct  432  TMEVILPRNARIPTTVTKYFQTYEDGQRGLTVEVYEGEKENAKENDHICYFNF----ALP  487

Query  474  R------GVPQIDVTFDIDANGILNVSA  495
            R      G     VTF ++A+GIL V A
Sbjct  488  RDKIGKAGEFAHPVTFTMNASGILQVQA  515

>PYAR_14579
Length=567

 Score = 314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 205/507 (40%), Positives = 303/507 (60%), Gaps = 28/507 (6%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTERLIGDAAKNQV  63
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  +  E L+G+AA  + 
Sbjct  22   CIGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVHFLPSSHEVLVGNAAIARE  80

Query  64   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESK-TFQPE  122
                 NTV   KRL+G++F    VQ   K     + + A     + VQ  G+     QPE
Sbjct  81   YEPPGNTVRAIKRLMGQRFDSRAVQLASKFATHSIVATAQGNAAVQVQRGGDGVIAVQPE  140

Query  123  EISSMVLIKMREVAEAFI----GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  178
            EI++ VL +++  AEA+      K + N VITVPAYFNDSQR+AT  +  +AG   +R++
Sbjct  141  EIAAEVLRELKASAEAYWEQTHSKRIDNVVITVPAYFNDSQRKATILSAQMAGFKAVRLL  200

Query  179  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  238
            NEPTAAA+AYGL    GE++V++ D GGGT DVSLL+I +G F+V    GDT+LGGED +
Sbjct  201  NEPTAAAMAYGL-FVSGEKHVVVVDFGGGTLDVSLLAIHDGKFQVLGIGGDTNLGGEDIN  259

Query  239  NRLVDHFTQEFKRKHRKDITDNQRA-LRRLRTACERAKRTLSSSAQAYIEIDSL---FDG  294
            + ++ H  +  +R+     +   R+ L +++   ERAK  LS+     +E+ +L      
Sbjct  260  DLVMAHVLENLQRQRSVPRSALSRSDLIQIKREVERAKVALSTDESVELELPNLGPLAKQ  319

Query  295  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  354
              F   +TR +FE +CG  + + ++ VE VLR+A +   ++ EV++VGGSTRIP V+  +
Sbjct  320  KPFTLVLTRTKFESLCGSIWTRCLDIVEDVLREAGVETHEIDEVIMVGGSTRIPIVRSKV  379

Query  355  SEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGV  414
            S FF+ KE   S+N DE V  GA +QAAIL G       +D+L++DV PL +GLE A G 
Sbjct  380  SAFFHDKELCVSVNADEVVCEGAAIQAAILSG-IDKRVFRDVLMMDVIPLPIGLEKADGR  438

Query  415  MTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR  474
            M  L+A+N+ +P    + F T+ D Q G+ +QV+EGE+ M ++N  +  F+     P+PR
Sbjct  439  MEVLLAKNSRIPVSVTKYFETFEDGQRGLTVQVYEGEKEMAKENDHISDFSF----PLPR  494

Query  475  ------GVPQIDVTFDIDANGILNVSA  495
                  G  +  VT  ++A+G+L V A
Sbjct  495  DKIGKAGEFRHPVTLTMNASGVLQVQA  521

>H310_03911
Length=570

 Score = 309 bits (792),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 204/516 (40%), Positives = 299/516 (58%), Gaps = 26/516 (5%)

Query  10   SVGIDLGTTYSCVGVWQNDR-----VEIIANDQGNRTTPSYVAFT-DTERLIG-DAAKNQ  62
             +GIDLGTT SCVG W+        V  +  D  ++T PS V+F       +G DA +++
Sbjct  21   CIGIDLGTTNSCVGYWKEGANFAKIVNHVGKDGKHKTVPSVVSFPPQGNPFVGFDAVEHE  80

Query  63   VAMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  121
              +     T+  AKRL+G+  ++  V  + K+  + L     D   + +    +     P
Sbjct  81   QKLEPDTVTIRSAKRLMGKTLAE--VGDEQKYLSYSLCD---DGDHVAIDLPSKKTVVAP  135

Query  122  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  181
             E+S+++L  +++  E  +G +V N V+TVPA+FN+SQRQAT  A A+AG   +R++NEP
Sbjct  136  SEVSAILLKYIKDTTEEKLGHQVVNCVLTVPAHFNESQRQATLKAAAMAGFQGIRLLNEP  195

Query  182  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            TAAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    G+THLGGED ++ L
Sbjct  196  TAAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGKFAVDGVGGNTHLGGEDINHVL  254

Query  242  VDHFTQEFKRKHR-KDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300
             D+  +  + ++    +T ++ A+ +L+ A E AK TLSS  +  I +D +         
Sbjct  255  YDYMLESIQNQNGGTPLTLDRTAIIQLQQAAEHAKVTLSSQKEVSIYLDDIGGVKSHKLK  314

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +TR++FE +C     + ++    VL    L+ + + EVVLVGGSTRIP ++  LS  FNG
Sbjct  315  LTRSKFESLCDPLLTRCIDITLNVLASIDLTPNDIDEVVLVGGSTRIPALRNKLSALFNG  374

Query  361  KEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIA  420
            KE   S+N DE VA GA +QAAIL G  +   LQD+L+LDV PLS+G+E A G M  LI 
Sbjct  375  KEMCTSMNADEVVASGAAIQAAILSG-VNKRVLQDVLMLDVIPLSIGIEKADGTMEVLIP  433

Query  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR------  474
            +N+ +P    + F T  D+Q G+ ++VFEGE+ + RDN  L  FN      +PR      
Sbjct  434  KNSRIPIAVTKHFETLDDDQRGITVEVFEGEKPVARDNVFLTYFNF----TLPRHKAGKA  489

Query  475  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  510
            G  Q  VT  +DANGIL V A  +    +N++ I+N
Sbjct  490  GEFQHAVTLSMDANGILQVKAGAQHDIDDNEVAISN  525

>PHALS_02692
Length=557

 Score = 305 bits (780),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 201/505 (40%), Positives = 297/505 (59%), Gaps = 29/505 (6%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAFTDTERLI--GDAAKN-QV  63
             +GIDLGTT SCVG+W  DR  V+I  N     RTTPS V F  T + +  G AA + + 
Sbjct  18   CLGIDLGTTNSCVGMWYVDRNHVKIFKNRLNRGRTTPSVVHFDPTSQSVDVGQAAIDLET  77

Query  64   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQF-KGESKT-FQP  121
            +    NT+   KRL+G+K+          +  +++   A  +  + VQ  +G  K   QP
Sbjct  78   SEPVGNTIRSIKRLMGQKYESKATDVARIYASYEVAPTA--QKNVAVQLVRGHKKVQVQP  135

Query  122  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
            EE+S+ +L +++  AEA+   + +  N VITVPAYF+D+QR+AT  +  +AG   +R++N
Sbjct  136  EEVSAYILTELKTSAEAYFDGQTRLNNVVITVPAYFSDAQRKATITSALMAGFKAVRLLN  195

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAA+AYGL    G + V +FD GGGT DVSLL I++G FEV    GDT+LGGED +N
Sbjct  196  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLRIQDGKFEVLGIGGDTNLGGEDINN  254

Query  240  RLVDHFTQEFKRKH---RKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  296
             ++DH  +   ++H   R  +T     L RL+   E+ K  LS    A + +  L     
Sbjct  255  LVLDHVLEVLNKRHNVIRSQVTGAD--LVRLKQEVEKLKIQLSVEESADVIVRDLAGVPR  312

Query  297  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSE  356
               T+TR +FE +C   ++K +  +  VL++A++  + + EV+LVGGSTRIP ++  +S+
Sbjct  313  VTVTLTRRKFEQLCDPIWKKCLRIMSSVLKEAQVDAADMDEVILVGGSTRIPCLRSKISK  372

Query  357  FFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMT  416
             F+GKE   S+N DE V  GA +QAAIL G       +D+L++DV PL +GLETA G M 
Sbjct  373  AFHGKELCMSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETADGTME  431

Query  417  TLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR--  474
             ++ RN  +PT   + F+TY DNQ G+ I+V+EGE+ + ++N  +  FN      +PR  
Sbjct  432  VILPRNARIPTTVTKYFTTYEDNQRGITIEVYEGEKDIAKENDHICYFNF----ALPRNK  487

Query  475  ----GVPQIDVTFDIDANGILNVSA  495
                G     VTF ++A+GIL V A
Sbjct  488  IGKAGEYSHPVTFTMNASGILQVQA  512

>SPRG_01255
Length=566

 Score = 305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 200/500 (40%), Positives = 288/500 (58%), Gaps = 24/500 (5%)

Query  10   SVGIDLGTTYSCVGVWQ--NDRVEII---ANDQGNRTTPSYVAFTDT-ERLIGDAAKNQV  63
             +GIDLGTT SCVG W+   + V+I+   A D   +T PS V+F  T    +G AA    
Sbjct  24   CIGIDLGTTNSCVGYWKLHANHVKIVNHSAGDTKAKTLPSVVSFPPTGAPAVGFAAVAAE  83

Query  64   AMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  122
            A +A   TV  AKRL+G+  +D     D K+  + L  G  +   +++       +  P 
Sbjct  84   ASDADVVTVRSAKRLLGQSLAD--ASPDQKYLSYTLCDG--ESGHVSIALPARKTSVTPS  139

Query  123  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  182
            E+++++L K++  AEA + + + N V+TVPAYF + QRQAT +A A+AG + +R++NEPT
Sbjct  140  EVAALLLSKLKAAAEAKLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPT  199

Query  183  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            AAA+AYGL   G +R V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N L 
Sbjct  200  AAAMAYGLFVAGTKR-VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNILF  258

Query  243  DHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  301
            DH  Q   +KH    +      + +L+ A E AK  LS+  +  + + ++        T+
Sbjct  259  DHVLQAIAKKHGPVSLPLATHDMVQLQRAVEAAKVALSTDDETVLRLTNVGHVALHEMTL  318

Query  302  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK  361
            TR + + +C   ++K +    +VL+   +  S V EVVLVGGSTRIP ++  L  FFN K
Sbjct  319  TRRKLDALCDPLYKKCLRITREVLKSIDVDPSDVDEVVLVGGSTRIPAIRARLRAFFNDK  378

Query  362  EPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIAR  421
            E   S+N DE VA GA +QAAIL G       QD+L+LDV P+S+G+E A G M  LI +
Sbjct  379  ELCTSVNADEVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIQK  437

Query  422  NTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR------G  475
            N+ +P    + F T  D+Q G  I+VFEGE  + R+N  L  F+      +PR      G
Sbjct  438  NSRIPVSVTKYFDTAIDDQAGFTIEVFEGESPVARENTYLTYFDF----VLPRKVRGKAG  493

Query  476  VPQIDVTFDIDANGILNVSA  495
              Q  VT  ++ANG+L V A
Sbjct  494  AIQHPVTLSMNANGLLQVKA  513

>PYIW_17320
Length=563

 Score = 305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 198/500 (40%), Positives = 298/500 (60%), Gaps = 20/500 (4%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAF---TDTERLIGDAAKNQV  63
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS V F   ++    +G AA  Q 
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPSVVRFDPQSEHAYEVGHAAIAQE  82

Query  64   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  123
                 NT+   KRL+G+K++   V+       + +T+       + V    ++   QPEE
Sbjct  83   TQPVGNTIRSVKRLMGQKYTSKAVEVAKSFGTYTITATKQGGAAVQVVRANKTAVVQPEE  142

Query  124  ISSMVLIKMREVAEAFIG-KEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  182
            +++ +L  ++  AEA+   K + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPT
Sbjct  143  VAACILADLKASAEAYFDDKRIDNVVITVPAYFNDSQRKATLTSASMAGFKAVRLLNEPT  202

Query  183  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            AAA+AYGL    G + V++FD GGGT DVSL+SI +G FEV    GDT+LGGED +N + 
Sbjct  203  AAAMAYGL-FVAGTKMVVVFDFGGGTLDVSLMSISDGRFEVLGIGGDTNLGGEDLNNAIT  261

Query  243  DHFTQEFKRKH---RKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  299
            DH  +   + H   R  +T   + + +L+T  E+AK  LSS     IE+  +     F  
Sbjct  262  DHLIELLHKHHDVSRATLT--MQDMIQLKTQAEQAKIALSSDDSTEIELRDVAGIAKFKY  319

Query  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFN  359
            T+TR +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +S+FF+
Sbjct  320  TLTRHKFEQLGEAIWKKCLRIVHSVLKEAEVEVADVDEVVMVGGSTRIPLLRTKVSDFFD  379

Query  360  GKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLI  419
            GKE   S+N DE V  GA +QAAIL G       +D+L++DV PL +GLET  G M T+I
Sbjct  380  GKELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGRMETII  438

Query  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR----G  475
             +N+ +P    + F T+ DNQ G+ ++V+EGE  + ++N  +  FN   + P  +    G
Sbjct  439  PKNSRIPVSLTKYFQTFEDNQRGLTVEVYEGEHEVAKENDHICYFNF--VLPHDKVGKAG  496

Query  476  VPQIDVTFDIDANGILNVSA  495
                 VTF ++A+G+L V A
Sbjct  497  EFAHPVTFTMNASGVLQVQA  516

>PYIR_13638
Length=543

 Score = 303 bits (777),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 195/502 (39%), Positives = 291/502 (58%), Gaps = 44/502 (9%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAFTDTERLIGDAAKNQVAMN  66
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS     +T  +            
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPS----VETAPV------------  66

Query  67   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
              NT+   KRL+G+K++    +       +K+ +       + V    +  T +PEE+S+
Sbjct  67   -GNTIRSIKRLMGQKYTSKAAEVAKSFGTYKIAATKQGSAAVQVVRAQKLVTVEPEEVSA  125

Query  127  MVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
             +L  ++  AE +   K + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPTAAA
Sbjct  126  CILSDLKASAEVYFDNKRIDNVVITVPAYFNDSQRKATITSASMAGFKAIRLMNEPTAAA  185

Query  186  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            +AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N + DH 
Sbjct  186  MAYGL-FVAGTKMVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNNVITDHL  244

Query  246  TQEFKRKHRKDITDNQRA------LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  299
             +   + H     D  RA      + +L+T  E+AK  LSS   A IE+  +     F  
Sbjct  245  IELLHKHH-----DVPRAKLSMADMIQLKTQAEQAKIALSSDDSAEIELHDVAGVPKFKY  299

Query  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFN  359
            T+TR +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +SEFF+
Sbjct  300  TLTRHKFEQLGESIWKKCLRIVSSVLKEAEVEIADVDEVVMVGGSTRIPILRTKISEFFD  359

Query  360  GKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLI  419
            GKE   S+N DE V  GA +QAAIL G       +D+L++DV PL +GLET  G M  +I
Sbjct  360  GKELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGTMEVII  418

Query  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR-----  474
             +N+ +P    + F T+ DNQ G+ ++V+EGE+ + ++N  +  FN      +PR     
Sbjct  419  PKNSRIPVSLTKYFQTFEDNQRGLTVEVYEGEQKVAKENDHICYFNF----VLPRDKIGR  474

Query  475  -GVPQIDVTFDIDANGILNVSA  495
             G     VTF ++A+G+L V A
Sbjct  475  AGEFAHPVTFTMNASGVLQVQA  496

>CCI45261
Length=558

 Score = 303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 197/508 (39%), Positives = 304/508 (60%), Gaps = 37/508 (7%)

Query  10   SVGIDLGTTYSCVGVWQND--RVEIIANDQGNR---TTPSYVAFTDTERLIGDAAKNQVA  64
            ++GID GTT SCVG+W  D  RV+I+ +D   +     PS V +  T+  +    +  V 
Sbjct  24   AIGIDFGTTNSCVGIWLKDQSRVKILKHDFDTKRYYLLPSVVRYDPTDVSLVSVGQEAVR  83

Query  65   MNA----HNTVFDAKRLIGRKFSD---PIVQADIKHWPFKLTSGAGDKPQITVQFKGESK  117
            + A     NT+   KRL+G+++++     +Q+   H    +++  G+     +  K +  
Sbjct  84   LEATPPCKNTIRCVKRLMGQRYTNDRISYLQSSSTHQI--VSTKRGNVGICIITEKNDES  141

Query  118  TFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLR  176
              +PE++++ +L+K++  AEA+   K ++N V+TVPA+FND QR+AT  A ++AG   +R
Sbjct  142  IVEPEQVAACILLKLKAKAEAYFDHKIIENVVLTVPAHFNDGQRKATIRAASMAGFRKIR  201

Query  177  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGED  236
            ++NEPTAAA+AYGL    G + VL+FD GGGT DVSL+ I+EG F+V A  GDT+LGGED
Sbjct  202  LMNEPTAAAMAYGL-FIAGHKQVLVFDFGGGTLDVSLMRIDEGKFKVVAIGGDTNLGGED  260

Query  237  FDNRLVDHFTQEF-KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  295
             +  +  H    F KR   K   D Q A+++   + E AK  LS S +A +E+      +
Sbjct  261  INQIIYHHILCSFEKRGILKLTIDQQTAMKQ---SIEEAKIQLSDSMEATVELKVATRLL  317

Query  296  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  355
             +N  + R  FE +C   +++ +  +EKVL+DA L    V EVV+VGGSTRIPK++  +S
Sbjct  318  QYN--LRRDVFESICDSVWKRCISTIEKVLKDASLEPCDVDEVVMVGGSTRIPKLRSSIS  375

Query  356  EFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVM  415
            EFF+ KE   S+N D  V  GA +QAA+L G      LQD+L+LDV PLS+GLET  G M
Sbjct  376  EFFDKKELCDSVNADRVVCEGAAIQAAVLSG-MDRKTLQDVLMLDVIPLSMGLETVDGRM  434

Query  416  TTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRG  475
              ++++N+ +P +  + F T+ D+Q G+ + V+EGE S+ R+N  + +F+     P+P  
Sbjct  435  EIILSKNSQIPAEVTKYFQTFEDDQRGISVDVYEGENSIARENEHICRFDF----PIPS-  489

Query  476  VPQID--------VTFDIDANGILNVSA  495
              +ID        VTF ++ NG+L VSA
Sbjct  490  -LKIDKAGRIFHPVTFKMNENGVLQVSA  516

>PHALS_12790
Length=214

 Score = 281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)

Query  454  MTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  513
            MTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  514  RLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKK  573
            RLSQ+DIDRMV+EAEKYKSEDEANKVRIEAKN LENYAY+LRN+LNDEKLK Q+ + DKK
Sbjct  61   RLSQADIDRMVSEAEKYKSEDEANKVRIEAKNGLENYAYNLRNTLNDEKLKGQLSDDDKK  120

Query  574  VVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANPILQKMY  616
             +DDKVTETI WLDA+QSAE EE+E KQKELEGVANPILQKMY
Sbjct  121  AIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMY  163

>H257_01680
Length=571

 Score = 292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 197/518 (38%), Positives = 291/518 (56%), Gaps = 29/518 (6%)

Query  10   SVGIDLGTTYSCVGVWQN--DRVEII---ANDQGNRTTPSYVAF-TDTERLIG-DAAKNQ  62
             +GIDLGTT SCVG W+   +  +II   A D  ++T PS V+F +     +G DA +++
Sbjct  21   CIGIDLGTTNSCVGYWKEGANHAKIINHTATDGKHKTVPSVVSFPSQGNPFVGFDAVEHE  80

Query  63   VAMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  121
                    T+  AKRL+G+  ++  +  + K+  + L    G    + +    +     P
Sbjct  81   QKYEPDTVTIRSAKRLMGKTLAE--MADEQKYLSYTLCDADG---HVAIDLPSKESIATP  135

Query  122  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  181
             E+S+++L  +++ AE  +G +V N V+TVPAYFN+SQRQ+T  A  +AG   +R++NEP
Sbjct  136  SEVSAILLKYIKDTAEDKLGHQVFNCVLTVPAYFNESQRQSTLKAATMAGFQGIRLLNEP  195

Query  182  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            TAAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    GDTHLGGED ++ L
Sbjct  196  TAAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGTFAVDGVGGDTHLGGEDINHLL  254

Query  242  VDHF----TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  297
            VD      +QE        +   + A+ +L+ A E AK TLS+     I +  +      
Sbjct  255  VDFMLDSISQEQNGGKPLPLPLTRTAIIQLQQAAEHAKVTLSTQKDVSIYLKDVGGIKAH  314

Query  298  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEF  357
               ++RA+ E +C     + ++    VL    L+   + EVVLVGGSTRIP ++  LS+ 
Sbjct  315  KMKLSRAKLESLCAPLLTRCVDITRDVLASIGLTPQDIDEVVLVGGSTRIPALRTKLSDL  374

Query  358  FNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTT  417
            F+GK    S+N DE VA GA +QAAIL G       QD+L++DV PLS+G+E A G M  
Sbjct  375  FDGKVLCTSVNADEVVASGAAIQAAILSG-VDKRVFQDVLMMDVIPLSIGIEMADGRMEV  433

Query  418  LIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR---  474
            LI +N+ +P    ++F TY D+Q G+ ++VFEG+  + RDN  L  FN      +PR   
Sbjct  434  LIPKNSRIPISVTKSFDTYEDHQKGITVEVFEGDHPVARDNVYLTYFNF----TLPRHKL  489

Query  475  ---GVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  509
               G  Q  VT  ++ NG+L V A  +    EN+  ++
Sbjct  490  GKAGEFQHAVTLSMNENGVLQVKAGAQHEIDENEAAVS  527

>PYVX_13615
Length=585

 Score = 292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 204/535 (38%), Positives = 302/535 (56%), Gaps = 51/535 (10%)

Query  3    QAKTSGYSVGIDLGTTYSC---VGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTER  53
            Q       VGIDLGTT SC   VG+W+ +R  V+I+ N  D+G RTTPS V F     + 
Sbjct  14   QFAAGARCVGIDLGTTNSCATRVGIWKTERNHVKILKNRRDRG-RTTPSVVRFGPESDQV  72

Query  54   LIG-DAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQF  112
            L+G +A  +++     NTV   KRL+G+ F    V+   K   FKL         I++  
Sbjct  73   LVGNEAIAHELEDPVGNTVRAVKRLMGQPFESKAVEVATKFAAFKLEPTKQGNTAISIDR  132

Query  113  KG-ESKTFQPEEISSMVLIKMREVAEAFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIA  170
             G ++ T  PE++S+ VL +++  AEA+   E + + VITVPAYFNDSQR+AT +A   A
Sbjct  133  SGSKTDTVLPEDVSAAVLSELKASAEAYYQDESIDHVVITVPAYFNDSQRRATLEAATSA  192

Query  171  GLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDT  230
            G + +R++NEPTAAA+AYGL    G + V++FD GGGT DVSL+ I++G FEV    GDT
Sbjct  193  GFSAVRLLNEPTAAAMAYGL-FLAGTKLVVVFDFGGGTLDVSLMQIQDGKFEVLGIGGDT  251

Query  231  HLGGEDFDNRLVDHFTQEFKRK---HRKDITDNQRALRRLRTACERAKRTLSSSAQAYIE  287
            +LGGED ++ L+DH  + F +    HR+ +      + +L+   E+AK  LS+   A +E
Sbjct  252  NLGGEDINHLLLDHVLEMFDKHFGVHREQLRPED--MVKLKREVEKAKIELSTEESAVVE  309

Query  288  I-DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  346
            +  +         T+ R +FE +C   +++ +  V  VL++A+   +++ EV+LVGGSTR
Sbjct  310  LRGAAGSSKTMTVTLHRRKFELLCESIWKRCLRIVSNVLKEAEADVTEIDEVILVGGSTR  369

Query  347  IPKVQQLLSEFFNGK--------------------EPNKSINPDEAVAYGATVQAAILGG  386
            IP V+  LSEFFN K                    E   S+N DE V  GA +QAAIL G
Sbjct  370  IPVVRSRLSEFFNDKWMVCLTVRIRSTNGVSGVEQELCMSVNADEVVCEGAAIQAAILSG  429

Query  387  NdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQ  446
                   +D+L++DV PL +GLETA G M  L+ +N+ +P    + F T+ D Q G+ ++
Sbjct  430  -MDHKVFRDVLMMDVIPLPIGLETADGAMEVLLPKNSRIPVSLTKYFETFEDGQRGLTVE  488

Query  447  VFEGERSMTRDNHLLGKFNLDAIPPMPR------GVPQIDVTFDIDANGILNVSA  495
            V+EGE ++ + N  +  FN      +PR      G  +  VTF +  +G+L V A
Sbjct  489  VYEGEHAVAKQNDHICYFNF----ALPRDKIGKAGEFRHPVTFTMTPSGVLQVQA  539

>SDRG_01068
Length=621

 Score = 293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 201/619 (32%), Positives = 308/619 (50%), Gaps = 28/619 (5%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQ-GNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  69
            + ID+GT+   VGVW+NDRVE++A D  G    P+YVAFTD  RL+G  AK   A +A N
Sbjct  5    IAIDIGTSNLRVGVWRNDRVELLALDSDGATALPAYVAFTDAGRLVGRRAKAYAATDAAN  64

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
             VF   R +GR   D  V+AD    PF++ + + DKPQ+ V   G+  TF  EE    VL
Sbjct  65   VVFRMTRFLGRSMRDRGVRADCDKVPFQVVASSDDKPQVRVTLNGQPSTFDLEE----VL  120

Query  130  IKMREVAEAFIGKE--VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
              + E  +A + ++  V    +TVPA F  +QR A  DA AIAGLNV +++N PTAA + 
Sbjct  121  ATLLEHTKAMVDEQLTVGYVTLTVPAAFTTTQRHAVLDAAAIAGLNVRKLLNAPTAALVT  180

Query  188  YG--LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            Y     +   ER VL    G G+  V++   E  +    AT+G+ HLGG D D RLV H 
Sbjct  181  YMNMHPRMREERTVLTVTAGAGSLGVAITVDESALSTAVATSGNAHLGGLDIDERLVRHC  240

Query  246  TQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  305
               F+R    D+  + R L+RLRTACE AK  LS++    +E+  L    D    ++R +
Sbjct  241  IAAFERTIGCDVRLSPRGLQRLRTACEEAKIALSTATTTTVEVPRLSGENDLVVVVSRDQ  300

Query  306  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNK  365
               +  +   +    V K L+ AKL K+ + ++VL GG  R+P ++  L + F+G+    
Sbjct  301  LNQLAREMMAQLTALVVKALQTAKLDKNNIDDIVLAGGLVRMPLLKTTLVDLFHGQRVRL  360

Query  366  SINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTV  425
              NPDEA+  GAT+  A    N +       +L      +             +AR  T 
Sbjct  361  VGNPDEAIVTGATLYTA----NATLRATGRDVLACQCLPTPFWVATEARHPQYLARGATD  416

Query  426  PTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQ---IDVT  482
                 +   T   NQP + + V+EG       +HL GK+    + P+P G+P+   + V 
Sbjct  417  YFSTTEDMFTTQANQPDITLLVYEGLLGQRDTSHLQGKWR---VGPLPNGIPRGATVQVG  473

Query  483  FDI-DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRI  541
            F I  A G L +SA    T  +  I  TN+    ++  + R++ EA   +  D    +  
Sbjct  474  FQICHATGTLQISA----TVDDKPIPATNELAPTTRGRMCRLIQEAATRRQVDGRQHIHA  529

Query  542  EAKNALE---NYAYSLRNSLNDEKL-KEQIPEADKKVVDDKVTETIQWLDAHQSAETEEY  597
                A      Y   LR + + + + + ++ E  +  +DD +   ++WL  H +A T EY
Sbjct  530  ARAAAKAAATEYTMRLREAWHGDAISRNRVSEVTRDELDDALALALKWLILHPNANTVEY  589

Query  598  ESKQKELEGVANPILQKMY  616
            E  + +LE V + +++ +Y
Sbjct  590  EVVRFKLEAVGSRVVEALY  608

>PHYRA_51904
Length=129

 Score = 275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%), Gaps = 0/129 (0%)

Query  5    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  64
            KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60

Query  65   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI
Sbjct  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120

Query  125  SSMVLIKMR  133
            SSMVLIKMR
Sbjct  121  SSMVLIKMR  129

>SDRG_16621
Length=531

 Score = 289 bits (739),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 189/488 (39%), Positives = 278/488 (57%), Gaps = 38/488 (8%)

Query  28   DRVEIIANDQGN---RTTPSYVAFTDTERLIGDAAKNQVAMNAHN------TVFDAKRLI  78
            + V+I+ +  G+   +T PS V+F  T    G  A   VA+ A        TV  AKRL+
Sbjct  3    NHVKIVNHSTGDAKAKTLPSVVSFPST----GAPAVGFVAVAAEASDADVVTVRSAKRLL  58

Query  79   GRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEA  138
            G+  +D +   D K+  +KL  G  +   +++       +  P E+++++L ++++ AEA
Sbjct  59   GQSLADAL--PDQKYLSYKLCEG--ESGHVSIALPARKTSVTPSEVAALLLSELKKAAEA  114

Query  139  FIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERN  198
             + + + N V+TVPAYF + QRQAT +A A+AG + +R++NEPTAAA+AYGL   G +R 
Sbjct  115  KLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPTAAAMAYGLFVAGTKR-  173

Query  199  VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKH-----  253
            V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N + DH  Q   +KH     
Sbjct  174  VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNIVFDHVLQSIAKKHGPLAL  233

Query  254  ---RKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMC  310
                 D+   QRA+       E AK  LS+  +  + + ++        T+TR + + +C
Sbjct  234  PLATPDMVQLQRAV-------EAAKIALSTDDETVLRLTNVGHVALHEMTLTRRKLDALC  286

Query  311  GDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPD  370
               F+K +    +VL+   +  S V+EVVLVGGSTRIP ++  L  FFN KE   S+N D
Sbjct  287  DPLFKKCLRITREVLKAIDVDPSDVNEVVLVGGSTRIPAIRARLRAFFNDKELCTSVNAD  346

Query  371  EAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKA  430
            E VA GA +QAAIL G       QD+L+LDV P+S+G+E A G M  LI +N+ +P    
Sbjct  347  EVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIPKNSRIPVSVT  405

Query  431  QTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVP---QIDVTFDIDA  487
            + F T  D+Q G  I+VFEGE  + R+N  L  F+   +P   RG     Q  VT  ++A
Sbjct  406  KYFDTAVDDQAGFTIEVFEGESPVARENTYLTYFDF-VLPRKTRGKAGSIQHPVTLSMNA  464

Query  488  NGILNVSA  495
            NG+L V A
Sbjct  465  NGLLQVKA  472

>PYAP_19903
Length=527

 Score = 288 bits (738),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 194/502 (39%), Positives = 292/502 (58%), Gaps = 21/502 (4%)

Query  24   VWQNDR--VEIIAN-DQGNRTTPSYVAFT--DTERLIGDAAKNQVAMNAHNTVFDAKRLI  78
            +W  +R  V+I+ N D   RTTPS V F     E ++G+AA  +      NTV   KRL+
Sbjct  1    MWHVERNHVKILKNRDDRGRTTPSVVHFKPDSQEVVVGNAAIAREYDPPGNTVRTIKRLM  60

Query  79   GRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQPEEISSMVLIKMREVAE  137
            G++F    V+   +     +         ++V+  G+     QPEE+SS VL++++  AE
Sbjct  61   GQRFDSDAVRVAKRFATHSIVETKQGNAAVSVKRSGQDAVDVQPEEVSSHVLMELKASAE  120

Query  138  AFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  196
            A+   E V N VITVPAYFNDSQR+AT  +  +AG   +R++NEPTAAA+AYGL    G+
Sbjct  121  AYWDDERVDNVVITVPAYFNDSQRKATILSAQMAGFKAIRLLNEPTAAAMAYGL-FLSGQ  179

Query  197  RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKD  256
            ++V++FD GGGT DVSLLSI +G FEV    GDT+LGGED ++ +V H      ++H   
Sbjct  180  KHVVVFDFGGGTLDVSLLSINDGRFEVLGIGGDTNLGGEDINDLVVGHVVDMLHQQHGLT  239

Query  257  ITDNQRA-LRRLRTACERAKRTLSSSAQAYIEIDSLFDGID-FNSTITRARFEDMCGDYF  314
              D  R+ L +++   E+AK  LSS     IE+  +      +   +TR  FE +C   +
Sbjct  240  RNDLSRSDLIQIKRETEKAKVELSSEESIAIELKGIGKKKQAYKIKLTRPAFEKICASIW  299

Query  315  RKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVA  374
             + +  V  VL +A +  S + EV++VGGSTRIP V+  +SEFF+ KE   S+N DE V 
Sbjct  300  SRCLVIVTDVLEEAGVHTSDIDEVIMVGGSTRIPIVRAKVSEFFDNKELCLSVNADEVVC  359

Query  375  YGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFS  434
             GA +QAAIL G       +D+L++DV PL +GLE A G M  L+ +N+ +P    + F 
Sbjct  360  EGAAIQAAILSG-LDKRIFRDVLMMDVLPLPIGLEKADGEMEILLPKNSRIPVTMTKYFE  418

Query  435  TYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPR------GVPQIDVTFDIDAN  488
            T+ D+Q G+ +QV+EGE ++ ++N  +  FN     P+PR      G  +  VTF ++A+
Sbjct  419  TFEDDQRGLTVQVYEGENAVAQENDHICDFNF----PIPRDKIGKAGEFKHPVTFTMNAS  474

Query  489  GILNVSAVEKSTGKENKITITN  510
            G+L V+A      +E  +++T+
Sbjct  475  GVLQVTAGIHHDSEETPMSLTS  496

>CCA22305
Length=561

 Score = 288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 189/510 (37%), Positives = 301/510 (59%), Gaps = 38/510 (7%)

Query  10   SVGIDLGTTYSCVGVWQND--RVEIIAN---DQGNRTTPSYVAFTDTERLIGDAAKNQVA  64
            ++GID GTT SCVGVW  D  RV+I  +    + +   PS V +   +  +    K  + 
Sbjct  24   AIGIDFGTTNSCVGVWLKDQNRVKIFKHGIETKWSHLLPSVVRYDPVDISLVLVGKEAIE  83

Query  65   MN----AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES----  116
            +       NT+   KRL+G+K+ +  +        +++ S    +    +Q  G+     
Sbjct  84   LESKPPCKNTIRCVKRLMGQKYVNDRIAYLQSSSIYEIVST--QRGNAAIQIDGDHGDDK  141

Query  117  -KTFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNV  174
              + +PEE+++ +LIK++  AEA+   K ++N V+TVPA+FND QR+AT  A ++AG   
Sbjct  142  RTSVEPEEVAAHILIKLKARAEAYFDHKAIENVVLTVPAHFNDGQRKATIRAASMAGFKK  201

Query  175  LRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGG  234
            +R++NEPTAAA+AYGL    G++ VL+FD GGGT DVSL+ I EG F V A  GDT+LGG
Sbjct  202  IRLLNEPTAAAMAYGL-FIAGKKQVLVFDFGGGTLDVSLMQIHEGRFRVVAIGGDTNLGG  260

Query  235  EDFDNRLVDHFTQEFKRKHR-KDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  293
            ED +  ++DH  Q F+ K     +T +Q+A   ++ + E+AK  LS++ +A I+ +    
Sbjct  261  EDINQMIIDHILQSFEEKEGILQLTIDQKA--AMKQSIEQAKIQLSNAMEAVIKFEHKTT  318

Query  294  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  353
               +   ++R  FE +C   + + +  ++ VL+DA +    V EVV+VGGSTRIPK++  
Sbjct  319  WRQY--ALSRDVFESICDSVWTRCISTIQGVLQDASVDPCDVDEVVMVGGSTRIPKLRSK  376

Query  354  LSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGG  413
            +SE F+ K   +S+N D+ V  GA +QAA+L G      LQD+L+LDV PLS+GLETA G
Sbjct  377  ISEVFDNKALCESVNADQVVCEGAAIQAAVLSG-MDRKVLQDVLMLDVIPLSMGLETADG  435

Query  414  VMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMP  473
             M  ++ +N+ +P +  + F T+ D+Q G+ + V+EGE  + R+N  + +F+     P+P
Sbjct  436  RMEVILPKNSQIPAQVTKYFQTFEDDQRGISVDVYEGEHPIARENEHICRFDF----PIP  491

Query  474  RGVPQID--------VTFDIDANGILNVSA  495
                +ID        VTF ++ NG+L+V+A
Sbjct  492  --TSKIDTAGRIFHPVTFRMNENGVLHVTA  519

>HYAP_01857
Length=492

 Score = 285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 190/467 (41%), Positives = 268/467 (57%), Gaps = 23/467 (5%)

Query  43   PSYVAFTDTERLI--GDAA-KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLT  99
            PS V F    + +  GDAA + +      NT+   KRL+G+KF    V     +  + + 
Sbjct  2    PSVVHFDPQSQHVDVGDAAVEFETEPPVGNTIRSIKRLLGQKFVSKAVDVARIYASYSVV  61

Query  100  SGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKE--VKNAVITVPAYFND  157
              A     + V   G+    QPEE+ + VL +++  AEA+   +  + N VITVPAYF+D
Sbjct  62   PTAQGNVVLQVVRGGKRVQVQPEEVVASVLAELKASAEAYFDGQLSIDNVVITVPAYFSD  121

Query  158  SQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIE  217
            SQR+AT  + ++AG   +R++NEPTAAA+AYGL    G++ V +FD GGGT DVSLL IE
Sbjct  122  SQRKATLTSASMAGFKAVRLLNEPTAAAMAYGL-FLSGKKLVTVFDFGGGTLDVSLLRIE  180

Query  218  EGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKH---RKDITDNQRALRRLRTACERA  274
            +G FEV    GDT+LGG+D DN LVDH  +   R H   R  + D    + RL+   E A
Sbjct  181  DGKFEVLGIGGDTNLGGDDIDNVLVDHLIEMLDRHHNLTRAQVGDEN--MVRLKREVENA  238

Query  275  KRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQ  334
            K  LS    A + +D + +      T+TR + E++CG   +K +  V  VL +AK+  S 
Sbjct  239  KIKLSEEEHAVVTVD-MANVPRITYTLTRRKLEELCGPIRKKCLRIVSSVLEEAKVESSN  297

Query  335  VHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklq  394
            V EV+LVGGSTRIP ++Q +SE F GKE   S+N DE V  GA +QAAIL G       +
Sbjct  298  VDEVILVGGSTRIPILRQQISEAFGGKELCMSVNADEVVCEGAAIQAAILCG-VDQRVFR  356

Query  395  dlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSM  454
            D+L++DV PL +GLETA G M  ++ +N  +PT   + F TY DNQ G+ ++V+EGE  +
Sbjct  357  DVLMMDVLPLPIGLETADGSMEVILPKNARIPTTMTKYFQTYEDNQRGLTVEVYEGENKI  416

Query  455  TRDNHLLGKFNLDAIPPMPR------GVPQIDVTFDIDANGILNVSA  495
             ++   +  FN      +PR      G     VTF ++ANGIL V A
Sbjct  417  AKECDHICYFNF----VLPRDKIGKAGEFAHPVTFTMNANGILQVRA  459

>SPRG_00183
Length=609

 Score = 286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 191/609 (31%), Positives = 310/609 (51%), Gaps = 18/609 (3%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  68
            + + ID+G +   VGVW+N R  ++A D  N   P+ VAFTDT  L G+ AK     +  
Sbjct  6    HCIAIDIGASTIRVGVWRNGRATVLALDGAN-GLPAVVAFTDTTTLFGNQAKAIAQNDPT  64

Query  69   NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
            N VF+   L+GR+ +DP VQA +   PF++ + +   P I VQ +  + T+ P+EI  M+
Sbjct  65   NVVFNVLHLLGRRMNDPTVQAMVTSAPFRIIASSDKTPLIHVQHRRSACTYYPQEIVGML  124

Query  129  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  188
            L   +++AE  +G  + +AV+TVPA +  SQRQA  DA  +AGL V R+++  TA  IA+
Sbjct  125  LEHAKKLAEDHLGACLDHAVVTVPATYTTSQRQAVLDAATMAGLTVDRLLSATTAVGIAH  184

Query  189  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
                   +R +L+ D G  +   S+++ E   F   A+A DT LGG   D RL  H    
Sbjct  185  TQATGASKRKLLVVDAGASSVTASVVTAEHDTFTAHASASDTQLGGFAMDARLAAHCMST  244

Query  249  FKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLF-DGIDFNSTITRARFE  307
            +    R    D   A +RL +ACE A+  LS+S +  + I     DG+    T++R +  
Sbjct  245  WTPSTRGH--DLILAKQRLLSACEAARCALSTSDETDVCIPHRSQDGMRL--TLSREKLN  300

Query  308  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSI  367
             +      K +  V KVL+ A+  K  V ++VLVGG   +P +Q  LS  F GK+     
Sbjct  301  ALVHHLMDKVVAHVLKVLQQAQCCKEDVDDIVLVGGVALMPCLQTTLSNLFGGKQVAWFP  360

Query  368  NPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPT  427
             P EAV  GA +   I     SSD       +     +     A G   T + R+  + +
Sbjct  361  TPSEAVVAGAALY--IASTTASSDATVRPFAIHDALSTPIWAAAAGHHWTTVFRSPALSS  418

Query  428  KKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDID-  486
                TF +   + P VL+ V+EG+      +HL G+++++++P        IDV F +D 
Sbjct  419  MATHTFVSTG-SSPFVLL-VYEGDVGFPASSHLQGQWHIESLP----HTRFIDVAFVVDE  472

Query  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNA  546
              G+L V+A +KS+ K   + +TN     S+ ++  + A+A           +   AK A
Sbjct  473  CTGVLRVTASDKSSQK--ALPVTNTDCATSRRELQHLCAQATARYHTTRQTVLLARAKAA  530

Query  547  LENYAYSLRNSLN-DEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
              ++ YSLR++ + DE  + ++ +A +  +DD +   I+WL  H  A  ++Y+  + +LE
Sbjct  531  ANDFTYSLRSTWHSDEASRRRVGDAARDELDDALAAAIKWLLLHPQATIDQYDDVRVQLE  590

Query  606  GVANPILQK  614
             V+  +L +
Sbjct  591  AVSRRVLAR  599

>PHALS_00667
Length=142

 Score = 270 bits (690),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 138/142 (97%), Gaps = 0/142 (0%)

Query  454  MTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  513
            MTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  514  RLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKK  573
            RLSQ++IDRMVAEA+KYKSEDEANKVR+EAKNALENYAYSLRNSLN+EK+KE IP+ADKK
Sbjct  61   RLSQAEIDRMVAEADKYKSEDEANKVRVEAKNALENYAYSLRNSLNEEKMKESIPKADKK  120

Query  574  VVDDKVTETIQWLDAHQSAETE  595
            VVDDKVTE IQWLDAHQS+E E
Sbjct  121  VVDDKVTEVIQWLDAHQSSEKE  142

>PHYSO_525236
Length=246

 Score = 262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 162/227 (71%), Gaps = 4/227 (2%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
            MA   T G S+GID+GT YS V +W  DR EI+ N  GNR T SYVAFTD++ L+GDAA 
Sbjct  1    MANKTTGGPSIGIDIGTAYSRVAIWHKDRAEILPNRFGNRLTSSYVAFTDSKVLVGDAAA  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGD----KPQITVQFKGES  116
            +Q   NA NTVF   RL+GRKFSDP VQ  IKHWPFK+  G  D     P + VQF+G++
Sbjct  61   DQRLQNAENTVFGITRLLGRKFSDPEVQERIKHWPFKVIRGPHDTPPPPPHVMVQFRGQT  120

Query  117  KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLR  176
            K F P +I S++L +MR + E + GKE   AV+TVPA+FN SQRQA KDAGAIA + V+R
Sbjct  121  KIFHPVQILSLLLSEMRGIVETYTGKEATTAVVTVPAHFNYSQRQAVKDAGAIAEIQVMR  180

Query  177  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  223
            +I+  TAA+I+YG++KKG ER VL+ DLG  T DVS++ IE+G FEV
Sbjct  181  MISRSTAASISYGINKKGSERRVLVVDLGASTLDVSVVEIEDGNFEV  227

>SPRG_00182
Length=615

 Score = 270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 193/618 (31%), Positives = 310/618 (50%), Gaps = 36/618 (6%)

Query  13   IDLGTTYSCVGVWQNDRVEIIAND-QGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  71
            +D+GT+   VGV +N+RVE++A D  G    P+YVAFTD+ RL G  AK   A    N +
Sbjct  7    LDIGTSSLRVGVKRNNRVELLALDGDGATAMPAYVAFTDSGRLFGRRAKAYAASAPENVI  66

Query  72   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F   R +G    D  V+AD    PF++ + + DKPQ+ V   G+  TF  EE+ +M+L  
Sbjct  67   FRMLRFLGGSMRDLNVRADCDKVPFRVVASSDDKPQVRVTVNGQPSTFDLEEVMAMLL--  124

Query  132  MREVAEAFIGKE--VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
              E  +A + ++  V++  +TVPA F  +QR+A  DA AIAGL V +++N PTAA +AY 
Sbjct  125  --EHTKAMVDEQLAVRHVTLTVPASFTTTQRRAVLDAAAIAGLTVRKLLNAPTAALVAYM  182

Query  190  L---DKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  246
                 +   +R V+    G G+  V++      +    AT G+ HLGG + D RLV H  
Sbjct  183  ATHPSRMHQDRTVVTVTAGAGSLGVAITIDSNDVSTAVATTGNAHLGGIEIDERLVRHCI  242

Query  247  QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  306
              F+R   +D+  + R L+RLRTACE AK  LS++    IE+  L    D    ++R + 
Sbjct  243  AAFERTIGRDVHLSPRGLQRLRTACEDAKIALSTATTTTIEVPRLSGENDLVVCVSRDQL  302

Query  307  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKS  366
              +  D   +    V + LR AK+ K+ V  +VL GG  R+P +Q  L + F+G+     
Sbjct  303  NALARDVMTQLTALVVEALRMAKMEKANVDAIVLAGGLGRMPLLQTTLVDLFHGQRVRLI  362

Query  367  INPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
             NP EA+  GAT+      G+  + +         T                + R +T  
Sbjct  363  GNPSEAIVTGATLYTP--DGDVLALQSLPTPFWVATEARHPE---------YLLRGSTEY  411

Query  427  TKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQ---IDVTF  483
                + F T  + Q  + + V+EG       +HL GK+    + P+P+ +P+   + V+F
Sbjct  412  FSTTEDFYTTQNKQSDITLLVYEGLVGQRETSHLQGKWR---VGPLPKSIPRGASVQVSF  468

Query  484  DI-DANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEA---NKV  539
             I DA G L+VSA     GKE  I   N+    ++  + R++ EA   +  D     N  
Sbjct  469  QILDATGTLDVSATVD--GKE--IPTANELAPTTRGRMRRLIEEAATRRRVDGGQVVNAA  524

Query  540  RIEAKNALENYAYSLRNSLNDEKL-KEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYE  598
            R  AK A   Y   LR + + + + + ++ EA +  +DD +   ++WL  + +A   EY 
Sbjct  525  RAAAKAATTEYTMRLREAWHGDAVSRNRVSEATRDELDDALAVALKWLILNPNATIVEYN  584

Query  599  SKQKELEGVANPILQKMY  616
            + + +LE V + +++ ++
Sbjct  585  AVRFQLEAVGSRVIEGLW  602

>H257_16775
Length=291

 Score = 257 bits (657),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 152/248 (61%), Positives = 175/248 (71%), Gaps = 47/248 (19%)

Query  369  PDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  428
            PDEAVA+GATVQAAIL GNDSSD+LQD                   +  L     ++  K
Sbjct  56   PDEAVAFGATVQAAILSGNDSSDRLQD-------------------LLFLHVTPLSLGLK  96

Query  429  KAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDAN  488
            +  TFST  DNQPG LIQVFEGERSMTRDN+LLGKF+ D IPPM RGVPQ+DVTFDIDAN
Sbjct  97   QPATFST--DNQPGALIQVFEGERSMTRDNNLLGKFSFDGIPPMHRGVPQVDVTFDIDAN  154

Query  489  GILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALE  548
            GILNVS +EKSTGKE  ITITN KGRLS+ DI                    IE  N LE
Sbjct  155  GILNVSTIEKSTGKE--ITITNAKGRLSKDDI--------------------IERMNGLE  192

Query  549  NYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVA  608
            NYAY+LRN+LN EKL+ ++ EADKKV++DKVTETI+WLDA +    EEYE+KQKELEGVA
Sbjct  193  NYAYNLRNTLNVEKLQGKLDEADKKVMEDKVTETIKWLDATK----EEYEAKQKELEGVA  248

Query  609  NPILQKMY  616
            NPI+QK+Y
Sbjct  249  NPIMQKLY  256

>SDRG_01067
Length=611

 Score = 264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 189/612 (31%), Positives = 305/612 (50%), Gaps = 26/612 (4%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  68
            + V ID+GT+   VGVW+N RV ++A D G  + P+ VAFTDT  L G  AK     +  
Sbjct  6    HCVAIDIGTSRVRVGVWRNGRVHVLALD-GAESLPAVVAFTDTLTLFGHQAKAYAQDHPT  64

Query  69   NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
            N V +A +L+GR+ +DPIVQA +   PF++ + +   P I VQ +  + T+ P+EI +M+
Sbjct  65   NVVSNALQLLGRRMNDPIVQAAVAGAPFRIRASSDKTPLICVQHQRSACTYYPQEIIAML  124

Query  129  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  188
            L  +R  AE  +G  + +AV+TVPA +  SQRQA  DA  +AG  V R+++  TAAAIA 
Sbjct  125  LEHVRTSAECHLGSCLDHAVVTVPATYTTSQRQAIVDAATMAGWTVDRLLSATTAAAIAQ  184

Query  189  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  248
                   +R +L+ D G      S+++ E   F   A+A D H+ G   D RL  +    
Sbjct  185  VHATGADKRRLLVVDAGASAVTASVVTAEYDTFTAHASASDMHVSGSAMDARLAAYCMSS  244

Query  249  FKRKHRKDITDNQRAL-----RRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  303
            +    R  I  N  A      +RL +ACE A+  LS++ +  + I  L+   D   +++R
Sbjct  245  W----RPSIIGNDFAFSASTKQRLLSACEAARCALSTTNETQLCIPRLYRDEDVALSLSR  300

Query  304  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEP  363
             + + +      K +  V KVL+ AK  K  V ++VLVGG   +P +Q  LS  F GK  
Sbjct  301  EKLDALVDHLMDKVVVLVRKVLQQAKCVKDDVEDIVLVGGVASMPYLQSTLSNVFCGKTV  360

Query  364  NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNT  423
                 P  AV  GA +  A    +  S      +   +         AG    T+     
Sbjct  361  ACLATP--AVVAGAALYVASTTASSDSVVRPIAIHDALLTPIWAA-AAGHHWRTVF----  413

Query  424  TVPTKKAQTFSTYADNQPG-VLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVT  482
             VP        T+  N  G  ++ ++EG+   +  +HL G+++++ +    R    IDV 
Sbjct  414  NVPVLSGTATHTFQSNGSGPFVLLMYEGDVGFSDSSHLQGRWHIETL----RSTRFIDVA  469

Query  483  FDID-ANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRI  541
            F ID   G+L V+A +KST  +  +++ N     S+  +  + A+A           +  
Sbjct  470  FVIDEGTGVLRVAAFDKST--QEGLSVVNSDSATSRRKLQHLCAQAMARHHIARQKVLLA  527

Query  542  EAKNALENYAYSLRNSLN-DEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600
             AK A  ++ YSLR++ + DE  + ++ +  +  +DD +   I+WL  + +A  EEY+  
Sbjct  528  RAKAAANDFTYSLRSTWHSDEASRHRVGDPSRDELDDALAAAIKWLLLNPNATIEEYDDV  587

Query  601  QKELEGVANPIL  612
            + +LE V+  +L
Sbjct  588  RVQLETVSRRVL  599

>SPRG_06720
Length=425

 Score = 243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 147/391 (38%), Positives = 210/391 (54%), Gaps = 23/391 (6%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  67
            +SVGIDLGTTYS V V Q D V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  31   HSVGIDLGTTYSVVAVNQKDNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  90

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGE-SKTFQPEEISS  126
             +T+F+AKR IGR F   +   +  H+ F L      +    +   G  ++   P ++ +
Sbjct  91   RHTIFNAKRFIGRAFDATVETEEAPHYEFGLGRDEAHRVCFPLSVTGHATRCVSPVDVGA  150

Query  127  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
             ++ +++  A  ++G  ++ +AVI VPA F+  QR AT  A   AGL V  ++ EPTAAA
Sbjct  151  HIVSQLKTSAMRYLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  210

Query  186  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  211  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  270

Query  246  TQEFKRKHRKDITDNQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  288
               F+             L R             +R   E+ KR L    S++A   IE 
Sbjct  271  VARFEELLATPALPPLSTLARTSDESAFPCTVSGMRGVAEKLKRDLSALPSAAASCVIEA  330

Query  289  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  346
             +        +T+  TR  +E +      +T+ P+  +L    ++ + + EVVLVGGS+R
Sbjct  331  STAQHAAGSLATVEMTRQEWEALVAPMLSRTLTPIHDMLDGNGMAPTDIDEVVLVGGSSR  390

Query  347  IPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            IP +Q  L+  F G+EPN  I+PD AVA GA
Sbjct  391  IPWIQHALAALF-GREPNAHIDPDVAVAVGA  420

>PYVX_13288
Length=810

 Score = 253 bits (645),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 190/679 (28%), Positives = 316/679 (47%), Gaps = 84/679 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAISVARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    +     A     I +Q+  E  TF  E+I +MVL 
Sbjct  64   ATDIKRLIGRKFKHPEVQREIAQLAYPCVELANGDVGIVLQYNDEPVTFSCEQIVAMVLN  123

Query  131  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYAVLSCPGFYTDVQRRAVLNASKIAGVNCLRLLNEHTAVALAYG  183

Query  190  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            + K    RN         V+  D+G  ++ VS+++  +G  +VKA A D  LGG DFD  
Sbjct  184  IYKSA--RNLFHESEPQYVMFIDIGHASYTVSIIAFVQGKLQVKAAAYDRFLGGRDFDMA  241

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  298
            +      +F  K++ D   N ++  +L +ACE++K+ LS       ++ I+ L D  D++
Sbjct  242  IAKDAAAQFSAKYKTDPLANPKSRIKLLSACEKSKKNLSPYGVTATHLNIECLADDRDYS  301

Query  299  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFF  358
            + IT  +FE+M      +   P+E  L+DA + KSQ+  V ++GG TR+  V++ LSE  
Sbjct  302  AQITLEQFEEMIAPLLARLDAPIESALKDAGIDKSQLANVEIIGGGTRVASVKRHLSEVL  361

Query  359  N-GKEP-----NKSINPDEAVAYGATVQAAILGGNdssd------------------klq  394
               KE      + ++N DE+VA G  +Q AIL                            
Sbjct  362  GLDKEAQNYGLSTTLNADESVARGCALQCAILSPMFKVKEFSITDAVHLPIRVSWDGAAS  421

Query  395  dlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVF-EGERS  453
                       + +E +      +  R    P  K  TF     +Q   +  V+ E    
Sbjct  422  APTDAAENDEDVNMEASSDSSIVIFHRKDEYPKTKRITFRR---DQSFAIDAVYDESATP  478

Query  454  MTRDNHLL--GKFNLDAIPPMPRG--VPQIDVTFDIDANGILNV----------------  493
                ++L+  GKF +  +P + +   +P+I V    D NG+ +V                
Sbjct  479  YLPPDYLMSIGKFTVSGLPSLAKDAELPKIRVNVTQDINGLFSVASSQLMQEVKEEEKPA  538

Query  494  -------------SAVEKSTGKENK------ITITNDKGRLSQSDIDRMVAEAEKYKSED  534
                         +A +KS   + K      + +T + G L+ SD+     +  K   +D
Sbjct  539  EEEAKEGAEGDAKAAEDKSEQPKKKRFRKIELQVTAEVGGLTTSDVAAATEQELKMAQQD  598

Query  535  EANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAET  594
               +     +N LE++ Y +RN ++D +L   I  ++K  +++K+ E   WL   +  ++
Sbjct  599  RVIEETFNKRNELESFVYEMRNHVSD-RLANFITSSEKATLEEKLLEAEDWLYTDEGFDS  657

Query  595  EE--YESKQKELEGVANPI  611
             +  Y++K  +L  ++NP+
Sbjct  658  TKSVYQTKLDDLRKLSNPV  676

>PHYSO_249932
Length=232

 Score = 235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 154/212 (73%), Gaps = 13/212 (6%)

Query  151  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  210
            +P +FN SQRQA K+AGA+AGLNV+R I   TAA+I YG +K G  R +L+FD+GG   D
Sbjct  2    MPLHFNQSQRQAIKNAGALAGLNVVRSIAGSTAASIGYGFEKTG-LRAILVFDMGGSALD  60

Query  211  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTA  270
            +SL++I++ I+EV AT G  HLGG              FKR H KD+  N RA+ RLR+A
Sbjct  61   LSLVTIDDDIYEVLATLGVPHLGGV------------PFKRTHGKDLRTNSRAMVRLRSA  108

Query  271  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL  330
            CE+AKR +S+S +A IE++SL++GID NSTI+R RF D+C D F K +  V KVLRDAK 
Sbjct  109  CEQAKRAVSTSTEAQIELESLYEGIDLNSTISRPRFNDLCADLFDKALGAVSKVLRDAKK  168

Query  331  SKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKE  362
            SK++V E+VLVGGS RIP++QQLL +FFNGK+
Sbjct  169  SKTRVDEIVLVGGSPRIPRMQQLLEDFFNGKK  200

>H257_04453
Length=423

 Score = 239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 149/389 (38%), Positives = 217/389 (56%), Gaps = 22/389 (6%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V V ++  V ++ +  GN   PS VAF      L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDANGNLLLPSIVAFKPHGGVLVGRDARHHRRVDP  91

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQIT--VQFKGESKTFQPEEIS  125
             +T+ +AKR IGRKF D  ++AD   + F L         +   +   G      P +I 
Sbjct  92   KHTISNAKRFIGRKF-DATIEADASLYDFPLLGNTTGDHHVCFGLSVPGHPSCVSPVDIG  150

Query  126  SMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184
              V+  ++E A A++G  ++  AVI +PA F+ +QR+AT  A   AGL V  ++ EPTAA
Sbjct  151  YFVVKTLKETAMAYLGHDQIYGAVIAIPAGFDANQRKATVAAFERAGLKVRNVLVEPTAA  210

Query  185  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244
            A+AYGL  K    NVL+FD GGGT DVSLL +++G F+V  TAGD HLGGED D++L  H
Sbjct  211  ALAYGLHTKPNVHNVLVFDFGGGTLDVSLLYLQKGSFQVMDTAGDNHLGGEDLDDQLSGH  270

Query  245  FTQEFKRK-HRKDITDNQRA---------LRRLRTACERAKRTLS------SSAQAYIEI  288
               +F++      + D Q +            +R   E+ KR LS      +S      +
Sbjct  271  LKHQFEQLVGGHSLPDLQTSDEPNVFPCTAAGIRGVAEQLKRQLSFDVEGEASCVVQEAV  330

Query  289  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  348
             S+  G      +TR+ +E +C    ++TM PV++VL    ++   + EVVLVGGS+RIP
Sbjct  331  GSVAVGDVLRLRMTRSEWEALCLPTLQRTMAPVKEVLEGNMMTTDDIDEVVLVGGSSRIP  390

Query  349  KVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
             +Q  L++ F G+EPN  I+PD AVA GA
Sbjct  391  WIQAQLAQMF-GREPNSHIDPDVAVAVGA  418

>PHALS_09281
Length=465

 Score = 241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/397 (37%), Positives = 217/397 (55%), Gaps = 32/397 (8%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V ++Q + V  IA+++G+   PS VA+  D   LIG  A+    ++ 
Sbjct  68   HVVGIDLGTTYSVVAIFQKNNVTAIADNEGHVLVPSTVAYLPDGGVLIGREARTHRTIDP  127

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHWPFK-----LTSGAGDKPQITVQFKGESKTFQPE  122
             +T+F+AKR IG+ + D +++++    P++     L     D     +      +   P 
Sbjct  128  QHTIFNAKRFIGQSYDD-VIKSENGTMPYEFNIKPLQRNEYDGICFALNLPNHPECVTPV  186

Query  123  EISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  181
            EI + ++  +  +A  ++G  +V  AV+ VP  FN+ QR ATK A   AGL V R++ EP
Sbjct  187  EIGTAIVRHLHFMAHRYVGHNQVTKAVVAVPVDFNEKQRNATKAAFRAAGLEVSRVLEEP  246

Query  182  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            TAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D RL
Sbjct  247  TAAAIAYGLHQDQNINFMLVFDFGGGTLDVSLLFARNGAITVVDTLGDNHLGGEDLDARL  306

Query  242  VDHFTQEFKRKHRKDI------TDNQRALRR----------LRTACERAKRTLS-----S  280
                   F+ + +K I      T+ +R L+           +R A E  KR L+     +
Sbjct  307  SAWLLMRFESQLKKKISTHNTKTEGKRVLKDRPEPPCTMAGVRQAAELLKRQLTNLSVVT  366

Query  281  SAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  340
            +A  + E D   + I     +TR +FE++C     +TM PV  +L    +   ++  VVL
Sbjct  367  AACVWNEGD---ESIQIEVDVTRLQFEELCKPLLERTMIPVRDILAANNIGTEEIDAVVL  423

Query  341  VGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            VGGS+RIP V+Q L+E F+G+ P  +I+PD AVAYGA
Sbjct  424  VGGSSRIPWVRQRLTEMFHGRAPLSNIDPDLAVAYGA  460

>SDRG_16559
Length=461

 Score = 239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 149/391 (38%), Positives = 213/391 (54%), Gaps = 24/391 (6%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  67
            +SVGIDLGTTYS V V Q   V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  68   HSVGIDLGTTYSVVAVNQKGNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  127

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES-KTFQPEEISS  126
             +T+F+AKR IGR F D  V+ +  H+ F L     ++    +   G + +   P ++ +
Sbjct  128  RHTIFNAKRFIGRAF-DAAVETEASHYEFGLDRDEANRVCFPLSVTGHATRCASPIDVGA  186

Query  127  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
             ++ +++  A   +G  ++ +AVI VPA F+  QR AT  A   AGL V  ++ EPTAAA
Sbjct  187  HIVSQLKASAMRHLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  246

Query  186  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  247  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  306

Query  246  TQEFKRKHRKDITDNQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  288
               F+            +L R             +R   E+ KR L    S++A   +E 
Sbjct  307  VARFEALLATPALPALSSLARTSDASAFPCTVSGMRGVAEKLKRDLSATPSAAASCVVEA  366

Query  289  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  346
             +        +T+  TR  +E +      +T+ P+ ++L    ++ S V EVVLVGGS+R
Sbjct  367  ATPQHAAGDLATLEMTRVEWEALVAPLLSRTLSPIHEMLSGNGMAPSDVDEVVLVGGSSR  426

Query  347  IPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            IP +Q+ L   F G+EPN  I+PD AVA GA
Sbjct  427  IPWIQEALGALF-GREPNAHIDPDVAVAVGA  456

>PYAP_18643
Length=804

 Score = 248 bits (632),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 184/678 (27%), Positives = 315/678 (46%), Gaps = 84/678 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNVDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    +K          + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAYKCVELPNGDVGVVLNYNDEPVTFTCEQVVAMILN  123

Query  131  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQAIAAAANEGVRPAYAVMSCPGFYTDVQRRALLNATKIAGMNCLRLLNEHTAIALAYG  183

Query  190  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K           ++V+  D+G  ++ VS+++  +G  +VKA   D  LGG DFD  L 
Sbjct  184  IYKSARNLFHESEPQHVMFIDMGHASYTVSIVAFVQGKLQVKAATFDRFLGGRDFDYALA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
                ++F+ KH+ +  ++ +A  +L  ACE+AK+ LS       Y+ I+ L D  D++  
Sbjct  244  VDVAKQFEEKHKINALNDAKARIKLLAACEKAKKNLSPHGVNATYVNIECLADEKDYSGQ  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFN-  359
            +T   FE++      +  +P+++ L+DA + KSQ+  V +VGG+TR+  V++ LS+    
Sbjct  304  VTLEHFEELIAPLLNRLEDPIQRALKDAGIDKSQLASVEIVGGATRVSSVKRRLSDILGL  363

Query  360  GKEP-----NKSINPDEAVAYGATVQAAILG------------------------GNdss  390
             KE      + ++N DE+VA G  +Q AIL                         GN   
Sbjct  364  DKEAQNYGLSTTLNADESVARGCALQCAILSPVFKVKEFHIADKVHLPVRVTWEDGN---  420

Query  391  dklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEG  450
                 +   D     + +E AG     +  R    P  K  TF    D    +     E 
Sbjct  421  -ASAPMDTADDNDEDVNMEAAGDSTIVIFDRKDDYPKTKRITFRR--DAAFSIDAAYDET  477

Query  451  ERSMTRDNHL--LGKFNLDAIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------  497
             +     +++  LGK+ +  +P   +G  VP+I V    D NGI +V++ +         
Sbjct  478  AQPYLPPDYVLNLGKYTISGLPAGEKGAEVPKIRVNVSQDINGIFSVASSQLMQEIKEEE  537

Query  498  ----------------------KSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDE  535
                                  K   ++ ++ +  +   LS ++I     +      +D 
Sbjct  538  KPAEEAKEGEAKEAEEKPAEPKKKRFRKVELKVEANVPGLSPTEITSATEQELAMAHQDR  597

Query  536  ANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETE  595
              +     +N LE++ Y +R  + D +L E I   +K  ++DK+ E   WL + +  ++ 
Sbjct  598  VIEETFNKRNELESFVYDMRAQVTD-RLAEYISSDEKNALEDKLNEVEDWLYSDEGFDST  656

Query  596  E--YESKQKELEGVANPI  611
            +  Y+SK  E+  + +P+
Sbjct  657  KSVYQSKLDEMRKITSPV  674

>PPTG_19375
Length=809

 Score = 245 bits (625),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 188/681 (28%), Positives = 317/681 (47%), Gaps = 87/681 (13%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    +K    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  131  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  190  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K       +   ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
                 +F  K++ +  +N ++  +L ++CE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSSCEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +T   FE +     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  VTLEEFETLIEPLLKRLDGPIERALADAGIDKSQLTNVEIVGGGTRVTSVKRHLADVLGL  363

Query  361  KEPNK------SINPDEAVAYGATVQAAIL------------------------GGNdss  390
             +  +      ++N DE+VA G  +  AIL                        G   ++
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILSPMFKVKEFSVTDRVHLPVRVSWDGSASTA  423

Query  391  dklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVF-E  449
                     DV   +   E +  V+ T   R    P  K  TF     ++P  +  V+ E
Sbjct  424  TDAAADDDEDVNMEAPASEDSSLVIFT---RKDEYPKTKRITFRR---DKPFSIDAVYDE  477

Query  450  GERSMTRDNHLL--GKFNLDAIPPMPRG--VPQIDVTFDIDANGILNVSAV---------  496
              ++    ++++  GKF +  +P    G  +P+I V    D NG+ +VS+          
Sbjct  478  SAKTYLPPDYVMDIGKFTISGMPAQEAGAEIPKIRVNVQQDMNGLFSVSSSQLMQEIKEE  537

Query  497  -----------EKSTGKENK-------------ITITNDKGRLSQSDIDRMVAEAEKYKS  532
                       E    KE+K             +T+    G LS +D+     +  K   
Sbjct  538  EKPAEAEGEQKEGEDKKEDKPAEPKKKRFRKIELTVQAQVGGLSVADVTTATEQELKMAQ  597

Query  533  EDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSA  592
            +D   +     +N LE++ Y +RN + D KL   I   +K  ++ K+ ET  WL   +  
Sbjct  598  QDRVIEETFNKRNELESFVYEMRNQITD-KLAGFITSDEKNTLESKLMETEDWLYTDEGF  656

Query  593  ETEE--YESKQKELEGVANPI  611
            ++ +  Y+ K  ++  +++P+
Sbjct  657  DSTKSVYQQKLDDMRKLSSPV  677

>H310_12260
Length=424

 Score = 235 bits (600),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 149/389 (38%), Positives = 213/389 (55%), Gaps = 21/389 (5%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V V ++  V ++ +  G+   PS VAF  +   L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDVHGHFLLPSVVAFKPNGGVLVGRDARHYRRVDP  91

Query  68   HNTVFDAKRLIGRKFSDPIV-QADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
             +T+ +AKR IGR+F + I  +A +  +P    +         +   G      P +I  
Sbjct  92   KHTISNAKRFIGRQFDESIAAEAALYDFPLLANTTGDSHVCFGLNLPGHPSCISPVDIGY  151

Query  127  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
             V+  ++E A AF+G  ++  AVI +PA F+ SQR+AT  A   AGL V  ++ EPTAAA
Sbjct  152  YVVKALKETAMAFLGHDQIYGAVIAIPAGFDASQRKATVAAFERAGLKVRNVLVEPTAAA  211

Query  186  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            +AYGL  K     VL+FD GGGT DVSLL ++ G F+V  TAGD HLGGED D+ L  H 
Sbjct  212  LAYGLHTKPNVHYVLVFDFGGGTLDVSLLYLQNGSFQVMDTAGDNHLGGEDLDDLLSAHL  271

Query  246  TQEFKR----------KHRKDITDNQRALRR-LRTACERAKRTLS------SSAQAYIEI  288
              EF++          +   D+ D        +R   E+ KR LS      +S      +
Sbjct  272  KHEFEQVVGGHSLPDVQTSGDMPDVFPCTAAGVRGVAEQLKRRLSFANDGEASCVVQQAV  331

Query  289  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  348
                 G      +TRA +E++C    ++TMEPV++VL    ++   V EVVLVGGS+RIP
Sbjct  332  GEYVVGDTLRLRMTRAEWEELCLPTLQRTMEPVKEVLVGNMMTAGDVDEVVLVGGSSRIP  391

Query  349  KVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
             +Q  L+E F G+ PN  I+PD AVA GA
Sbjct  392  WIQGQLTEMF-GRAPNGHIDPDVAVAVGA  419

>PHYRA_53570
Length=395

 Score = 234 bits (598),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 150/395 (38%), Positives = 207/395 (52%), Gaps = 29/395 (7%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNAHN  69
            VGIDLGTTYS V + Q + V  IA+D+G    PS VAF    E L+G  A+     +  +
Sbjct  1    VGIDLGTTYSVVAISQKNNVTAIADDEGYILVPSTVAFLPHGEMLVGREARAHRTTDPQH  60

Query  70   TVFDAKRLIGRKFSDPIVQAD-----IKHWPFKLTSGAGD---KPQITVQFKGESKTFQP  121
            T+F+AKR IGRK+ D +V+++     I  + F +    G+       ++    +     P
Sbjct  61   TIFNAKRFIGRKY-DEVVRSEADSNGITPYEFVVKPAQGNVHGGVCFSLDLPEQPDCVTP  119

Query  122  EEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180
             +I S V+  +R +A  F+G  ++  AVI VP  F+  QR AT  A   AGL V R++ E
Sbjct  120  VQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVEFDAQQRDATVAAFREAGLEVSRVLEE  179

Query  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            PTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D  
Sbjct  180  PTAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDAL  239

Query  241  LVDHFTQEFKRKHRKDITDN----------------QRALRRLRTACERAKRTLS--SSA  282
            L D   ++F+ +    IT                     L  +R A E  KR L+  S+A
Sbjct  240  LADWLAKQFEAQLGTPITSRGTEANVKNFDEDGMAPPCTLAGVRHAAELLKRQLTDFSTA  299

Query  283  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  342
             A          +      TR +FE +CG    +TM PV ++L    +   ++  VVLVG
Sbjct  300  SAACVWRKGTKVVRAEVKTTRTQFEALCGSLLERTMVPVREILEANNMETEEIDAVVLVG  359

Query  343  GSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            GS+R+P V+Q L+E F G+ P  +I+PD AVAYGA
Sbjct  360  GSSRVPWVRQHLTEMFQGRAPLSNIDPDLAVAYGA  394

>HYAP_06818
Length=316

 Score = 231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 194/300 (65%), Gaps = 14/300 (5%)

Query  318  MEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            M P +K ++DA L KS+++EV+LVGG +R+PKVQ  +  FF GK+P+K +NPDE VA GA
Sbjct  1    MGPCKKCVKDAGLEKSEINEVILVGGMSRMPKVQTTVEAFF-GKKPSKGVNPDEVVAMGA  59

Query  378  TVQAAILGGNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYA  437
             +Q  +L G+     L D+  L +       ET GGV T LI RNTT+PTKK+Q FST A
Sbjct  60   AIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAA  114

Query  438  DNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVE  497
            D+Q  V I+V +GER M  DN LLG F+L  IPP PRGVPQI+V+FDIDANGI+NV A +
Sbjct  115  DSQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARD  174

Query  498  KSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNS  557
            K+TGKE  I I +  G LS ++I++MVA+AE     D+  K  IEAKN  ++  Y+   +
Sbjct  175  KATGKEQNIVIQS-SGGLSDAEIEKMVADAEANAVADQQRKELIEAKNEADSVLYTTEKT  233

Query  558  LNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAE-TEEYESKQKELEGVANPILQKMY  616
            L  E+ KE+I +AD     +KV   +  L     +E TEE ++  KE++ +A  I + +Y
Sbjct  234  L--EEHKEKI-DADTL---EKVKVALSDLRQKSESENTEEIKAALKEVQEMAMKIGEAVY  287

>SPRG_10476
Length=270

 Score = 228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 137/276 (50%), Positives = 183/276 (66%), Gaps = 10/276 (4%)

Query  330  LSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNds  389
            +  +++ E+VLVGGSTRIPKVQ +LS  F GKE +KSINPDEAVAYGA VQ AIL G   
Sbjct  1    MKPNEITELVLVGGSTRIPKVQNMLSAVFGGKELSKSINPDEAVAYGAAVQGAILSG-IR  59

Query  390  sdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFE  449
            +D    LLL+DVTPLSLG+ET G VM+ LI RNT +P KK + ++T +D Q  V + ++E
Sbjct  60   NDATNSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIPVKKTRVYTTESDYQTQVNVVIYE  119

Query  450  GERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  509
            GER+    N+ LG+F +  I    RG PQ++VTF+IDANGILNVSA +K T  + + TI+
Sbjct  120  GERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDANGILNVSARDKKTNAKAETTIS  179

Query  510  NDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPE  569
            N+ GRLSQ+DIDRMV EAEK+K ED     +IEA+N+LE + Y         +  E   E
Sbjct  180  NNHGRLSQADIDRMVEEAEKFKKEDAEALKKIEARNSLEGFIY---------RALELTRE  230

Query  570  ADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELE  605
                  ++ + E  +WL+ H+ A   E E K++ LE
Sbjct  231  KGDAAAENTIREAREWLEDHEDATLRELEEKKRVLE  266

>PHALS_04095
Length=803

 Score = 241 bits (616),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 184/674 (27%), Positives = 309/674 (46%), Gaps = 77/674 (11%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    +     A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDLKRLIGRKFKHPEVQKEIAQLAYTCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  131  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIASAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  190  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
                 +F  K++ D   N ++  +L +ACE+AK+ LS        + I+ L D  D+N+ 
Sbjct  244  KDVAAKFAEKYKTDPLGNPKSRIKLLSACEKAKKNLSPYGVTATNLNIECLADDRDYNAQ  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +T   FE++      +  +PVE+ L DA + KSQ+  V +VGG TR+  V++ L+E    
Sbjct  304  LTLEEFEELIAPLLLRLNDPVERALADAGIDKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  361  KEPNK------SINPDEAVAYGATVQAAILGGNdssdklqdlll-----------ldvtp  403
             +  +      ++N DE+VA G  +  AIL       +                      
Sbjct  364  DKEQQNFGLSTTLNADESVARGCALNCAILSPMFKVKEFSVTDCVHLPVRVSWDGSAAAG  423

Query  404  lslglETAGGV-MTT------LIARNTTVPTKKAQTFSTYADNQPGVLIQVF-EGERSMT  455
                 E  G V M T      + +R    P  K  TF     ++P  +  ++ E  +S  
Sbjct  424  TPSAAEEDGDVNMETEDSSLVIFSRKDEYPKTKRITFRR---DKPFSIDAMYDESAKSYL  480

Query  456  RDNHLL--GKFNLDAIPPMPRG--VPQIDVTFDIDANGILNVSAVE--------------  497
              ++ +  GK+ +  +P    G  +P+I V    D NG+ +VS+ +              
Sbjct  481  PPDYDMDIGKYTISGMPSQEAGTEIPKIRVNVQQDMNGLFSVSSSQLMQEILEEEKPAVA  540

Query  498  ------------------KSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKV  539
                              K   ++ ++++      LS  D+     +  K   +D   + 
Sbjct  541  DGAEVEGEKKDDKPVEPKKKRFRKVELSVHAAVSGLSAGDVAAATEQELKMAQQDRVIEE  600

Query  540  RIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEE--Y  597
                +N LE++ Y +RN + D KL   I   +K  ++ K+TET  WL   +  ++ +  Y
Sbjct  601  TFNKRNELESFVYEMRNQITD-KLAGFITSGEKSNLESKLTETEDWLYTDEGFDSTKSVY  659

Query  598  ESKQKELEGVANPI  611
            + K  ++  +++P+
Sbjct  660  QQKLDDMRKLSSPV  673

>PHYCA_120845
Length=444

 Score = 233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 146/392 (37%), Positives = 208/392 (53%), Gaps = 25/392 (6%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V + + + V  IA+ +G+   PS VAF  D   L+G  A+     + 
Sbjct  50   HVVGIDLGTTYSVVAISRKNNVTAIADSEGHVLVPSTVAFLPDGGVLVGREARVHRTTDP  109

Query  68   HNTVFDAKRLIGRKF--SDPIVQADIKHWPF---KLTSGAGDKPQITVQFKGESKTFQPE  122
             +T+F+AKR IG+ +  +    +  +  + F   ++     D    ++  +G+     P 
Sbjct  110  QHTIFNAKRFIGQSYVMTSETNEKGVTPYEFVVKQMHRDEHDGICFSLSLQGQPDCVTPV  169

Query  123  EISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  181
            +I + V+  +R +A  F+G  ++  AVI VP  FN  QR+AT  A   AGL V R++ EP
Sbjct  170  QIGTSVVKHLRLMAHQFVGHDQITKAVIAVPVDFNQKQREATVAAFRGAGLEVSRVLEEP  229

Query  182  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            TAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D +L
Sbjct  230  TAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDAQL  289

Query  242  VDHFTQEFKRKHRKDIT----------------DNQRALRRLRTACERAKRTLSSSAQAY  285
                  EF+ +    IT                D    L  +R A E  KR L+ ++ A 
Sbjct  290  TAWLVGEFEAQLGTAITSRGTGDEVKTFDNDGKDPPCTLSGVRHAAELVKRQLTDASTAT  349

Query  286  IEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGST  345
                S  +G      ITR +FE++CG    +TM PV +VL    +   ++  VVLVGGS+
Sbjct  350  AACISGNEGAKVE--ITRTQFEELCGSLLERTMVPVREVLEANNMESDEIDAVVLVGGSS  407

Query  346  RIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            RIP V++ L++ F G+ P   I+PD AVAYGA
Sbjct  408  RIPWVRRRLTDMFQGRAPLSDIDPDLAVAYGA  439

>PHYCA_111740
Length=810

 Score = 241 bits (615),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 183/683 (27%), Positives = 318/683 (47%), Gaps = 89/683 (13%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +IK   +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIKQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  131  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE T+ A+AYG
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTSIALAYG  183

Query  190  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K           ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
                 +F  K++ +  +N ++  +L +ACE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +T   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ L+E    
Sbjct  304  VTLEEFEELIAPLLQRLDGPIERALADAGIEKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  361  KEPNK------SINPDEAVAYGATVQAAILG-----------------------GNdssd  391
             +  +      ++N DE+VA G  +  AIL                        G+ S+ 
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILSPMFKVKEFSVTDRVHLPVRVSWDGSASTA  423

Query  392  klqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVF-EG  450
                    DV   +   E +  V   +  R    P  K  TF     ++P  +  V+ E 
Sbjct  424  TDAADDDEDVNMEATASEDSSLV---IFNRKDEYPKTKRVTFRR---DKPFSIDAVYDET  477

Query  451  ERSMTRDNHLL--GKFNLDAIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------  497
             ++    ++++  GK+ +  +P    G  +P+I V    D NG+ +V++ +         
Sbjct  478  AKAYLPPDYVMDIGKYTISGMPAQEAGAEIPKIRVNVQQDMNGLFSVASSQLMQEIKEEE  537

Query  498  ---------------------------KSTGKENKITITNDKGRLSQSDIDRMVAEAEKY  530
                                       K   ++ ++T+    G LS +D+     +  K 
Sbjct  538  KPAEAEGDKKEGEEKDEKKDDKPAEPKKKRFRKIELTVQAQVGGLSPADVSTATEQELKM  597

Query  531  KSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQ  590
              +D   +     +N LE++ Y +RN + D KL   I   +K  ++ K+ ET  WL   +
Sbjct  598  AQQDRVIEETFNKRNELESFVYEMRNQITD-KLAGFITGDEKSNLETKLMETEDWLYTDE  656

Query  591  SAETEE--YESKQKELEGVANPI  611
              ++ +  Y+ K  ++  +++P+
Sbjct  657  GFDSTKSVYQQKLDDMRKLSSPV  679

>PYIR_21692
Length=468

 Score = 233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 147/397 (37%), Positives = 214/397 (54%), Gaps = 30/397 (8%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  69
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  67   VGIDLGTTYSVVAISQKNNVSVIPDAFGHVIIPSIVAFLPGGDVLVGRQARAHRTKDPEH  126

Query  70   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFK----GESKTFQPEEIS  125
            T+F+AKR IGR + D     D + + + +   +  +P+  V F+    G  K   P  + 
Sbjct  127  TIFNAKRFIGRIYDDVKQSKDDESYEYTVARASLSEPESGVCFQLSLPGHPKCVTPVSVG  186

Query  126  SMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184
            S ++  +R +A +F+G  ++  AVI VP  F+  QR AT+ A A AGL V RI+ EPTAA
Sbjct  187  SAIVRHLRAMAHSFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRILEEPTAA  246

Query  185  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244
            AIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D+++ + 
Sbjct  247  AIAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDIDSQVAEL  306

Query  245  FTQEFKRK-------HRKDITDNQRALRR-----------LRTACERAKRTLSSSAQAYI  286
             T+    +          D+ +    L             +R A E  KRTLSS      
Sbjct  307  LTEAIAARIGTTLTSMASDMEETDSELHEDPGQLPCTPAGIRRAAELLKRTLSSEGSGSA  366

Query  287  EIDSLFDGIDFNST------ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  340
                   G    S       +TRA+FED+CG+  ++T+ PV++++    ++  ++  VVL
Sbjct  367  SCIVQRSGTLLQSAEKVTIDMTRAQFEDICGEILKRTLTPVQEIISANHMTPEEIDAVVL  426

Query  341  VGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            VGGS+RIP V++ L+E F+G+ P   I+PD AVAYGA
Sbjct  427  VGGSSRIPWVREHLAELFDGRAPLSDIDPDIAVAYGA  463

>PPTG_09003
Length=449

 Score = 232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 150/396 (38%), Positives = 203/396 (51%), Gaps = 27/396 (7%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V + Q + V  I + +G    PS VAF      L+G  A+    ++ 
Sbjct  49   HVVGIDLGTTYSVVAISQKNNVTAIKDKEGYVLVPSTVAFLPHGGVLVGREARAHRTLDP  108

Query  68   HNTVFDAKRLIGRKFSDPIV-QAD---IKHWPF---KLTSGAGDKPQITVQFKGESKTFQ  120
             +TVF+AKR IG+ + D +  +AD   +  + F    L     D    T+   G+     
Sbjct  109  QHTVFNAKRFIGQSYGDVLASEADENGVTPYEFGVKMLQDNKHDGVCFTLDLSGQPGCVT  168

Query  121  PEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
            P EI + V+  +R +A  F+G  ++  AVI VP  FN  QR AT  A   AGL V R++ 
Sbjct  169  PVEIGTAVVRHLRSMAHNFVGHDQITKAVIAVPVDFNARQRDATVAAFRAAGLEVSRVLE  228

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D 
Sbjct  229  EPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDA  288

Query  240  RLVDHFTQEFKRKHRKDITDNQR----------------ALRRLRTACERAKRTLS--SS  281
            RL     ++F+ +    IT                     +  +R A E  KR L+  S 
Sbjct  289  RLSAWLLKQFEAQLGAAITSRGSESEGKVSENGSNEPPCTMAGVRQAAELVKRQLTDVSV  348

Query  282  AQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  341
              A          +    T+TRA+FE++C     +TM PV  VL    +   ++  VVLV
Sbjct  349  TTAACISSGNKKPVRVEVTVTRAQFEELCDSLLERTMIPVRDVLESNNMDTDEIDAVVLV  408

Query  342  GGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            GGS+RIP V+Q L++ F G+ P   I+PD AVAYGA
Sbjct  409  GGSSRIPWVRQRLTDMFQGRPPLSDIDPDLAVAYGA  444

>PHALS_08498
Length=895

 Score = 240 bits (613),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 197/718 (27%), Positives = 328/718 (46%), Gaps = 129/718 (18%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+D G  Y  V  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  27   GVDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAATVGVRRPQTA  86

Query  71   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
                +RL+G K SDP V A  D +H P++L   A     + +Q  G+ + F  EE+ +MV
Sbjct  87   YMQIRRLLGTKLSDPQVIALRDEEHLPYELIQNATRGGTVMLQH-GKKQFFHAEELVAMV  145

Query  129  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  188
                R++ + F    VK+ V+TVP YF+ +QRQA  DA  I+G+ VL +INE TAAA+  
Sbjct  146  FTHARQITDTFAEASVKDWVLTVPTYFSQAQRQAMLDAADISGVRVLSLINENTAAALQL  205

Query  189  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEE-------------GIFEVKATAGDTH  231
             +    D +   + +L +++G  +  VS+                   IF+  + A D  
Sbjct  206  AVHSSFDPEEKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISIFQTISNAWDES  265

Query  232  LGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSL  291
            LGG  FD RL +H  QEF  K  +DI    R + ++R   ++ K  LS++ +  + + SL
Sbjct  266  LGGAKFDLRLAEHLAQEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEIPVVMQSL  325

Query  292  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  351
             + IDF +++TR + E +  D F +T++PVE  L  A L+ + + E+ L+GG  R+PK+Q
Sbjct  326  HNDIDFFTSMTRTKLEALSSDLFERTLKPVEVALEKAGLTAADIDEIELIGGGVRMPKIQ  385

Query  352  QLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETA  411
            Q LSEFF GK+    +N DEA+A GA  +AA L  +    ++    +         ++ +
Sbjct  386  QQLSEFFVGKDLGVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDIATYPIGVRLVDLS  445

Query  412  GGVMT---------------TLIARNTTVPTKKAQTFSTYAD-------NQPGVL-IQVF  448
               +T                L + +  +  +K+ +FS  +D       ++P +L + V 
Sbjct  446  SSELTNNKEEEDMKQWMKRAALFSESHRLGVRKSVSFSHSSDLSCTFRYDKPSMLPVGV-  504

Query  449  EGERSMTRDNHLLGKFNLDAIPPMPR-------GVPQIDVTFDIDANGILNVSAVEKS--  499
                     N  +G FN+  +            G P++ +TF++D+NGI  ++  E +  
Sbjct  505  ---------NVHIGTFNVTGVEKFAARMADKNLGEPKVTLTFELDSNGIAQIAKAEATLE  555

Query  500  ---------------------------------------------------TGKENKITI  508
                                                               T +E  I +
Sbjct  556  EEVEVEVVLKKEKKSKKSKKEDSSTDSSAAGDEKMVEEEEKPETRMEKQIKTHREKLIVV  615

Query  509  TNDKGRLSQSDIDRM-VAEAEKYKS-------EDEANKVR--IEAKNALENYAYSLRNSL  558
                 R  + D+  + ++E  K +S       E++ NK R  +EAKN LE + Y+  ++L
Sbjct  616  RAHDAREPEDDVSVLPMSEHAKKESMRMLREMENDDNKRRADLEAKNNLETFIYTAHDAL  675

Query  559  NDEKLKEQ---IPEADKKVVDDKVTETIQWL-DAHQSAETEEYESKQKELEGVANPIL  612
            + ++ + +   IPE   + +  K+TET +WL +  + AE  EY+++ +EL+   + IL
Sbjct  676  SAQESQIKLVTIPE-QLESLQKKLTETEEWLYNDGEHAEAAEYKTRMEELKLELDSIL  732

>PYAR_15468
Length=769

 Score = 237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 181/656 (28%), Positives = 307/656 (47%), Gaps = 74/656 (11%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G T   +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNTDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    F           + +++  E+ TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAFPCVELPNGDVGVVLRYNDEAVTFTCEQVVAMILN  123

Query  131  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVRPAYAVLSCPGFYTDVQRRALLNAAKIAGVNCLRLLNEHTAVALAYG  183

Query  190  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K       +   ++V+  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  L 
Sbjct  184  IYKSARNLFAESEPQHVMFIDMGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYALA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
            +    +F+ K++ +   + +A  +L + CE+AK+ LS       ++ ++SL +  D++  
Sbjct  244  EDVAAQFEAKYKVNPLKDAKARIKLLSGCEKAKKNLSPHGVTATFLNVESLAEDRDYSGQ  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            +T  RFE++      +   P+++ L DA + K+Q+  V +VGG+TR+     +LS  F  
Sbjct  304  VTLERFEELIAPLLNRLEGPIQRALADAGIDKAQLASVEIVGGATRVSSC-AILSPVFKV  362

Query  361  KE---PNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAGGVMTT  417
            KE    +K+  P        +       G+                  + +E AG   T 
Sbjct  363  KEFHIADKTHFPVRVSWENGSANTTDAAGD-------------NDEEDVNMEAAGSDSTL  409

Query  418  LIA-RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERS---MTRDNHL-LGKFNLDAIPPM  472
            +I  R    P  K  TF   A       I     E +   +  D  L LGK+ +  IP  
Sbjct  410  VIFDRKDEYPKTKRITFRRDA----AFAIDAAYDETATPFLPADYSLALGKYTISGIPKT  465

Query  473  PRGVPQIDVTFDIDANGILNVSAVE----------------------KSTGKENK-----  505
               +P+I V    D NGI +V++ +                      K    E+K     
Sbjct  466  GDEIPKIRVNVQQDLNGIFSVASSQLMQEIKEEEKSAEEAKEGADEAKDKAAEDKPAEPK  525

Query  506  --------ITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNS  557
                    + +  D   LS  +I     +      +D   +     +N LE++ Y +RN 
Sbjct  526  KKRFRKVELKVDADVPGLSPQEISSATEQELAMAHQDRVIEETFNKRNELESFVYDMRNH  585

Query  558  LNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEE--YESKQKELEGVANPI  611
            +  E+L E I E++K  ++DK+TE   WL + +  ++ +  Y+ K  EL  +++P+
Sbjct  586  IT-ERLAEYISESEKASLEDKLTEAEDWLYSDEGFDSTKSVYQGKLDELRKLSSPV  640

>PYIW_14231
Length=1243

 Score = 242 bits (618),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 182/571 (32%), Positives = 296/571 (52%), Gaps = 64/571 (11%)

Query  9    YSVGIDLG-----TTYSCVGVWQNDRVEII-ANDQGNRTTPSYVAFTDTERLIGDAAKNQ  62
            + +GID+G     TT S  GV  +  +E    +D      P+YV+ TD++ ++G  A+ +
Sbjct  12   WCIGIDIGAHFFSTTVSKDGVAVDVPLEEHEQDDTKTHLLPAYVSVTDSDFIVGSEARKR  71

Query  63   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT----  118
                  NT+FD  R++GRK SD +   D+  WPFK+  G  DK  + ++      T    
Sbjct  72   AKSGDSNTIFDFVRIVGRKISD-LNAGDLSKWPFKVVPGDNDKAVVEIRTSTNGSTASVS  130

Query  119  ---FQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVL  175
               F PEE+ ++++  ++E  E  +G  V +AV+ VP  FN +Q +A ++A  IAGL   
Sbjct  131  FRMFHPEELLAVLVRCIKEKVEMMLGAVVDSAVVCVPGGFNHTQCRAVRNAFTIAGLRTE  190

Query  176  RIINEPTAAAIAYGLDKKGGERN-----VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDT  230
            +++   TA AI++GLD +    N     VL+ D+G  T D++L+S+    FEVKA   D 
Sbjct  191  KLLGAATATAISFGLDIRTDIANAAMQLVLVVDIGASTTDIALVSVLANKFEVKAVDSDL  250

Query  231  HLGGEDFDNRLVDHF----TQEFKRKHRKDITDNQ---RALRRLRTACERAKRTLSSSAQ  283
             LGG+DF +R+  H     TQE        + + Q   + + ++R ACE AK+ LSSS  
Sbjct  251  GLGGDDFTDRIAAHCHRKKTQEVTPSGENAVANTQGYVKGVHQIRHACELAKKLLSSSLT  310

Query  284  AYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVH  336
            A +       GIDF +       T+TR  FE +C D ++  +E V +V++++  SK  + 
Sbjct  311  AVV-------GIDFPTSDTFGYYTVTRTGFEALCMDPWQHALERVHRVIQESSASKDDIT  363

Query  337  EVVLVGGSTRIPKVQQLLSEFF-------NGKEPNKSINPDE-AVAYGATVQAAILGGNd  388
             V+LVGGS +IP++Q L  E F        G +    ++P   A A+ + V+  + G   
Sbjct  364  TVLLVGGSFQIPRLQTLFKESFPSQEVVVAGAQSPPILSPARGAAAFSSAVRRGVPGAE-  422

Query  389  ssdklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVF  448
                     LL+VTPLSLG+++  G    +I RNT++P  K  +F  YA+ Q  V++ V 
Sbjct  423  ---------LLEVTPLSLGIQSVAGTRIMMIPRNTSIPVHK--SFLYYANCQHAVIVYVI  471

Query  449  EGERSMTRDN---HLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENK  505
            EG+ + ++ N   H L    +D        V +ID+T DI++   + V+A E+S+G++  
Sbjct  472  EGD-NFSKPNEILHRLSSIRVDGSLATKHLVLKIDITIDINSLDQMTVTAAERSSGRKIA  530

Query  506  ITITNDKGRLSQSDIDRMVAEAEKYKSEDEA  536
              I+ D   +S + I    A  E   ++  A
Sbjct  531  TAISGDDTGMSANAIAHANARLENRIADSTA  561

>PITG_17383
Length=438

 Score = 228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 152/398 (38%), Positives = 205/398 (52%), Gaps = 29/398 (7%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V + Q + V  IA+  G+   PS VAF  +   L+G  A+     + 
Sbjct  36   HVVGIDLGTTYSVVAISQKNNVTAIADKNGHVLVPSTVAFLPSGAVLVGREARAHRTTDP  95

Query  68   HNTVFDAKRLIGRKFSDPIV-QADIKHW-PFK-----LTSGAGDKPQITVQFKGESKTFQ  120
             +T+F+AKR IG+ + D +  +AD     P++     L     D    T+  +   K   
Sbjct  96   QHTIFNAKRFIGQSYEDVLTSEADENGGTPYEFSVKMLRDNEHDGVCFTLDLQDHPKCVT  155

Query  121  PEEISSMVLIKMREVAEAFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
            P  I + V+  +R +A  F+G E +  AVI VP  FN+ QR AT  A   AGL V R++ 
Sbjct  156  PVNIGTAVVQHLRSMAHQFVGHEQITKAVIAVPVDFNNRQRDATVAAFRAAGLAVSRVLE  215

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D 
Sbjct  216  EPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDA  275

Query  240  RLVDHFTQEFKRKHRKDIT-------------DNQR-----ALRRLRTACERAKRTLS--  279
            RL     +EF+      IT             DN        +  +R A E  KR L+  
Sbjct  276  RLSAWLLKEFEAHLGTAITSRGAETETKATSVDNDSKEPPCTVAGVRQAAELLKRQLTDA  335

Query  280  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  339
            S A A    +     +      TR +FE +CG    +T+ PV +VL    +   ++  VV
Sbjct  336  SVATAACIWNDGKKTVRVEVRATRVQFEKLCGSLLERTIIPVREVLEANNMDTDEIDAVV  395

Query  340  LVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            LVGGS+RIP V+Q L++ F G+ P   I+PD AVAYGA
Sbjct  396  LVGGSSRIPWVRQRLTDMFEGRPPLSDIDPDLAVAYGA  433

>CCA15913
Length=857

 Score = 237 bits (605),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 186/693 (27%), Positives = 316/693 (46%), Gaps = 105/693 (15%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  43   IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  102

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQA+I    FK    A     I +++     TF  E+I +M+L 
Sbjct  103  ATDIKRLIGRKFKHPEVQAEIAQLSFKCDEMANGDVGIVLKYNDADVTFSCEQIIAMILN  162

Query  131  KMREVA-EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A  A  G      V++ P Y+ D QR+A  ++  IAGLN LR+INE TA A+AYG
Sbjct  163  KMQIIATSANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  222

Query  190  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            + K    RN         V+  D+G  ++ V+++S   G  +V++ A D  LGG DFD  
Sbjct  223  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVSFVLGKLQVRSVAFDRFLGGRDFDYA  280

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  298
            L     + F+ KH+ D     ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  281  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  340

Query  299  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFF  358
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+  V++ L++  
Sbjct  341  SQITLEHFEELIAPLLDRLEAPITQALNDAGIEKSQLSNVEVVGGGTRVASVKRRLADIL  400

Query  359  NGKEP------NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETAG  412
            +  +       + ++N DE+VA G  +Q AIL       K   +      P+ +  ET+ 
Sbjct  401  SLDKSAQNYGLSTTLNADESVARGCALQCAILSP-LFKVKEFSIADRVYYPVRVSWETSA  459

Query  413  GVMTTLIARNTTVPTKKAQ---------------TFSTYADNQPGVLIQVFEGERSMTRD  457
             V         +VP +                     T+AD  P      F  E S + D
Sbjct  460  DV---------SVPMETGDDNEDGDLGNDGANSIVIFTHADEYPKTKRITFRREDSFSVD  510

Query  458  NHL---------------LGKFNLDAIPPMPRG--VPQIDVTFDIDANGILNVSAVE---  497
                              +GKF +  +P + +G  +P+I V    D NG++ +S+ +   
Sbjct  511  AKYDESAKALLPPDYDLGIGKFTISGLPEIEKGGEIPKIRVNIQHDLNGLVGISSSQLMQ  570

Query  498  -------------------------------------KSTGKENKITITNDKGRLSQSDI  520
                                                 K   ++ ++ I  +   L+ S++
Sbjct  571  ELKEEKPADEAKETQENEENKEKKEGGKADEKAPEPKKKRFRKVELKIEAETKGLNVSEV  630

Query  521  DRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVT  580
            ++      +   +D   +     +N LE++ Y +RN ++D +L++ I E +K  ++  + 
Sbjct  631  NKATEIELEMAHQDRVIEETCNKRNELESFVYEMRNQISD-RLRDFITEEEKSKLESSLA  689

Query  581  ETIQWLDAHQSAETEE--YESKQKELEGVANPI  611
            E  +WL   +  ++ +  Y++K   L  ++ PI
Sbjct  690  EVEEWLYTDEGFDSVKSVYQTKLDGLRKLSAPI  722

>PYIW_19956
Length=459

 Score = 228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 149/396 (38%), Positives = 211/396 (53%), Gaps = 29/396 (7%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  68
            + VGIDLGTTYS V + Q + V +I +  G+   PS VAF   E L+G  A+     +  
Sbjct  61   HVVGIDLGTTYSVVAIAQKNNVSVIPDAFGHVIIPSIVAFLPGEVLVGRQARAHRTRDPK  120

Query  69   NTVFDAKRLIGRKFSDPIVQADIKHWPFKL--TSGAGDKPQITVQFKGESKTFQPEEISS  126
            +T+F+AKR IGR + D +   D   + + +  T   G   Q++V   G  K   P  I S
Sbjct  121  HTIFNAKRFIGRTYKDVVQSKDDASYEYTVARTPEGGVCFQLSV--AGHPKCVTPVAIGS  178

Query  127  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185
             ++  +R +A  F+G  ++  AVI VP  F+  QR AT+ A A AGL V R+++EPTAAA
Sbjct  179  AIVSHLRAMAHRFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRVLDEPTAAA  238

Query  186  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  245
            IAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D+++    
Sbjct  239  IAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDIDSQVAAFL  298

Query  246  T------------------QEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIE  287
            T                  +E   +H +D          +R A E  KRTLSS + +   
Sbjct  299  TEAIAARIGTTLTSMASDMEESDSEHNEDPEQLPCTPAGIRRAAELLKRTLSSHSASSAS  358

Query  288  IDSLFDGIDFNST------ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  341
                  G    S       +TRA+FE+MC +   +T+ PV++++    ++  ++  VVLV
Sbjct  359  CVVQHSGTLLQSGEKVTIDVTRAQFEEMCAEILGRTLVPVQEIISANHMTPEEIDAVVLV  418

Query  342  GGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            GGS+RIP V+  L+  FNG+ P   I+PD AVAYGA
Sbjct  419  GGSSRIPWVRSNLATMFNGRAPLSDIDPDVAVAYGA  454

>PYU1_G008851
Length=795

 Score = 234 bits (597),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 139/391 (36%), Positives = 213/391 (54%), Gaps = 20/391 (5%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSVARAHFKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E+I +MVL 
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQIVAMVLN  123

Query  131  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G +   AV++VP Y+ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDGVQPGYAVVSVPGYYTDVQRRALLNASKIAGLNTLRLINEHTAIALAYG  183

Query  190  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSIVAFVQGKLQVKSAAYDRFLGGRDFDYA  241

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  298
            L     ++F+ K++ D     ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKKFQEKYKTDPLAEAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  299  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFF  358
            S IT   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ LSE  
Sbjct  302  SQITLELFEELIEPLLQRLEGPIERALNDAGVEKSQLTSVEIVGGGTRVSSVKRRLSEIL  361

Query  359  NGKEP------NKSINPDEAVAYGATVQAAI  383
               +       + ++N DE+VA G  +Q AI
Sbjct  362  GLDKDAQNYGLSTTLNADESVARGCALQCAI  392

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 84/185 (45%), Gaps = 32/185 (17%)

Query  458  NHLLGKFNLDAIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------------  497
            N  +GKF +  IP + +G  +P+I V    D NG+  V++ +                  
Sbjct  486  NTTIGKFTVSGIPELEKGAELPKIRVNVQQDINGLFAVASSQLMQEIKEEEKPAEEGKEG  545

Query  498  ---------KSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALE  548
                     K   ++  + +T + G LS SD+     +  K   +D   +     +N LE
Sbjct  546  EAEKPTEPKKKRFRKVDLKVTAEVGGLSSSDVLAATEQELKMAHQDRIIEETFNKRNELE  605

Query  549  NYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEE--YESKQKELEG  606
             + Y +RN ++D KL E + +++K  ++DK+ E   WL + +  +T +  Y++K  EL  
Sbjct  606  TFVYEMRNQVSD-KLAEFVTDSEKAALEDKLNEMEDWLYSDEGFDTTKSVYQAKLDELRQ  664

Query  607  VANPI  611
              +P+
Sbjct  665  STSPL  669

>PYU1_G006843
Length=481

 Score = 226 bits (577),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 144/411 (35%), Positives = 213/411 (52%), Gaps = 34/411 (8%)

Query  1    MAQAKTSGYS----VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTER-LI  55
            +  AK + +S    VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+
Sbjct  66   LLYAKLTAFSLYDLVGIDLGTTYSVVAISQKNNVTVIPDVLGHVLIPSMVAFVPGGKVLV  125

Query  56   GDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQ---ITVQF  112
            G  A+     +  +T+F+AKR IGR + D +   D   + F ++    D        V  
Sbjct  126  GRDARAHRTKDPAHTIFNAKRFIGRTYEDVVQSKDAASYEFAVSKAPNDVHHGVCFPVNV  185

Query  113  KGESKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAG  171
             G  K   P  I + ++  +R +A AF+G  ++  AVI VP  F+  QR AT+ A   AG
Sbjct  186  PGHRKCVSPIAIGATIVGHLRAMAHAFVGHNQITKAVIAVPVDFDGVQRAATQKAFFAAG  245

Query  172  LNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTH  231
            L+V RI+ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD +
Sbjct  246  LHVSRILEEPTAAAIAYGLHQDPSVNFILVFDFGGGTLDVSLLFTRAGSINVVDTIGDNN  305

Query  232  LGGEDFDNRLVDHFTQEFKRKHRKDITDNQR-------------------ALRRLRTACE  272
            LGGED D ++ +  T +   +    +T                        L  +R A E
Sbjct  306  LGGEDLDAKVAEVLTHKIAERIGTTLTSATSDMEETYSDRTNDDPDQLPCTLAGIRRAAE  365

Query  273  RAKRTLS--SSAQAYIEIDSLFDGIDFNSTI----TRARFEDMCGDYFRKTMEPVEKVLR  326
              KRTLS  +SA A   +    + +    T+    TR   E++C +   +T+ PV++++ 
Sbjct  366  LLKRTLSYETSATASCVVQMSGELLQARETVSIEMTRTELEEICSELLARTLVPVKEIIE  425

Query  327  DAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
               ++  ++  VVLVGGS+RIP V++ L++ F+G+ P   I+ D AVAYGA
Sbjct  426  ANHMTSEEIDAVVLVGGSSRIPWVREHLAKMFDGRAPLSDIDRDVAVAYGA  476

>CCI46709
Length=819

 Score = 233 bits (593),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 178/685 (26%), Positives = 312/685 (46%), Gaps = 89/685 (13%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQA+I    F+    A     I +++     TF  E+I +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQAEIAQLSFRCEEMANGDVGIVLKYNDADVTFSCEQIIAMILN  123

Query  131  KMREVA-EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A  A  G      V++ P Y+ D QR+A  ++  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQIIATTANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  183

Query  190  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            + K    RN         V+  D+G  ++ V++++   G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVAFVLGKLQVKSVAFDRFLGGRDFDYA  241

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  298
            L     + F+ KH+ D     ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  242  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  301

Query  299  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFF  358
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+  V++ L++  
Sbjct  302  SQITLDHFEELIAPLLDRLEAPINQALNDAGIIKSQLSNVEIVGGGTRVASVKRRLADIL  361

Query  359  NGKEP------NKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslglETA-  411
            +          + ++N DE+VA G  +Q AIL       +      +          +A 
Sbjct  362  SLDNSAQNYGLSTTLNADESVARGCALQCAILSPLFKVKEFSIADRVYFPVRVSWETSAD  421

Query  412  -------------------GGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGER  452
                               G     +       P  K  TF    DN   +  +  E  +
Sbjct  422  ISVPMETGDDNEDGDLGNDGANSIVIFTHADEYPKTKRITFRR--DNSFSIDAKYDESAK  479

Query  453  SMTRDNHLL--GKFNLDAIPPMPRG--VPQIDVTFDIDANGILNVSAVE-----------  497
            ++   ++ L  GKF +   P + +G  +P+I V    D NG++ +++ +           
Sbjct  480  ALLPPDYDLAIGKFTVSGFPELEKGGEIPKIRVNIQHDLNGLVGIASSQLMQELKEEKPV  539

Query  498  -----------------------------KSTGKENKITITNDKGRLSQSDIDRMVAEAE  528
                                         K   ++ ++ I ++   L+ +++++      
Sbjct  540  EEPKEAQESDEKKEKKEGEQAEEKASEPKKKRFRKVELKIESEIKGLNVAEVNKATETEL  599

Query  529  KYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDA  588
            +   +D   +     +N LE++ Y +RN ++D +L++ I E +K  ++  + E  +WL  
Sbjct  600  EMAHQDRIIEETCNKRNELESFVYEMRNQISD-RLRDFITEEEKAKLESSLAEAEEWLYT  658

Query  589  HQSAETEE--YESKQKELEGVANPI  611
             +  ++ +  Y++K   L  ++ PI
Sbjct  659  DEGFDSVKSVYQTKLDGLRKLSAPI  683

>PHYCA_504114
Length=887

 Score = 233 bits (594),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 133/396 (34%), Positives = 216/396 (55%), Gaps = 21/396 (5%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+DLG  +  +  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDLGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  71   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
                +RL+G + SDP V +  D +H+P++L   A     I+++  G+S+TF  EE+ +MV
Sbjct  88   YAQIRRLLGTRLSDPQVSSLLDEEHFPYELVQNATRGGTISLKH-GKSQTFHAEELVAMV  146

Query  129  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  188
                R++ + F    VK+ V+TVP++F+ +QRQA  DA  I+G+ VL +INE TAAA+  
Sbjct  147  FAHARQITDTFAEAAVKDWVLTVPSFFSQAQRQALLDAAEISGVRVLSLINENTAAALQL  206

Query  189  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  231
             +    D +   + +L +++G  +  VS+      +             F+  + A D  
Sbjct  207  AVHASYDPEDKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWDES  266

Query  232  LGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSL  291
            LGG  FD RL +H   EF  K  +DI    R + ++R   ++ K  LS++ +  + + SL
Sbjct  267  LGGAKFDLRLAEHLATEFSEKIGEDIRKIPRPMAKIRAQAKKTKTVLSANEEIPVVMQSL  326

Query  292  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  351
            ++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG  R+PK+Q
Sbjct  327  YNDIDFFTSMTRSKLEELSSDLFDRTLKPVETALEKAGLTAADIDEIEIIGGGVRMPKIQ  386

Query  352  QLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            Q LSEFF+GK+    +N DEA+A GA  +AA L  +
Sbjct  387  QQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

 Score = 38.5 bits (88),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 52/95 (55%), Gaps = 8/95 (8%)

Query  522  RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN--DEKLKE-QIPEADKKVVDDK  578
            RM+ E EK  ++  AN   +EAKN+LE + Y   ++L+  + ++KE  +PE   + +  K
Sbjct  643  RMLNEMEKTDNKRRAN---LEAKNSLETFIYKAHDALSAQESQIKEVTVPE-QVESLQRK  698

Query  579  VTETIQWL-DAHQSAETEEYESKQKELEGVANPIL  612
            + ET +WL D     E  EY+ K  EL    + IL
Sbjct  699  LEETEEWLYDDGDKVEAAEYKKKMDELNKDLSAIL  733

>HYAP_07918
Length=897

 Score = 231 bits (588),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 136/396 (34%), Positives = 212/396 (54%), Gaps = 21/396 (5%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+DLG+ +  V  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  29   GVDLGSEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRKPQTA  88

Query  71   VFDAKRLIGRKFSDPIVQADI--KHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
                +RL+G K SDP V + +  +H+P++L S A     I ++   ++ TF  EE+ +MV
Sbjct  89   YAQIRRLLGTKLSDPQVVSLLTDEHFPYQLVSNATRGGAIALKHANDA-TFHAEELVAMV  147

Query  129  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  188
            L   R++   F    VK+ V+TVP +F+ +QRQA  DA  IAG+ VL +IN+ TAAA+  
Sbjct  148  LTHARQITNTFAEVPVKDYVLTVPTFFSQAQRQALLDAAEIAGVRVLSLINDNTAAALQL  207

Query  189  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  231
             +    D     + VL ++LG     VS+ ++   +             FE  + A D  
Sbjct  208  AVHTSYDPTEAPKRVLFYNLGSTALQVSIAAMSSQVVPDGFKKNKTVSTFETLSNAWDES  267

Query  232  LGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSL  291
            LGG  FD RL +H   EF ++  +DI    RA+ ++R    + K  LS++ Q  + + SL
Sbjct  268  LGGSKFDLRLAEHLATEFSQQIGQDIRTVPRAMAKIRAQAMKTKTVLSANEQIPVVMQSL  327

Query  292  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  351
             + +DF +++TR + E++  D F +T++PVE+ L  A L+ + + E+ L+GG  R+PK+Q
Sbjct  328  HNDVDFFTSMTRTKLEELSSDLFERTLKPVEQALEKAGLTVADIDEIELIGGGVRMPKIQ  387

Query  352  QLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
              LS+FF GK+    +N DEA+A GA  +AA L  +
Sbjct  388  HQLSQFFAGKDLGVHLNGDEAMALGAAFRAANLSNS  423

 Score = 35.4 bits (80),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 50/95 (53%), Gaps = 8/95 (8%)

Query  522  RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN---DEKLKEQIPEADKKVVDDK  578
            +M+ E E   ++  AN   +EAKN+LE + Y   ++++   DE  +  +PE   + +  K
Sbjct  649  QMLTEMENADNKRHAN---LEAKNSLETFIYKTHDAISAHEDEMKQVTVPE-QIEALKKK  704

Query  579  VTETIQWL-DAHQSAETEEYESKQKELEGVANPIL  612
            + ET +WL D  +  E  EY+ K   L+   + IL
Sbjct  705  LEETEEWLYDDGERVEAVEYKKKMDALDSDLSAIL  739

>PITG_15771
Length=883

 Score = 229 bits (584),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 133/396 (34%), Positives = 213/396 (54%), Gaps = 21/396 (5%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  71   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
                +RL+G   SDP V +  D +H+P++L   A     I+++  G+ +T+  EE+ +MV
Sbjct  88   YAQIRRLLGTTLSDPQVSSLLDEEHFPYELIQNATRGGTISLKH-GKEQTYHAEELVAMV  146

Query  129  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  188
                R++ + F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+  
Sbjct  147  FTHARQITDTFAEAPVKDWVLTVPTFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQL  206

Query  189  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  231
             +    D +   + +L F++G  +  VS+      +             F+  + A D  
Sbjct  207  AVHASYDPEDKPKKILFFNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWDES  266

Query  232  LGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSL  291
            LGG  FD RL +H  +EF  K  +DI    R + ++R   ++ K  LS++ +  + + SL
Sbjct  267  LGGAKFDLRLAEHLAKEFSDKIGEDIRKVARPMAKIRALAKKTKTVLSANEEIPVVMQSL  326

Query  292  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  351
            ++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + EV ++GG  R+PK+Q
Sbjct  327  YNDIDFFTSMTRSKLEELSSDLFERTLKPVEVALEKAGLTAADIDEVEIIGGGVRMPKIQ  386

Query  352  QLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            Q LSEFF+GK+    +N DEA+A GA  +AA L  +
Sbjct  387  QQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

>PYAP_19741
Length=885

 Score = 229 bits (583),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 136/405 (34%), Positives = 212/405 (52%), Gaps = 21/405 (5%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  59
            +A A  S    G+D G  +  +  V      EI+ N    R T + VAF   ERL G  A
Sbjct  17   LAPAAVSANVAGVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADA  76

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGES-  116
                           +R +G    DP + + ++  ++P++L     +  + TV  K E+ 
Sbjct  77   ATVGVRRPQTCYAQVRRFLGTTPEDPAIASLLQEEYFPYELLQ---NDTRGTVALKHEND  133

Query  117  KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLR  176
            + F  EE+ +MV    R++ +AF    VK+ V+TVP +F  +QRQA  DA  I+G+  L 
Sbjct  134  QVFHAEELVAMVFTHARQITDAFAEVPVKDWVLTVPDFFTQAQRQAMLDAAEISGVRALS  193

Query  177  IINEPTAAAIAYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FE  222
            +INE TAAA+   +     E R VL +++G  +  VS++     +             FE
Sbjct  194  LINENTAAALQLAVHSTFPEPRRVLFYNMGSTSLQVSIVEFSSQVVPDGFKKNKTVSGFE  253

Query  223  VKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA  282
            V + A D  LGG  FD RL +H   EF  K  +D+    R + ++R   ++ K  LS++ 
Sbjct  254  VLSKAWDPLLGGAKFDLRLAEHLAAEFSEKLGEDVRQIPRPMAKIRAQAKKTKIVLSANE  313

Query  283  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  342
            Q  + + SL+  IDF +++TR +FE+MC D F + M+PVE+ L  A L+ + +HE+ ++G
Sbjct  314  QIPVVMQSLYKDIDFFTSMTRGKFEEMCKDLFAQAMKPVEQALEKAGLTPADIHEIEIIG  373

Query  343  GSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            G  R+PK+QQ L EFF+GK+    +N DEA+A GA   AA L  +
Sbjct  374  GGVRMPKIQQQLKEFFSGKDLGVHLNGDEAMALGAAFHAANLSNS  418

>PHYRA_82545
Length=806

 Score = 227 bits (579),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/391 (34%), Positives = 211/391 (54%), Gaps = 16/391 (4%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ ++    +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQELAQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  131  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+A+G
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAFG  183

Query  190  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSVVAFVQGRLTVKSAAFDRFLGGRDFDMVIA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
                 +F  K++ +  +N ++  +L +ACE+AK+ LS       ++ I+ L D  D+N+ 
Sbjct  244  KDVATKFADKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNAQ  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFN-  359
            +T   FE +      +  +PVE+ L+DA + KSQ+  V +VGG TR+  V++ L+E    
Sbjct  304  VTLEEFETLIAPLLERLDDPVERALKDAGIDKSQLTNVEIVGGGTRVTSVKRHLAEVLGL  363

Query  360  GKEP-----NKSINPDEAVAYGATVQAAILG  385
             KE      + ++N DE+VA G  +  AIL 
Sbjct  364  DKEQQNFGLSSTLNADESVARGCALNCAILS  394

>H310_06229
Length=800

 Score = 227 bits (578),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 132/392 (34%), Positives = 213/392 (54%), Gaps = 18/392 (5%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKFS P VQ +IK++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIKNYGFKCVELPSGQVGIVLNYNDNPVTYTCEQVVAMMLN  123

Query  131  KMREVAEAFIGKEVKNA--VITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  188
            K++ +A A   + V+ A  V++ P YF D QR+A  +A  IAGLN LR++NE TA A+ Y
Sbjct  124  KLQNIA-AVANENVRPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGY  182

Query  189  GLDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  241
            G+ K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L
Sbjct  183  GIYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFAL  242

Query  242  VDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNS  299
                 ++F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S
Sbjct  243  AKDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSALNIECLVDEIDYAS  302

Query  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEF--  357
             ++   FE +      +   P++  L DA L+  ++  V +VGG  R+  V++ L++   
Sbjct  303  KVSLEEFETLIAPLLERLEAPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLADILG  362

Query  358  FNGKEPN----KSINPDEAVAYGATVQAAILG  385
             + ++PN     ++N DEAVA G  +Q AIL 
Sbjct  363  LDKEKPNMGLSTTLNADEAVARGCALQCAILS  394

 Score = 39.3 bits (90),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 49/99 (49%), Gaps = 3/99 (3%)

Query  515  LSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKV  574
            LS S++ R   +      +D   +     +N LE + Y +RN L  EK  E +  AD++ 
Sbjct  574  LSSSEVTRASEDELAMAQQDRVIEETANKRNELETFVYDMRNHLG-EKYSEFVSTADRES  632

Query  575  VDDKVTETIQWLDAHQSAETEE--YESKQKELEGVANPI  611
             + K+ +   WL + +  ++ +  Y++K  EL  V+ PI
Sbjct  633  FEAKLNDMEDWLYSDEGFDSTKSVYQAKLDELRVVSKPI  671

>PHYRA_73661
Length=884

 Score = 227 bits (578),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 137/398 (34%), Positives = 216/398 (54%), Gaps = 25/398 (6%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  69
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  27   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVGVRRPQ  84

Query  70   TVFDA-KRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            T +   +RL+G   SDP V A  D +H+P+ L   A     I+++  G+ + FQ EE+ +
Sbjct  85   TAYSQIRRLLGTTLSDPQVSALLDEEHFPYDLVQNASRGGTISLKH-GKDQAFQAEELVA  143

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MV    R++   F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  144  MVFAHARQITNTFAEAPVKDWVLTVPTFFSQAQRQALLDAAEISGVRVLSLINENTAAAL  203

Query  187  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  229
               +    D +   + +L ++LG  +  VS+      +             FE  + A D
Sbjct  204  QLAVHASYDPEDKPKKILFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTISTFETISNAWD  263

Query  230  THLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEID  289
              LGG  FD RL ++   EF  K  +DI    R + ++R   ++ K  LS++ +  + + 
Sbjct  264  ESLGGAKFDLRLAEYLATEFSEKIGEDIRKVARPMAKIRAQAKKTKTVLSANEEIPVVMQ  323

Query  290  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  349
            SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ L+GG  R+P+
Sbjct  324  SLYNDIDFFTSMTRSKLEELSADLFERTIKPVEVALEKAGLTVADIDEIELIGGGVRMPR  383

Query  350  VQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            +QQ LSEFF GK+ +  +N DEA+A GA  +AA L  +
Sbjct  384  IQQQLSEFFEGKDLSVHLNGDEAMALGAAFRAANLSNS  421

 Score = 35.0 bits (79),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%), Gaps = 8/100 (8%)

Query  517  QSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN--DEKLKE-QIPEADKK  573
            + D  RM+ E EK  ++  AN   +EAKN+LE + Y   ++L+  + ++K+  +PE   +
Sbjct  641  KKDSMRMLTEMEKADNKRSAN---LEAKNSLETFIYKAHDALSAQESQIKQVTVPE-QVE  696

Query  574  VVDDKVTETIQWL-DAHQSAETEEYESKQKELEGVANPIL  612
             +  K+ ET +WL +  +  +  EY+ K   L+   + IL
Sbjct  697  SLQSKLEETEEWLYEDGEKVDAAEYKKKMDTLDSDLSAIL  736

>H257_16484
Length=795

 Score = 225 bits (574),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 131/390 (34%), Positives = 211/390 (54%), Gaps = 16/390 (4%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKFS P VQ +I+++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIQNYGFKCVELPSGQVGIVLNYNDNPVTYSCEQVVAMMLN  123

Query  131  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            K++ +A  A  G      V++ P YF D QR+A  +A  IAGLN LR++NE TA A+ YG
Sbjct  124  KLQNIAAVANDGVNPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGYG  183

Query  190  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L 
Sbjct  184  IYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFALA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
                ++F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S 
Sbjct  244  KDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSVLNIECLVDEIDYASK  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEF--F  358
            ++   FE +     ++   P++  L DA L+  ++  V +VGG  R+  V++ L+E    
Sbjct  304  VSLDEFETLIAPLLQRLEGPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLAEILGL  363

Query  359  NGKEPN----KSINPDEAVAYGATVQAAIL  384
            + ++PN     ++N DEAVA G  +Q AIL
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAIL  393

>CCA27145
Length=463

 Score = 218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 139/403 (34%), Positives = 208/403 (52%), Gaps = 35/403 (9%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  67
            + +GIDLGTTYS V + Q++ V II +   +   PS V F  +   L+G  A+     + 
Sbjct  57   HVIGIDLGTTYSVVAISQHNNVTIIPDRHHHTLIPSIVTFLPEGALLVGRQARAYRTKDP  116

Query  68   HNTVFDAKRLIGRKFSDPIVQADIKHW---PFKLTSGAGDK----PQITVQFKGESKTFQ  120
             +T+++AKR IGR +++ I  A+   +   PF+  S +  +    P  ++   G      
Sbjct  117  RHTIYNAKRFIGRSYNESIQAAEPYGFSIEPFRNESASEPESLPGPCFSLSVSGHPACVT  176

Query  121  PEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179
            P EI S+++  +  +A  F+   ++   VI VP  F  +QR+AT  A   AGL V R++ 
Sbjct  177  PIEIGSLIIRHLHLMAHEFVKHNQLDRVVIAVPVDFKPAQRRATVQAYEKAGLKVARVLE  236

Query  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239
            EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G   V  T GD +LGGED DN
Sbjct  237  EPTAAAIAYGLHQAPNVNFILVFDFGGGTLDVSLLFVRSGSISVVDTLGDNNLGGEDLDN  296

Query  240  RLVDHFTQEFKRKHRKDI---------TDNQR---------ALRRLRTACERAKRTLSSS  281
             + +H T + +      +         TD+++          +  +R A E  KR LS S
Sbjct  297  LVSNHLTSQLEALLGMKLAEASSEVMETDSEKNEDPDQLPCTIAGIRRAAEILKRKLSFS  356

Query  282  AQAYIEIDSLFDGIDF-------NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQ  334
              A         G            +++R  FE +C     + + PV ++LRD  ++   
Sbjct  357  DSAIASCIVQEPGGKLIPQDNRVEISMSRIEFEALCEPILERALIPVRQILRDNHMNPKS  416

Query  335  VHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            + EVVLVGGS+RIP +   L E F GK+P  +I+PD AVA+GA
Sbjct  417  IDEVVLVGGSSRIPWIHTQLEELF-GKQPRITIDPDVAVAFGA  458

>PHYKE_6664
Length=804

 Score = 224 bits (570),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/390 (33%), Positives = 210/390 (54%), Gaps = 16/390 (4%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    ++    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYECVELASGDVGIVLSYNDEPVTFSCEQVVAMILN  123

Query  131  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+A+G
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALMNATKIAGLNCLRLINEHTAIALAFG  183

Query  190  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K           ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
                ++F  K++ D   + ++  +L +ACE+AK+ LS       +I I+ L D  D+N+ 
Sbjct  244  QDVAKKFAEKYKTDPLAHPKSRLKLLSACEKAKKNLSPYGVTATHINIECLADDRDYNAQ  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360
            ++   FE +     ++   P+E+ L+DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  VSLEEFEVLIAPLLKRLDGPIERALKDAGIDKSQLTSVEIVGGGTRVTSVKRQLADVLGL  363

Query  361  KEPNK------SINPDEAVAYGATVQAAIL  384
             +  +      ++N DE+VA G  +  AIL
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAIL  393

>PHYSO_255506
Length=1228

 Score = 227 bits (578),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 136/398 (34%), Positives = 218/398 (55%), Gaps = 25/398 (6%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  69
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  364  GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAAT--VGVRRPQ  421

Query  70   TVF-DAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            T +   +RL+G   SDP V A  D +H+P++L   A     +++Q   + + F  EE+ +
Sbjct  422  TAYAQIRRLLGTTLSDPQVAALLDEEHFPYQLLQNATRGGTVSLQH-AKDRVFHAEELVA  480

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MV    R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TA+A+
Sbjct  481  MVFAHARQITDTFAEAPVKDWVLTVPAFFSQAQRQAMLDAAEISGVRVLSLINENTASAL  540

Query  187  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  229
               +    D +   + +L +++G  +  VS+      +             F+  + A D
Sbjct  541  QLAVHASYDPEDKPKRILFYNMGSTSLQVSVAEFSSQVVPDGFKKNKTISTFQTLSNAWD  600

Query  230  THLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEID  289
              LGG  FD RL +H  +EF  K  +DI    R + ++R   ++ K  LS++ +  + + 
Sbjct  601  ESLGGAKFDLRLAEHLAKEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEIPVVMQ  660

Query  290  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  349
            SL++ IDF ++ITR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG  R+PK
Sbjct  661  SLYNDIDFFTSITRSKLEELSADLFDRTLKPVEVALEKAGLTVADIDEIEIIGGGVRMPK  720

Query  350  VQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            +QQ LSEFF+GK+    +N DEA+A GA  +AA L  +
Sbjct  721  IQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  758

 Score = 36.2 bits (82),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 52/95 (55%), Gaps = 8/95 (8%)

Query  522   RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN--DEKLKE-QIPEADKKVVDDK  578
             RM+ E EK  ++  AN   +EAKN+LE + Y   ++L+  + ++KE  +PE   + +  K
Sbjct  982   RMLTEMEKADNKRRAN---LEAKNSLETFIYKAHDALSAQESQIKEVTVPE-QVESLQTK  1037

Query  579   VTETIQWL-DAHQSAETEEYESKQKELEGVANPIL  612
             + ET +WL D     +  EY+ K   L+   + IL
Sbjct  1038  LEETEEWLYDDGDKVDAAEYKKKMDALDSDLSAIL  1072

>PHYKE_9011
Length=902

 Score = 223 bits (567),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/398 (33%), Positives = 217/398 (55%), Gaps = 25/398 (6%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  69
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAA--TVGVRRPQ  85

Query  70   TVFDA-KRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            T +   +RL+G K  +P V+A ++  H+P+ L         ++++ + +   +Q EE+ +
Sbjct  86   TAYQQIRRLLGTKLENPQVKALLEEEHFPYNLLQNVTRGGTVSLKHR-DGHIYQAEELVA  144

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MV    R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  145  MVFTHARQITDTFAEAAVKDWVVTVPAFFSQAQRQALLDAAEISGVRVLSLINENTAAAL  204

Query  187  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  229
               +    D +   R +L +++G  +  VS+      +             F+  + A D
Sbjct  205  QLAVHASYDPEDKPRRILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWD  264

Query  230  THLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEID  289
              LGG  FD RL +H   EF  K  +D+    R + ++R   ++ K  LS++ +  + + 
Sbjct  265  ESLGGARFDLRLAEHLATEFSEKIGEDVRKVPRPMAKIRAQAKKTKMVLSANEEIPVVMQ  324

Query  290  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  349
            SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ LVGG  R+PK
Sbjct  325  SLYNDIDFFTSMTRSKLEELSADLFERTLKPVEVALEKAGLTVADIDEIELVGGGVRMPK  384

Query  350  VQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            +QQ L+EFF+GK+    +N DEA+A GA  +AA L  +
Sbjct  385  IQQQLAEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

 Score = 37.7 bits (86),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 54/98 (55%), Gaps = 8/98 (8%)

Query  522  RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN---DEKLKEQIPEADKKVVDDK  578
            RM+ E EK  ++ +AN   +EAKN+LE + Y   ++L+    E  K  +PE   + +  K
Sbjct  648  RMLKEMEKADNKRKAN---LEAKNSLETFIYKAHDALSAQESEIKKVTVPE-QVESLQTK  703

Query  579  VTETIQWL-DAHQSAETEEYESKQKELEGVANPILQKM  615
            + ET +WL +    A+  EY+ K  +L+   + IL ++
Sbjct  704  LEETEEWLYEDGDKADAAEYKKKMSDLDSDLSAILSRV  741

>PYAP_21865
Length=481

 Score = 214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 142/410 (35%), Positives = 203/410 (50%), Gaps = 45/410 (11%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  68
            ++VGIDLGTTYS V + QN+ V +I ++ G+  TPS VA+    R    A + +   +  
Sbjct  71   HTVGIDLGTTYSVVAISQNNSVTVIPDEHGHLITPSIVAYLPNGRREARAYRTK---DPR  127

Query  69   NTVFDAKRLIGRKFSDPIVQADIKHWPFKLT-SGAGDKPQITVQFK----GESKTFQPEE  123
            +T+F+AKR IGR F D    A    WP++ T    G+    TV F+    G      P +
Sbjct  128  HTIFNAKRFIGRSFRDVSDDASTT-WPYEFTIKRYGEHDNATVCFELETVGHPNCISPVD  186

Query  124  ISSMVLIKMREVAEAFIGK-------------------EVKNAVITVPAYFNDSQRQATK  164
            + + ++  ++ +A  F+G                    ++  AVI VP  F+  QR AT 
Sbjct  187  VGTRIVQHLKTLAWRFVGHNQMGMIDNLLSGLTHNYCGQINRAVIAVPVDFDSKQRSATV  246

Query  165  DAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVK  224
             A   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V 
Sbjct  247  AAFNAAGLKVSRVLEEPTAAAIAYGLHQDASVNFILVFDFGGGTLDVSLLFARSGSISVI  306

Query  225  ATAGDTHLGGEDFDNRLVDHFTQEFKRK-------------HRK-DITDNQRALRRLRTA  270
             T GD +LGGED D  +  H  Q  + K             H + D   +  AL   +  
Sbjct  307  DTMGDNNLGGEDLDAAIAHHLIQNLEVKLGAVSSGGSGVDAHEQLDHDGDSEALPCTKAG  366

Query  271  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTI---TRARFEDMCGDYFRKTMEPVEKVLRD  327
              RA   L  S  + +E  +     D N  I   +R   E +C    ++T+ PV ++L  
Sbjct  367  IRRAAEMLKRSLSSSLEASASCLTTDNNRVIMAMSRYELESICEAILKRTLVPVREILEA  426

Query  328  AKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
              ++   +  VVLVGGSTR+P V++ L+  F G+ P   I+PD AVAYGA
Sbjct  427  NSMTIQDIDAVVLVGGSTRLPWVRRELTAMFGGRPPLTDIDPDVAVAYGA  476

>PYU1_G000896
Length=711

 Score = 218 bits (556),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 168/566 (30%), Positives = 283/566 (50%), Gaps = 69/566 (12%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEI----------IANDQGNRTTPSYVAFTDTERLIGDA  58
            + +GID GT + C      D + +          I +++     P++V+ TDT  LIG  
Sbjct  58   WVLGIDFGT-HLCSAAVSRDGIVVDVPVPGDAAAIDDNKSPLAVPAFVSVTDTGYLIGTE  116

Query  59   AKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES--  116
            A+        NTVFD  RL+GRK  D +  AD   WPF + +G  DK  + +     S  
Sbjct  117  ARTLARRGDLNTVFDLTRLVGRKVGD-LSDADQARWPFHVVAGDHDKVLVAILGTNNSVS  175

Query  117  --KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNV  174
              +   PEE+ +++ ++++E AEA +  +++ AV+ VP  FN +QR+A ++AG IAGL+V
Sbjct  176  NPRKLYPEELLAVLFLQLKENAEALLHTKLQTAVLCVPEGFNHTQRRAVRNAGMIAGLSV  235

Query  175  LRIINEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIE-EGIFEVKATAGD  229
             R++   TAAA+++G+          R ++  D+G    +++L++++   +FEVKA A D
Sbjct  236  TRLVCAATAAAVSFGIGSSVPSSLSTRVIMTVDIGASATNMALVAVKNRTVFEVKAVASD  295

Query  230  THLGGEDFDNRLVDHFTQEFKRKHRK------------DITDNQ-RALRRLRTACERAKR  276
             +LGG D    +V H  +       +            D +++Q   +R++R A E AK+
Sbjct  296  LNLGGHDLTEAIVAHCQRRRPTPSPRFCVSSASASTPADTSESQLHGMRQIRHASEVAKK  355

Query  277  TLSSSAQAYIEIDSLFDGIDFN-STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  335
             LS+S  A + ID   D   F    +TRA FE +C +++++  E + ++L+++  +K  +
Sbjct  356  LLSTSTNAVVGID-FPDPSAFGYYNVTRACFEALCEEHWQRIRELMNQLLQESLATKEGI  414

Query  336  HEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAY-----GATVQAAILGGNdss  390
              +VL+GGS  IP+VQ L+ E F          P   V Y      +   AA+ GG   +
Sbjct  415  DAIVLLGGSAWIPRVQTLVQESF----------PLHHVLYTPEDVSSARGAALCGGKSRN  464

Query  391  dklqdlllld-----vtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLI  445
             +             VT L LG+++A G    +I  NT +P  K  +F  YA+ Q  V+ 
Sbjct  465  TQNGISTAPAVELPDVTLLPLGIQSANGTKIVMIPSNTKLPVHK--SFLYYANCQHAVVF  522

Query  446  QVFEGE------RSMTRDN-----HLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVS  494
             V EG        S++++      H L    +D        V +ID+TFD+D    + V+
Sbjct  523  HVIEGRVFNIKPGSLSKNPASAALHELASVRVDGRHATTHVVLKIDITFDVDTLDQIIVT  582

Query  495  AVEKSTGKENKITITNDKGRLSQSDI  520
            A E+S+G++  + I  D+  LS + I
Sbjct  583  ATERSSGRKVTVCIDGDETSLSVNAI  608

>PYAR_16202
Length=893

 Score = 221 bits (563),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 131/405 (32%), Positives = 207/405 (51%), Gaps = 21/405 (5%)

Query  1    MAQAKTSGYSVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  59
            M  +  +    G+D G  +  + + +     EI+ N    R T + VAF   ERL G  A
Sbjct  22   MGPSPVAASVAGVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGEERLYGADA  81

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGES-  116
                           +R +G    DP + A I+  ++P++L     +  + TV  K +  
Sbjct  82   ATVGVRRPQTCYAQIRRFLGTTKEDPAISALIQDEYFPYELLH---NDTRGTVALKHDKG  138

Query  117  KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLR  176
            + F  EE+ +MV    R + +AF    VK+ V+TVP +F  +QRQA  DA  I+G+  L 
Sbjct  139  QVFSAEELVAMVFTHARHITDAFAEVPVKDWVVTVPDFFTQAQRQAMLDAAEISGVRALS  198

Query  177  IINEPTAAAIAYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FE  222
            ++NE TAAA+   +     E R VL ++LG  +  VS+      +             FE
Sbjct  199  LLNENTAAALQLAVHSTFAEPRRVLFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTVSGFE  258

Query  223  VKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA  282
            V + A D  LGG  FD RL +H   EF  K  +D+    R + ++R   ++ K  LS++ 
Sbjct  259  VLSKAWDASLGGAKFDLRLAEHLAAEFSEKLGEDVRQLPRPMAKIRAQAKKTKIVLSANE  318

Query  283  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  342
            Q  + + SL+  +DF +++TR++ E++C D F + M+PVE+ L  A L K  +HE+ ++G
Sbjct  319  QIPVVMQSLYKDVDFFTSMTRSKLEEICKDLFAQAMKPVEQALEKAGLKKDDIHEIEIIG  378

Query  343  GSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            G  R+PK+QQ L +FF GK+    +N DEA+A GA   AA L  +
Sbjct  379  GGVRMPKIQQQLKDFFEGKDLGVHLNGDEAMALGAAFHAANLSNS  423

 Score = 37.4 bits (85),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 6/102 (6%)

Query  517  QSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSL--NDEKLKEQIPEADKKV  574
            + D  RM+ E E   ++  AN   +EAKN LE+Y Y+ R++L   +E+          + 
Sbjct  647  KKDSMRMLREMELADNQRRAN---LEAKNKLESYVYTARDTLGAQEEEFTAVTTSEQLEK  703

Query  575  VDDKVTETIQWL-DAHQSAETEEYESKQKELEGVANPILQKM  615
            +  K+ ET +WL D  +     EY  K K L+   + IL ++
Sbjct  704  LRTKLEETEEWLYDEGEKVSAAEYNKKVKSLDTDFSAILFRI  745

>SDRG_03266
Length=792

 Score = 216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 204/390 (52%), Gaps = 16/390 (4%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFSCEQVVGMFLN  123

Query  131  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A  A  G      VI+ P YF D QR+A   A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSASKIAGMNCLRLMNEHTAVALSYG  183

Query  190  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFIDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
               +++F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEF--F  358
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+  V++ L++    
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  359  NGKEPN----KSINPDEAVAYGATVQAAIL  384
            + ++PN     ++N DEAVA G  +Q AIL
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAIL  393

>SPRG_08060
Length=793

 Score = 215 bits (547),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 204/390 (52%), Gaps = 16/390 (4%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFTCEQVVGMFLN  123

Query  131  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A  A  G      VI+ P YF D QR+A   A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSAAKIAGMNCLRLMNEHTAVALSYG  183

Query  190  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFVDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  243  DHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  300
               +++F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEF--F  358
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+  V++ L++    
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  359  NGKEPN----KSINPDEAVAYGATVQAAIL  384
            + ++PN     ++N DEAVA G  +Q AIL
Sbjct  364  DKEKPNMGLSTTLNADEAVARGCALQCAIL  393

>PHYSO_247517
Length=794

 Score = 214 bits (544),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 176/646 (27%), Positives = 301/646 (47%), Gaps = 87/646 (13%)

Query  46   VAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDK  105
            V     +R IG+AA +   M+  NT  D KRLIGRKF  P VQ +I    +K    A   
Sbjct  24   VCVQGKQRFIGEAAISMARMHYKNTATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGD  83

Query  106  PQITVQFKGESKTFQPEEISSMVLIKMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATK  164
              I + +  E  TF  E++ +M+L KM+ +A A   G      V++ P ++ D QR+A  
Sbjct  84   VGIVLNYNDEPVTFSCEQVVAMILNKMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALL  143

Query  165  DAGAIAGLNVLRIINEPTAAAIAYGLDK-------KGGERNVLIFDLGGGTFDVSLLSIE  217
            +A  IAGLN LR+INE TA A+AYG+ K       +   ++V+  DLG  ++ VS+++  
Sbjct  144  NATKIAGLNCLRLINEHTAIALAYGIYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFV  203

Query  218  EGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRT  277
            +G   VK+ A D  LGG DFD  +      +F  K++ +  +N ++  +L +ACE+AK+ 
Sbjct  204  QGRLTVKSAAFDRFLGGRDFDMVIAKDAAAKFAAKYKTNPLENPKSRIKLLSACEKAKKN  263

Query  278  LSSSA--QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  335
            LS       ++ I+ L D  D+NS +T   FE++      +   P+E+ L DA + KSQ+
Sbjct  264  LSPYGVTATHLNIECLADDRDYNSQVTLEEFEELIAPLLTRLDGPIERALADAGVEKSQL  323

Query  336  HEVVLVGGSTRIPKVQQLLSEFFNGKEPNK------SINPDEAVAYGATVQAAILG----  385
              V +VGG TR+  V++ L+E     +  +      ++N DE+VA G  +  AIL     
Sbjct  324  ANVEIVGGGTRVTSVKRHLAEVLGLDKEQQNYGLSTTLNADESVARGCALNCAILSPMFK  383

Query  386  -------------------GNdssdklqdlllldvtplslglETAGGVMTTLIARNTTVP  426
                               G+ S+         DV   +   E +  V   +++R    P
Sbjct  384  VKEFSVTDRVHLPVRVSWDGSASTATDAADDDEDVNMETPASEDSSLV---ILSRKDEYP  440

Query  427  TKKAQTFSTYADNQPGVLIQVF-EGERSMTRDNHLL--GKFNLDAIPPMPRG--VPQIDV  481
              K  TF     ++P  +  V+ E  ++    ++++  GKF +  +P    G  +P+I V
Sbjct  441  KTKRITFRR---DKPFSIDAVYDESAKAYLPPDYVMDIGKFTVSGMPAQEAGAEIPKIRV  497

Query  482  TFDIDANGILNVSAVE----------------------------------KSTGKENKIT  507
                D NG+ ++++ +                                  K   ++ ++T
Sbjct  498  NVQQDMNGLFSIASSQLMQEIKEEEKPAEAEGEEKKEGEEKKEDKPAEPKKKRFRKIELT  557

Query  508  ITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEQI  567
            +    G LS +D+     +  K   +D   +     +N LE++ Y +RN + D KL   I
Sbjct  558  VQAQVGGLSAADLTTATEQELKMAQQDRVIEETFNKRNELESFVYEMRNQITD-KLAGFI  616

Query  568  PEADKKVVDDKVTETIQWLDAHQSAETEE--YESKQKELEGVANPI  611
               +K  ++ K+ ET  WL   +  ++ +  Y+ K  +L  +++P+
Sbjct  617  TSEEKGNLEAKLMETEDWLYTDEGFDSTKSVYQQKLDDLRKLSSPV  662

>PHYSO_285382
Length=379

 Score = 202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 130/353 (37%), Positives = 180/353 (51%), Gaps = 28/353 (8%)

Query  52   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKH---WPFKLT-----SGAG  103
            E ++G  A+     +  +T+F+AKR IGR F D + ++++      P++ T       A 
Sbjct  23   EVIVGRKARAHRTTDPTHTIFNAKRFIGRSFDD-VGESEVDSNGVSPYEFTVKPVLDNAH  81

Query  104  DKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQA  162
            D     + F G+     P +I S V+  +R +A  F+G  ++  AVI VP  FN  QR A
Sbjct  82   DGVCFALGFPGQQDCVTPVQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVDFNARQRDA  141

Query  163  TKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  222
            T  A  +AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   
Sbjct  142  TVAAFRVAGLEVSRVLEEPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAIS  201

Query  223  VKATAGDTHLGGEDFDNRLVDHFTQEF----------------KRKHRKDITDNQRALRR  266
            V  T GD HLGGED D  L     +EF                ++    D TD    L  
Sbjct  202  VLDTLGDNHLGGEDVDALLTAWLVREFEAQIGSRITSRGVEGEEKSLDDDATDPPCTLAG  261

Query  267  LRTACERAKRTLS--SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKV  324
            +R A E  KR L+  ++A A                 +RA+FE++CG    +TM PV  V
Sbjct  262  VRRAAELLKRRLTDATTASATCVWSEGGSKARVEVKASRAQFEELCGPLLERTMIPVRDV  321

Query  325  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            L    +   ++  VVLVGGS+RIP V+Q L+  F  + P  +I+PD AVAYGA
Sbjct  322  LEANNMETEEIDAVVLVGGSSRIPWVRQRLTTMFQDRAPLSTIDPDLAVAYGA  374

>PPTG_04054
Length=324

 Score = 200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 160/255 (63%), Gaps = 25/255 (10%)

Query  82   FSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIG  141
            FSD +++ D  ++ F       DK  I              EISSMV+++M E+AEAF+G
Sbjct  2    FSDKVMKKDATYFLFTTKESDDDKVLI--------------EISSMVVLRMSEMAEAFLG  47

Query  142  KEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGG----ER  197
            + +  AV+T PAYFN+ QRQ+TKD  +IAGL++ RI NE + AA+AYGLD   G      
Sbjct  48   QRISQAVVTAPAYFNNQQRQSTKDVVSIAGLDLQRINNETSVAALAYGLDTNAGTDGKAC  107

Query  198  NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRK-D  256
            NV IF LGGGT DVS+LSI     EVK+T GD+   GED DN +V H   EF+RK R  D
Sbjct  108  NVQIFVLGGGTVDVSILSIRVRHLEVKSTGGDS---GEDSDNNMVQHLLTEFERKIRNLD  164

Query  257  ITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST-ITRARFEDMCGDYFR  315
             + + RA   + TACE AKR L ++  A +E+ SLF+G++F+ST +TRA+FE +  + F+
Sbjct  165  PSGSARA--SVVTACESAKRMLLTTTSASVEVTSLFEGVEFSSTVVTRAKFESLNEELFK  222

Query  316  KTMEPVEKVLRDAKL  330
            +    V KVL DAK+
Sbjct  223  RCEVTVFKVLEDAKM  237

>CCA21519
Length=929

 Score = 213 bits (541),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 155/552 (28%), Positives = 260/552 (47%), Gaps = 77/552 (14%)

Query  12   GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+D G  Y  V + +  +  EI+ N    R T + VAF   ERL G  A        H  
Sbjct  41   GLDFGGEYFKVALVKPGKPFEIVTNVHSKRKTETMVAFDGEERLYGADADTIGVRRPHTG  100

Query  71   VFDAKRLIGRKFSDPIVQADI--KHWPFKLTSGAGDKPQITVQFKGE-SKTFQPEEISSM  127
                +R +G       + + I  +++P+ L++   ++ + ++  K E  K +  EE+ +M
Sbjct  101  YAQIRRFLGSSLDQYGIVSLILEEYYPYSLST---NEKRGSIHIKHEDEKHYHAEEVVAM  157

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            V   +R++ + F   +VK+ VITVP Y+  +QRQA  DA  +AGL VL +INE TAAA+ 
Sbjct  158  VFSHVRQITDVFAETDVKDYVITVPEYYTQAQRQAVLDAAELAGLRVLSLINENTAAALQ  217

Query  188  YGLD---KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  231
              +    +    + V+ ++ G  +  V++  +   +             F+V + A + H
Sbjct  218  LCIHTTLEPDTPKRVIFYNQGSTSLQVTIAELFSYVVPVGSSSNKTIIGFKVLSKAWNQH  277

Query  232  LGGEDFDNRLVDHFTQEFKRK---HRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEI  288
            LG    D RL +HF +EF  K   +++D+    + + +LR   ++ K  LS++ +  + +
Sbjct  278  LGSSQIDLRLAEHFAREFNEKVLHNKQDVRSLPKVMAKLRAQAKKTKIVLSANEEIPVVM  337

Query  289  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  348
             SL +  D  +T+TR   E++C D F + + PV + L  A L++  +HEV L+GG  R+P
Sbjct  338  QSLLEDYDLRTTVTRTLLEELCKDLFDQALGPVHEALEKANLTRQDIHEVELIGGGVRVP  397

Query  349  KVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtplslgl  408
            KVQ+LL EFFN  E    +N DEA+A GA  +AA L  +                     
Sbjct  398  KVQRLLKEFFNVPELGAHLNGDEAMALGAAFRAANLSNS------------FRVRPIQMT  445

Query  409  ETAG-GVMTTLIARNT-----TVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLG  462
            +TA  G+  TL   N      +  TK A  F+T   ++ G    V     S+T    +  
Sbjct  446  DTASYGIGATLADVNAEDGKDSSWTKHAPLFTTA--HRLGARKAV-----SLTHTRDMFC  498

Query  463  KFNLDAIPPMPRGV--------------------------PQIDVTFDIDANGILNVSAV  496
             F  D    +P GV                          P++ +TF +D++GI++++  
Sbjct  499  TFRYDQSVALPEGVSVFIGRYSISGIEAFYEQHLEKYLGDPKVTLTFLLDSSGIVSIAKA  558

Query  497  EKSTGKENKITI  508
            E S  +E +I +
Sbjct  559  EVSLEEEYQIEV  570

 Score = 35.4 bits (80),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 67/129 (52%), Gaps = 13/129 (10%)

Query  491  LNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR---IEAKNAL  547
            L V  VE+  G++ KI ++      SQ      +A  E  +  D A+  R   ++AKN L
Sbjct  631  LKVELVEERLGEKRKIGMSILPMSASQK-----IASVEMLREMDSADNKRKADLDAKNRL  685

Query  548  ENYAYSLRNSL--NDEKLKE-QIPEADKKVVDDKVTETIQWL-DAHQSAETEEYESKQKE  603
            E + YS R++L  +DE +++  +PE    V+  ++    +WL +    AE  EY++K+ +
Sbjct  686  EAFVYSARDTLESDDEVIRQVTLPEQVTTVL-AQLEAAEEWLYEDGDKAEASEYDAKRSD  744

Query  604  LEGVANPIL  612
            ++   + IL
Sbjct  745  MKTKLDEIL  753

>PYIR_25979
Length=438

 Score = 203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/400 (32%), Positives = 209/400 (52%), Gaps = 53/400 (13%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQ-------GNRTTPSYVAFTDTERLIGDAAKN  61
            +SVGIDLGT      + ++  V  ++ D+        N   PS+V+ TD+  L+G  A+ 
Sbjct  34   WSVGIDLGTQVCSAALIRDGIVIDVSFDEEQQQDSSPNLLLPSFVSATDSGFLVGADARR  93

Query  62   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES-----  116
            +      +TVFD  RL+GRK  D   Q  +  WPFK+  G  DK  I +           
Sbjct  94   RARSGDPSTVFDFVRLVGRKIEDLSSQDILCKWPFKVVPGENDKAMIEISAIDTKDSAST  153

Query  117  ------KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIA  170
                  +TF PEE+ + +++K+++ AEA +  +V++ V+ VP  FN SQR+A ++A  IA
Sbjct  154  STSDVIRTFHPEELVAALIMKIKQKAEALVSAKVESTVVCVPGGFNHSQRRAVRNACVIA  213

Query  171  GLNVLRIINEPTAAAIAYGLDKKGG-------ERNVLIFDLGGGTFDVSLLSIEEGIFEV  223
            GL V +I++  TAA  ++G+ ++          + VL  D+G  + D+SL+S+    FEV
Sbjct  214  GLRVEKILSAATAAVTSFGMKEQNAGTAAGIPTQVVLAVDVGASSTDISLVSVLANKFEV  273

Query  224  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDN--------------QRALRRLRT  269
            KA   +  LGG+DF  R+V H  ++  R+      +                +   ++R 
Sbjct  274  KAVDSNLDLGGDDFTERIVTHCRRKKSREEAAAAPEPGDTVKTASSQTHGYSKGASQIRQ  333

Query  270  ACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVE  322
            ACE AK+ LSSS  A +       GIDF +       T+TR  FE +C D ++  +E V 
Sbjct  334  ACELAKKLLSSSENAVV-------GIDFPASDTFGYYTVTRFCFEALCEDLWQSLVEKVH  386

Query  323  KVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKE  362
            +V+ ++ + K  ++ V+L+GGS++IP++Q L  E F  ++
Sbjct  387  RVIHESSVVKEDINAVLLMGGSSQIPRLQTLFKESFPSQQ  426

>PYIR_24220
Length=908

 Score = 211 bits (538),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 134/397 (34%), Positives = 221/397 (56%), Gaps = 25/397 (6%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  69
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G DAA   VA+    
Sbjct  31   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVAVRRPQ  88

Query  70   TVFDA-KRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  126
            T +   +R +G     P V + ++  ++P+ L   A  +  I+++   + K F  EE+ +
Sbjct  89   TAYSQIRRFLGATPDHPQVVSLLQEEYFPYTLLQNAT-RGTISLEHDNK-KVFHAEELVA  146

Query  127  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186
            MV    R++ +AF    VK+ VITVP++F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  147  MVFSHARQITDAFAEAPVKDWVITVPSFFSQAQRQAMLDAAEISGVRVLSLINENTAAAL  206

Query  187  AYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHL  232
             + +     E R +L +++G  +  VS+   +  +             F+V A A D +L
Sbjct  207  QHAVHSTFTEPRKILFYNMGSTSLQVSITEFKSEVVPDGFKKNKTVSGFQVLANAWDENL  266

Query  233  GGEDFDNRLVDHFTQEFKRK--HRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDS  290
            GG  FD +L +H  +EF +K  + +DI    R L ++R   ++ K  LS++ +  + + S
Sbjct  267  GGAKFDLQLAEHLAKEFNKKLGNGEDIRTIPRPLAKIRAQAKKTKIVLSANEEIPVVMQS  326

Query  291  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  350
            L+  +DF +++TR++FE++  D F +++EPV++ L  A LS S + E+ +VGG  R+PK+
Sbjct  327  LYKDMDFFTSMTRSKFEEINADLFARSLEPVKQALAKAGLSASDIDEIEIVGGGVRMPKI  386

Query  351  QQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            Q  L EFF+GK+    +N DEA+A G+  +AA L  +
Sbjct  387  QAQLKEFFSGKDLGVHLNGDEAMALGSAFRAANLSNS  423

>PYVX_15061
Length=891

 Score = 209 bits (532),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 130/397 (33%), Positives = 203/397 (51%), Gaps = 24/397 (6%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+DLG  +  V  V      EI+ N    R T + VAF   ERL G  A         + 
Sbjct  27   GVDLGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATIGVRRPQSA  86

Query  71   VFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +R +G    DP V A ++    P++L     D  + ++  K   K  F  EE+ +M
Sbjct  87   YAQVRRFLGATLDDPQVVALLEDERLPYELEQ---DLARGSIALKHSDKQLFHAEELVAM  143

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            V    R++ +AF    VK+ V+TVP YF+ +QRQA  DA  +AG+ VL +INE TAAA+ 
Sbjct  144  VFSHARQITDAFAEAPVKDWVVTVPVYFSQAQRQALLDAAELAGVRVLSLINENTAAALQ  203

Query  188  YGLD----KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  230
              +      +   + +L ++LG  +  VS+  +   +             F++ ++A D 
Sbjct  204  LAVHASVAPEDKPKRILFYNLGSTSLQVSVAELSAQVVPDGFKKNKTVSTFQMLSSAWDD  263

Query  231  HLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDS  290
             LGG  FD RL DH  +EF  K  +D+    R + ++R   ++ K  LS++ Q  + + S
Sbjct  264  SLGGAKFDLRLADHLAKEFSDKIGEDVRTLARPMAKIRAQAKKTKIVLSANEQIPVVMQS  323

Query  291  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  350
            L+  +DF +++TR   E++C D F + + PV   L  A LS   + E+ LVGG  R+PK+
Sbjct  324  LYKDVDFFTSMTRGDLENLCEDLFPRALAPVAAALEKAGLSVDDIDEIELVGGGVRMPKI  383

Query  351  QQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            QQ L ++F GK+    +N DEA+A GA  +AA L  +
Sbjct  384  QQQLKDYFGGKDLGVHLNGDEAMALGAAFRAANLSNS  420

>HYAP_04460
Length=818

 Score = 208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 130/392 (33%), Positives = 207/392 (53%), Gaps = 18/392 (5%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +++   F     +     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFKHPEVQQELQQLAFTCVELSSGDVGIVLTYNDEPVTFSCEQVVAMILN  123

Query  131  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A   G      V++ P Y+ D QRQA  +A  IAGLN LR++NE TA A+AYG
Sbjct  124  KMQHIAAAANEGVTPAYCVLSCPGYYTDVQRQALLNASKIAGLNCLRLMNEHTAIALAYG  183

Query  190  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242
            + K           ++V+  D+G  ++ V++++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDVGHASYTVAVVAFVQGRLTVKSVAFDRFLGGRDFDLAIA  243

Query  243  DHFTQEFKRKHR--KDITDNQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  298
                 +F  K++    + +N +A  +L +ACE+AK+ LS    +   + I+ L +  D+N
Sbjct  244  KDAAAKFADKYKVANPLENNPKARMKLLSACEKAKKNLSPYGVSATQLNIECLAEDRDYN  303

Query  299  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFF  358
            + +T   FE +      +   PVE+ L DA L  + +  V +VGG TR+  V++ L+E  
Sbjct  304  AQVTLEEFEALIAPLLERLNGPVEQALADAGLKATDLTNVEIVGGGTRVTSVKRHLAEVL  363

Query  359  N-GKEP-----NKSINPDEAVAYGATVQAAIL  384
               KE      + ++N DE+VA G  +  AIL
Sbjct  364  GLDKEQQNYGLSSTLNADESVARGCALNCAIL  395

 Score = 38.5 bits (88),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 60/121 (50%), Gaps = 3/121 (2%)

Query  493  VSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAY  552
            V+  +K   ++ ++ + +  G LS +D+     +  K   +D   +     +N LE++ Y
Sbjct  568  VAGPKKKRFRKVELIVQSQVGGLSTTDVSSATEQELKMAQQDRVIEDTFNKRNELESFVY  627

Query  553  SLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEE--YESKQKELEGVANP  610
             +RN + D KL   I   +K  ++ K+ +T  WL   +  ++ +  Y+ K  ++  +++P
Sbjct  628  EMRNQITD-KLAAFITSDEKSNLEKKLVDTEDWLYTDEGFDSTKSVYQQKLDDMRKLSSP  686

Query  611  I  611
            +
Sbjct  687  V  687

>H310_01493
Length=909

 Score = 209 bits (531),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 130/397 (33%), Positives = 206/397 (52%), Gaps = 27/397 (7%)

Query  12   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+D G  +  + + +   + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  71   VFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +RL+G   + P+V++ +K  ++P+ LT    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            V    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSLIDENTAAALQ  205

Query  188  YGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  230
            + L     + G    VL++++G  +  VSL+     I             FEV   A D 
Sbjct  206  HALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVIDFEVLGKAWDD  265

Query  231  HLGGEDFDNRLVDHFTQEFKRKHRK--DITDNQRALRRLRTACERAKRTLSSSAQAYIEI  288
             LGG  FD RL D F  EF  K +K  D+    RA+ +LR A  + K  LS++ +  + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVLSANEEIPVVV  325

Query  289  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  348
             SL   +DF S+  R  FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSSAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAIEIIGGGVRIP  385

Query  349  KVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILG  385
            K+Q +L  +F  ++    +N DEA+A GA +  A L 
Sbjct  386  KIQSVLKTYFE-RDLGLHLNGDEAMALGAALHGANLS  421

>PPTG_14555
Length=703

 Score = 205 bits (522),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 174/551 (32%), Positives = 271/551 (49%), Gaps = 49/551 (9%)

Query  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIA-----NDQGNRTTPSYVAFTDT---ERLIGD  57
            T+  S+GID G T     V  +  V  +      N +   + PS+V+   T   E  +G 
Sbjct  39   TAECSIGIDFGRTKCEAAVVSDTGVATLIPLEPQNKENCYSLPSFVSMGVTRTGEWEVGL  98

Query  58   AAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGE-S  116
             A N+       TVFD   L+G+K    +   D+  W F L +G   K  +    KG   
Sbjct  99   QAINRAKAGHPYTVFDLTMLLGQKVK-ALSPQDVDRWAFNLQAGVAGKAVVECPAKGNVP  157

Query  117  KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLR  176
                PE++++M+L  ++  AE F  K V  AV+TVPA FN +QRQA  DA  IA LNV R
Sbjct  158  DLLYPEQVAAMLLSTIKNRAEIFTKKRVTGAVVTVPAAFNRTQRQAVWDACRIADLNVSR  217

Query  177  IINEPTAAAIAYGLDKKGG---ERNVLIFDLGGGTFDVSLLSIEE------GI-FEVKAT  226
            ++   TA+A+A  +        E+ +++ D G G  DV+L  + E      GI  EV+AT
Sbjct  218  LVISSTASAVADSIIDGAAAVFEKTIVVVDCGAGGLDVTLARVREADGSSSGIEVEVEAT  277

Query  227  AGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYI  286
            AG+  LGGE   +RL +HF  E K       T N    RRLR AC   +R LS+S QA I
Sbjct  278  AGNLELGGEALTDRLFEHFHNEVKAGDTSSKT-NPAFSRRLRRACALVQRILSTSQQAAI  336

Query  287  EIDSLFDG--------IDFNSTITRARFEDMCGDYFRKTME-PVEKVLRDAKLSKSQVHE  337
            ++     G          F S+I RA F+++CG      +   VE+VL  AK+ K  +  
Sbjct  337  DLPWRTRGPGAVNGTAAGFTSSIWRADFDNLCGSEVWDNLPITVEQVLTRAKVKKEDLDA  396

Query  338  VVLVGGSTRIPKVQQLLSEFFNGKEPNKSIN-PDEAVAYGATVQAAILGGNdssdklqdl  396
            V++ GG+ ++PK++++L +    +  N+ ++ P+   A GA++ AA   G+        +
Sbjct  397  VLITGGAMKVPKLREVLGDCL-AEHWNRIMDLPEHTAAIGASMIAAQSTGH--------V  447

Query  397  llldvtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEG---ERS  453
            L  + TPLSLG+ ++ G    ++  +T VPT +AQ +  YA  Q  +   + EG    RS
Sbjct  448  LKNEPTPLSLGIRSSSGDTLVVVPASTAVPTHQAQLY--YASCQREINFDILEGLTANRS  505

Query  454  ----MTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  509
                  R  H LG+  +D        V ++++ F +DA G   V   +KS  +  ++ ++
Sbjct  506  PGAAPNRLEHCLGRILVDGRRASTPLVLKLEIAFQLDATGRFTVVVSDKSNDRVTRLLVS  565

Query  510  NDKGRLSQSDI  520
             D+  L +  I
Sbjct  566  GDETCLQEEAI  576

>H310_01496
Length=904

 Score = 207 bits (528),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 131/397 (33%), Positives = 204/397 (51%), Gaps = 27/397 (7%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+D G  +  +  V    + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  71   VFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +RL+G   + P+V++ +K  ++P+ LT    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            V    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSLIDENTAAALQ  205

Query  188  YGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  230
            + L     + G    VL++++G  +  VSL+     I             FEV   A D 
Sbjct  206  HALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVIDFEVLGKAWDD  265

Query  231  HLGGEDFDNRLVDHFTQEFKRKHRK--DITDNQRALRRLRTACERAKRTLSSSAQAYIEI  288
             LGG  FD RL D F  EF  K +K  D+    RA+ +LR A  + K  LS++ +  + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVLSANEEIPVVV  325

Query  289  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  348
             SL   +DF S   R  FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSNAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAIEIIGGGVRIP  385

Query  349  KVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILG  385
            K+Q +L  +F  ++    +N DEA+A GA +  A L 
Sbjct  386  KIQSVLKTYFE-RDLGLHLNGDEAMALGAALHGANLS  421

>PPTG_17083
Length=304

 Score = 194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 145/214 (68%), Gaps = 11/214 (5%)

Query  123  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  182
            EISSMV+++M+E+AEAF+G+ +  AV+T PAYFN+ QRQ+TKD  +I GL++ RI NE +
Sbjct  23   EISSMVVLRMKEMAEAFLGQRISQAVVTAPAYFNNQQRQSTKDVVSITGLDLQRINNETS  82

Query  183  AAAIAYGLDKKGGE----RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  238
             AA+AYGLD   G      NV IF LGGGT DVS+LSI     EVK+T GD+    ED D
Sbjct  83   VAALAYGLDTNAGTDGKACNVQIFVLGGGTVDVSILSIRVRHLEVKSTGGDS---AEDSD  139

Query  239  NRLVDHFTQEFKRKHRK-DITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  297
            N +V H   EF+RK R  D + + RA   + TACE AKR L ++  A +E+ SLF+G++F
Sbjct  140  NNMVQHLLTEFERKIRNLDPSGSARA--SVVTACESAKRMLLTTTSASVEVTSLFEGVEF  197

Query  298  NST-ITRARFEDMCGDYFRKTMEPVEKVLRDAKL  330
            +ST +TRA+FE +  + F +    V KVL DAK+
Sbjct  198  SSTVVTRAKFESLNEELFMRCEVTVFKVLEDAKM  231

>PYU1_G003764
Length=910

 Score = 206 bits (523),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/396 (33%), Positives = 212/396 (54%), Gaps = 23/396 (6%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  31   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVSVRRPQTA  90

Query  71   VFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +R +G     P V + ++  ++P+ L     ++ + T+  + ++K  F  EE+ +M
Sbjct  91   YSQIRRFLGATPDSPEVVSLLQEEYFPYTLLK---NETRGTISLEHDNKQVFHAEELVAM  147

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            V    R++ +AF    VK+ VITVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+ 
Sbjct  148  VFSHARQITDAFAEAPVKDWVITVPTFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQ  207

Query  188  YGLDKKGGE-RNVLIFDLGGGTFDVSLLS-----IEEGI--------FEVKATAGDTHLG  233
            + +     E R +L +++G  +  VS+       I +G         F++ A A D  LG
Sbjct  208  HAVHSTFTEPRRILFYNMGSTSLQVSIAEFNSEVIPDGFKKNKTVSAFQMIANAWDETLG  267

Query  234  GEDFDNRLVDHFTQEFKRK--HRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSL  291
            G  FD +L +H   EF +K    +D+    R L ++R   ++ K  LS++ +  + + SL
Sbjct  268  GAKFDLQLAEHLALEFNKKLGGDEDVRTLPRPLAKIRAQAKKTKIVLSANEEIPVVMQSL  327

Query  292  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  351
            +  IDF +T+TR++FE++  D F + + PV++VL  A L+ + + E+ ++GG  R+PK+Q
Sbjct  328  YKDIDFFTTMTRSKFEEINADLFARALNPVQQVLNKAGLTVNDIDEIEIIGGGVRMPKIQ  387

Query  352  QLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            Q L EFFNGK+    +N DEA+A G+  +AA L  +
Sbjct  388  QRLKEFFNGKDLGVHLNGDEAMALGSAFRAANLSNS  423

 Score = 40.0 bits (92),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 3/82 (4%)

Query  534  DEANKVRIEAKNALENYAYSLRNSLNDEK-LKEQIPEADK-KVVDDKVTETIQWL-DAHQ  590
            D   K  +EAKN LE Y Y+ R++LN +    EQ+ + ++ + +  K+ ET +WL D  +
Sbjct  664  DNQRKANLEAKNRLETYVYNARDTLNAKADAIEQVTQPEQLEQLQTKLEETEEWLYDDGE  723

Query  591  SAETEEYESKQKELEGVANPIL  612
              E  EY  K K+L+   + IL
Sbjct  724  KVEAAEYNKKIKDLDKDLSAIL  745

>HYAP_01538
Length=130

 Score = 185 bits (469),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 88/94 (94%), Positives = 90/94 (96%), Gaps = 1/94 (1%)

Query  1   MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60
           MAQ   SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1   MAQT-VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61  NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHW  94
           NQVAMNAHNTVFDAKRLIGRKFSD +VQAD+KHW
Sbjct  60  NQVAMNAHNTVFDAKRLIGRKFSDAVVQADVKHW  93

>H257_00287
Length=893

 Score = 202 bits (514),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 130/396 (33%), Positives = 204/396 (52%), Gaps = 27/396 (7%)

Query  12   GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+D G  +  + + +  +  EI+ N    R T + V+F   ERL G  A N       N 
Sbjct  29   GVDFGGEFFKIALVKPGKSFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQNA  88

Query  71   VFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +RL+G   + P+V++  K  ++P+ LT    ++ + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPLVESMTKSEYFPYTLTH---NETRGSVGLKHDDEHTFHAEELVAM  145

Query  128  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  187
            V    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAEGPVRDWVVTVPSYFAEAQRQAVIDAAEIAGIRVLSLIDENTAAALH  205

Query  188  YGLD----KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  230
            + L     + G    V+ +++G  +  VS++     I             FEV   + D 
Sbjct  206  HALSIDVPEVGKPTRVMFYNMGSTSLQVSVVEYTSRIVPDGFKKNKTIVDFEVLGKSWDE  265

Query  231  HLGGEDFDNRLVDHFTQEFKRKHRK--DITDNQRALRRLRTACERAKRTLSSSAQAYIEI  288
             LGG  FD RL D F  EF  K +K  DI    RA+ +LR A  + K  LS++    + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDIRLVPRAMAKLRAAARKTKIVLSANEVIPVVV  325

Query  289  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  348
             SL   +DF S   R+ FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSNAKRSEFEALCADLFGRVLGPVESVLQKTGLAKTDLSAIEIIGGGVRIP  385

Query  349  KVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAIL  384
            K+Q LL  +F  ++    +N DEA+A GA    A L
Sbjct  386  KIQSLLKGYFE-RDLGLHLNGDEAMALGAAFHGANL  420

>PYIR_18381
Length=747

 Score = 198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 126/391 (32%), Positives = 200/391 (51%), Gaps = 43/391 (11%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEISQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  131  KMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
            KM+ +A A         AV++VP Y+ D QR+A  +A  IA LN LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDNVSPAYAVVSVPGYYTDVQRRALLNAAKIANLNCLRLINEHTAIALAYG  183

Query  190  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYA  241

Query  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  298
            L     + F+ K++ D   + ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKNFQDKYKIDPLADAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  299  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFF  358
            S +T  +F+++           +E +L+             +VGG TR+  V++ LSE  
Sbjct  302  SQVTLEQFDEL-----------IEPLLQQ------------IVGGGTRVSSVKRRLSEIL  338

Query  359  NGKEP------NKSINPDEAVAYGATVQAAI  383
               +       + ++N DE+VA G  +Q AI
Sbjct  339  GLDKDAQNFGLSTTLNADESVARGCALQCAI  369

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 85/172 (49%), Gaps = 23/172 (13%)

Query  461  LGKFNLDAIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------KSTGKENKI  506
            +GKF +  IP + +G  +P+I V    D NG+ +VS+ +               GKE + 
Sbjct  469  IGKFTVSGIPELEKGAELPKIRVNVQQDVNGLFSVSSSQLMQEIKEEEKPAAEEGKEGEA  528

Query  507  TITND-----KGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDE  561
               +      K R  + D+ ++ AE  K   +D   +     +N LE++ Y +RN ++D 
Sbjct  529  KADDKPAEPKKKRFRKVDL-KIHAEELKMAHQDRIIEETFNKRNELESFVYEMRNQVSD-  586

Query  562  KLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEE--YESKQKELEGVANPI  611
            KL E I +A+K  ++DK+ E   WL + +  ++ +  Y++K  E+    +PI
Sbjct  587  KLAEFITDAEKAAIEDKLNEVEDWLYSDEGFDSTKSVYQNKLDEMRENTSPI  638

>PHYSO_339667
Length=160

 Score = 182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 111/152 (73%), Gaps = 0/152 (0%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            VGIDLGTT S  GVW+N+ VEII N  G  +TPSYVAFTDT  L G+AAK Q   NA NT
Sbjct  8    VGIDLGTTCSRDGVWRNEDVEIIPNGDGAYSTPSYVAFTDTALLTGNAAKRQPTRNAENT  67

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
            VF+  +LIGRKFSDP +Q  I++WPFK+  G  D  Q+ VQ+KGE+K FQP EI +++L 
Sbjct  68   VFNIHQLIGRKFSDPALQLSIRYWPFKVECGPKDTAQVVVQYKGETKRFQPIEIVAILLC  127

Query  131  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQA  162
            +MR++AE ++ +EV  AV+TVP  FN  QRQA
Sbjct  128  EMRKMAEIYLDQEVTKAVLTVPGSFNYFQRQA  159

>PHYCA_558934
Length=489

 Score = 192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 148/488 (30%), Positives = 245/488 (50%), Gaps = 39/488 (8%)

Query  55   IGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKG  114
            +G  A N        TVFD   L+G+K  + +   D+  WPF + +G   K  +    + 
Sbjct  11   VGKRAVNHAKAGHPYTVFDLTMLLGQKM-ESLSPQDMDRWPFTIRAGVAGKALVECPQRL  69

Query  115  ESKTF-QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLN  173
            +S     PE++++M+L  ++  AE F GK V  AV+TV A +N +QRQA +DA +IAGL+
Sbjct  70   QSPALVYPEQVAAMLLSTIKHRAETFTGKTVTRAVVTVSAAYNRTQRQALRDACSIAGLS  129

Query  174  VLRIINEPTAAAIAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIE------EGIFEV  223
            V R++   TA+A+A            ++ +L+ D  G + +V+L S+       E   EV
Sbjct  130  VERLVVSSTASAVANAKSDTDATAVFDKTILVVD-SGASLNVTLASVNSNDNGAEVEVEV  188

Query  224  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITDNQRAL-RRLRTACERAKRTLSSSA  282
             ATAGD   GGE   +RL +HF QE   +     T +  A  RRLR AC  A+R LSS  
Sbjct  189  TATAGDVEAGGEPLTDRLFEHFLQEINAEDVNSETTSSPAFSRRLRRACTLAQRVLSSFP  248

Query  283  QAYIEIDSL-FDGIDFNSTITRARFEDMCG-DYFRKTMEPVEKVLRDAKLSKSQVHEVVL  340
            Q   ++  L      F STI+R+ F+ +CG + + +  E VE+VL+ A++ K  V  +++
Sbjct  249  QVSFDVPPLQLRRGWFTSTISRSEFDSLCGLELWNRLPETVERVLKLAQVKKEDVDAILV  308

Query  341  VGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllld  400
             GG+ ++PK +++L E F          P    A G    AA++  N        +L  +
Sbjct  309  TGGAMQVPKFREVLGECFVEHWNRIKDLPKHTAAIG----AALIAKN-----NGYILKNE  359

Query  401  vtplslglETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEG---------E  451
             T L+LG+ ++GG +  ++  +T VPT++++ +  YA  Q  +   + EG          
Sbjct  360  PTSLALGIRSSGGDLLVIVPPSTCVPTRQSRVY--YASVQREIRFDILEGITEPDQEPTC  417

Query  452  RSMTRDN---HLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITI  508
             S T  N   H LG+  +D        + ++++TF++   G L V   + S  +  ++ +
Sbjct  418  NSGTAPNKLEHCLGRVTIDGRRASAPLILKLEITFEVGETGSLVVLISDSSNNRVTRMQV  477

Query  509  TNDKGRLS  516
              D+  LS
Sbjct  478  GGDETCLS  485

>CCI11769
Length=372

 Score = 188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/361 (34%), Positives = 183/361 (51%), Gaps = 38/361 (11%)

Query  52   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKL---------TSGA  102
            E L+G  A+     + H+T+++AKR IGR +++ I  A  K + F +         TS +
Sbjct  10   EILVGRQARAYRTKDPHHTIYNAKRFIGRSYNESIQAA--KPYGFSIEPIRNESATTSES  67

Query  103  GDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQ  161
               P  ++   G      P +I S+++  +  +A  F+   ++   VI VP  F  +QR+
Sbjct  68   LPGPCFSLNVSGHPSCVSPIDIGSLIIRHLHSMAREFVKHNQLDRVVIAVPVDFKAAQRR  127

Query  162  ATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF  221
            AT  A   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G  
Sbjct  128  ATVQAYEKAGLKVARVLEEPTAAAIAYGLHQTPNVNFILVFDFGGGTLDVSLLFVRSGSI  187

Query  222  EVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDI---------TDNQR---------A  263
             V  T GD +LGGED DN + +H   + +      +         TD+++          
Sbjct  188  SVVDTLGDNNLGGEDLDNLVSNHLISQLEALIGMKLAESSSEVMETDSEKTEDPDQLPCT  247

Query  264  LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRK  316
            +  +R A E  KR LS +  A         G    +       +++R  FE +C     +
Sbjct  248  IAGIRRAAEILKRKLSYTHTAIASCIVQEPGGKLIAQDNRVEISMSRDEFETLCESILER  307

Query  317  TMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYG  376
             + PV ++LRD  +  + + EVVLVGGS+RIP +   L E F GK+P  +I+PD AVA+G
Sbjct  308  VLLPVRQILRDNNMDPNSIDEVVLVGGSSRIPWIHTQLEELF-GKQPRITIDPDVAVAFG  366

Query  377  A  377
            A
Sbjct  367  A  367

>SDRG_01828
Length=866

 Score = 196 bits (498),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 150/556 (27%), Positives = 256/556 (46%), Gaps = 61/556 (11%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65
            S    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N    
Sbjct  19   SASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIEVR  78

Query  66   NAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  123
                     +R +G     P+V +  + +++P+ LT     +  + +Q   E  TF  EE
Sbjct  79   RPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSE-HTFHAEE  136

Query  124  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  183
            +++MV    +++   F    VK+ VITVP YF + QRQA  DA  IAG+ VL +I+E TA
Sbjct  137  LAAMVFGHAKQITNDFAEAPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDENTA  196

Query  184  AAIAYGLDKKGGERN----VLIFDLGGGTFDVSLLSIEEGI-------------FEVKAT  226
            AA+ + +D +  E N    ++++++G  +  VS++  +  +             F+V A 
Sbjct  197  AALHHAVDYEAAEPNTPERIMLYNMGSTSLQVSIVEYKTRVVPDGFKKNKTIVEFDVLAK  256

Query  227  AGDTHLGGEDFDNRLVDHFTQEF--KRKHRKDITDNQRALRRLRTACERAKRTLSSSAQA  284
            A D  LGG  FD RL + F  EF  K K+  D+    RA+ +LR A  + K  LS++   
Sbjct  257  AWDETLGGAQFDLRLAEKFANEFNAKLKNGDDVRKIPRAMAKLRAAARKTKIVLSANEAI  316

Query  285  YIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGS  344
             + + SL   +D+    +R   E++  D F + +EPV+  L  A L+   +  V ++GG 
Sbjct  317  PVIVPSLHADLDYKGHASRTELEEIAADLFARVLEPVKSALDQAGLTVGDLSAVEIIGGG  376

Query  345  TRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNdssdklqdlllldvtpl  404
             RIPK+Q LL EF   ++  K +N DEA+A GA   AA L  +     +    +      
Sbjct  377  VRIPKIQALLQEFVQ-RDLGKRLNGDEAMALGAAFNAANLSTSFRVRHVGMTDISSFPIG  435

Query  405  slglETAGGVM-------------TTLIARNTTVPTKKAQTFS-------TYADNQPGVL  444
               ++ A                   L      +  KK+ +FS       T+  ++P  L
Sbjct  436  VRLVDLASHAADDDHPEAKHWVKRAALFGERQKLNVKKSVSFSHADDVSCTFRYDKPSAL  495

Query  445  IQVFEGERSMTRDNHLLGKFNLDAIPPMPR-------GVPQIDVTFDIDANGILNVSAVE  497
             Q   G  S      ++ ++N+  I    +       G P++ ++F++DA+G+ ++   E
Sbjct  496  PQ---GVSS------IISRYNITGIAAFAKKMEDKKLGEPKVTLSFNLDASGLASIVKAE  546

Query  498  KSTGKENKITITNDKG  513
             +  +E ++     K 
Sbjct  547  ATLDEEIEVPAPTKKA  562

>PPTG_18280
Length=384

 Score = 186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 185/352 (53%), Gaps = 21/352 (6%)

Query  12   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+D G  +  V + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  71   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
                +RL+G   SDP V +  D +H+P++L   A     I+++  G+ +TF  EE+ +MV
Sbjct  88   YAQIRRLLGTTLSDPQVSSLLDEEHFPYELVQNATRGGTISLK-HGKDQTFHAEELVAMV  146

Query  129  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  188
                R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TAAA+  
Sbjct  147  FAHARQITDTFAEAAVKDWVLTVPAFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQL  206

Query  189  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  231
             +    D +   + +L +++G  +  VS+      +             F+  + A D  
Sbjct  207  AVHASYDPEDKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWDES  266

Query  232  LGGEDFDNRLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSL  291
            LGG  FD RL +H  +EF  K  +DI    R + ++R   ++ K  LS++ +  + + SL
Sbjct  267  LGGSKFDLRLAEHLAKEFSEKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEIPVVMQSL  326

Query  292  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  343
            ++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG
Sbjct  327  YNDIDFFTSMTRSKLEELSSDLFDRTLKPVEVALEKAGLTAADIDEIEIIGG  378

>HYAP_10418
Length=315

 Score = 182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 151/297 (51%), Gaps = 25/297 (8%)

Query  104  DKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQA  162
            D     +   G      P EI S ++  +R++A  F+G  ++  AVI VP  F+  QR  
Sbjct  16   DGVCFAINLDGHPDCITPVEIGSKIVRHLRDMAHRFVGHDQITKAVIAVPVDFDAKQRDD  75

Query  163  TKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  222
            T  +   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   
Sbjct  76   TVASFRAAGLEVSRVLEEPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNGAIT  135

Query  223  VKATAGDTHLGGEDFDNRLVDHFTQEFKRK--------------HRKDITDNQRALRRLR  268
            V  T GD HLGGED D  L     ++F+ +              H  D  +    L  +R
Sbjct  136  VLDTLGDNHLGGEDLDALLAAWLVKQFEAQLGSPITSRGTDADGHGNDDKELPCTLTGVR  195

Query  269  TACERAKRTLSSSAQAYIEIDSLFDGIDFNST--------ITRARFEDMCGDYFRKTMEP  320
             A E  KR L+ +  A      ++DG D  +         +TR +FE +CG    +TM P
Sbjct  196  RAAEFLKRQLTDAPTA--SASCVWDGADSQAVAKTRATVDMTRVQFEVLCGSLLERTMIP  253

Query  321  VEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGA  377
            V KVL    +   ++  VVLVGGS+RIP V++ L+  F G+ P   I+PD AVAYGA
Sbjct  254  VRKVLEANNMESEEIDAVVLVGGSSRIPWVRERLTVMFQGRAPLSDIDPDLAVAYGA  310

>CCI45987
Length=939

 Score = 193 bits (491),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 122/397 (31%), Positives = 197/397 (50%), Gaps = 22/397 (6%)

Query  12   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  70
            G+D G  Y  V + +     EI+ N    R T + VAF   ER+ G  A        H  
Sbjct  41   GLDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGEERIYGADADTIGVRRPHTG  100

Query  71   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGE-SKTFQPEEISSMVL  129
                +R +G     P V + +    F  T    +K + T+  + E  + +  EE+ +MV 
Sbjct  101  YAQIRRFLGSSLDHPGVLSLVTQEYFPYTLKLNEK-RGTIHLEHEIEQLYHAEEVVAMVF  159

Query  130  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  189
              +R++ + F   +VK+ VITVP Y+  +QRQA  DA  I+GL VL +INE TAAA+   
Sbjct  160  SHVRQITDVFAESDVKDYVITVPDYYTQAQRQAVLDAAEISGLRVLSLINENTAAALQLC  219

Query  190  LD---KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHLG  233
            +    +    + V+ ++LG  +  VS+      +             F V + A D HLG
Sbjct  220  IHTSMEPNERKRVMFYNLGSTSLQVSIAEFYSYVVPVGSSSNKTVIGFSVLSKAWDEHLG  279

Query  234  GEDFDNRLVDHFTQEFKRK---HRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDS  290
                D RL ++  + F  +   +++D+    + + +LR   ++ K  LS++ +  + + S
Sbjct  280  SSKIDLRLAEYLARVFNEQVLHNKQDVRTLPKVMAKLRAQAKKTKIVLSANEEIPVVMQS  339

Query  291  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  350
            L D  D  + +TR   E++  D   + + PVE+ LR A L++  + +V L+GG  R+PKV
Sbjct  340  LLDDYDLRTVVTRTLLEEISKDLLDQVLGPVEEALRKANLTRGDIQDVELIGGGVRMPKV  399

Query  351  QQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGN  387
            Q LL EFFN +E    +N DEA+A GA  +AA L  +
Sbjct  400  QSLLKEFFNVQELGAHLNGDEAMALGAAFRAANLSNS  436

 Score = 36.6 bits (83),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query  491  LNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENY  550
            L+V  VE+  G+ N I          +SD  +++ E E   + D   K  ++AKN LE +
Sbjct  646  LSVKLVEERLGENNAIMSILPMSSSDKSDSIKLLREME---AADNKRKANLDAKNRLEAF  702

Query  551  AYSLRNSL-NDEKLKEQI--PEADKKVVDDKVTETIQWL-DAHQSAETEEYESKQKELEG  606
             YS R+SL +D+    Q+  PE    ++  K+    +WL +    AE  EY++K  E+E 
Sbjct  703  VYSARDSLESDQDAISQVTLPEQVNAIL-IKLEAAEEWLYEDGDKAEASEYQAKLSEIET  761

Query  607  VANPIL  612
              + IL
Sbjct  762  ELDAIL  767

Lambda      K        H        a         alpha
   0.315    0.132    0.368    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 51575962266

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40