Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_51904408471291296902e-94
PPTG_02121972912221286697e-90
PHYRA_72415569866551297022e-89
PHYRA_7246392626581297012e-89
PHYKE_6984569864501286845e-89
PHYCA_104429408476451276915e-88
PHYSO_480010569866531286925e-88
PHYCA_532912569866261286844e-87
PHYCA_10446592676531286854e-87
PHYSO_48561492676531286846e-87
PITG_1124492626631276856e-87
PHYCA_104335690356561286847e-87
PPTG_0212292626571276831e-86
PHYSO_48608592656531286812e-86
PHYSO_34470592627981276858e-86
PHALS_01338300173831286533e-85
PHALS_04330314037851276787e-85
PITG_1124792656531286708e-85
PITG_1124992676531286691e-84
PYIR_15857972915771276613e-84
PYVX_1564192626291276602e-83
PPTG_1672792702171296272e-83
PYIR_1585992626261296557e-83
PYAP_17334972916501276561e-82
H310_02604415933121266291e-82
PYU1_G013927972916491276551e-82
SDRG_114731221156361286472e-81
PYAP_19235994396431276393e-80
PPTG_19690248375661296334e-80
H310_026101483476501266342e-79
SPRG_000681221156431286332e-79
SPRG_0453392676521266308e-79
SDRG_1189992676521266308e-79
H257_173221483476061266242e-78
PHYSO_48279392706581276255e-78
H310_0955792676441246236e-78
PHYKE_701692706501276246e-78
PITG_1125292706541296237e-78
PYU1_G01393192626631276238e-78
HYAP_0153792706511276221e-77
H257_1295892676491246192e-77
PYIW_1687692626431276184e-77
CCI432211605206601296177e-77
PHALS_0980292706511276168e-77
PYVX_22981803776121276139e-77
PHYCA_10444492706441276114e-76
PHYRA_41888687195861276041e-75
PHYRA_7165592706531276053e-75
PYAP_1733392626571276011e-74
CCI4024992676601245923e-73
CCA1615392676631245907e-73
CCA1496715203914311226015e-72
PYAR_19807926216131275944e-71
CCI402471524566431275442e-66
CCA161511524566431275364e-65
HYAP_015389267130884663e-60
H257_000071275427871284943e-58
HYAP_01540753456341274841e-57
H257_1888597617861284892e-57
H310_147591275427871284892e-57
SPRG_105191275427821284882e-57
SDRG_057781275266181284771e-56
SDRG_0577797617861284802e-56
SPRG_1047797617621234793e-56
PYU1_G001540849376331284701e-55
HYAP_1266097617861284733e-55
CCI4609197617871284715e-55
CCA2082897617871284706e-55
PYAP_22238849376331284632e-54
PYIR_24387849376331284622e-54
PYIW_22144849376331284612e-54
PPTG_0312197617861284636e-54
PYVX_1812197616331284588e-54
PITG_1191397617861284629e-54
PHYKE_1081597617861284574e-53
PHYRA_7819397617861284574e-53
PHALS_0207997617861284532e-52
PHYCA_50982097617861284505e-52
PHYRA_72238694196011264272e-49
PHYSO_339667525751601233816e-47
PHYSO_249902459321301223787e-47
PYAR_14487569864671274028e-47
PYIR_16738939965551274015e-46
HYAP_010054786601274038e-46
HYAP_01004939966601274038e-46
PYIW_265671658555641293998e-46
PHYSO_2863764786601274021e-45
PITG_005274786561274011e-45
SPRG_003334786151273992e-45
PPTG_082454786581274002e-45
PHYCA_5106964786591273992e-45
PHYKE_79924786571273993e-45
H310_094344786581273974e-45
CCI502344786651283974e-45
PHYSO_5252361275422461323764e-45
PYIW_217554786581273975e-45
PYVX_167384786581273959e-45
PYAP_133414786571273959e-45
PHYRA_710424786541273941e-44
SDRG_035644786581273932e-44
PHALS_008334786521273904e-44
PYAR_1835447810841273934e-44
PYU1_G0040984786561273905e-44
PYU1_G004097939966631243862e-43
CCA249364786611283852e-43
PHYSO_339666694195851233535e-39
PHYSO_525429598456101173342e-36
HYAP_0199330975691222955e-31
PHYSO_55211630975701222921e-30
PHYRA_7159130975701222902e-30
PPTG_1012230975691222875e-30
PHYCA_532207309711181242824e-29
PITG_0354630975691222753e-28
SPRG_111331278736761232754e-28
PHYKE_6430975691222666e-27
CCI4758230975821212622e-26
PYAP_1621630975641222603e-26
PHALS_0039030975691222551e-25
CCA2022930975831212524e-25
H310_1276530975601242524e-25
PYU1_G003754127286501242472e-24
SPRG_1569530975811232463e-24
PHYKE_9008127286501242463e-24
SPRG_1718513203283742253e-24
SDRG_1003830975651232463e-24
PYU1_G00694030975651222445e-24
PHYRA_71123127286331242445e-24
H257_0765030975631242429e-24
PYIR_2412330975671222429e-24
PYVX_1769230975511222421e-23
PYIW_19165309711241222421e-23
PHYCA_541134127286331242411e-23
PITG_15786127286331242411e-23
PHALS_07616127286771242402e-23
PYVX_15051127286321242402e-23
PYAR_1993084937625652392e-23
H257_01277127286521242383e-23
PHYSO_500480127286331242383e-23
PPTG_18274127286481242383e-23
SDRG_010681221786211202384e-23
SDRG_010671221796111282366e-23
PYAP_19738127286481242341e-22
SPRG_02294127286341242331e-22
SDRG_11043127286491252323e-22
H310_06631127286511272304e-22
PYAR_246871058826181322225e-21
SPRG_001831221796091242217e-21
CCI45982127286611282209e-21
SPRG_001821221786151182201e-20
CCA21514127286591282163e-20
HYAP_04461415931601232019e-20
PHYCA_111740415938101232084e-19
HYAP_0151040847138541955e-19
PYVX_13288457648101232051e-18
PPTG_19375457648091232041e-18
CCA159131523708571232041e-18
CCI467091523708191232022e-18
PHYKE_6664457648041232004e-18
PHYRA_82545457648061232004e-18
H310_062291261518001232005e-18
PHALS_04095457648031231996e-18
HYAP_04460457648181231996e-18
PYAR_15468457647691231997e-18
H257_164841261517951231971e-17
PYU1_G008851457647951231952e-17
PYAP_18643457648041231943e-17
PYIR_18381457647471231891e-16
PYIW_19676457646641231891e-16
PYIR_19697127286081031873e-16
PYAR_22188127286341031855e-16
SPRG_06720139304251271846e-16
SDRG_16559139304611271811e-15
PYAR_2470430975251071793e-15
PYIW_19956139304591271767e-15
SDRG_032661261517921231768e-15
PYAR_14579133105671301769e-15
SPRG_080601261517931231751e-14
PYAP_21865139304811301713e-14
PHYSO_493381133105621321714e-14
PHYKE_7077133106311321662e-13
PYIR_25979861144381431652e-13
PYIR_21692139304681281652e-13
PYU1_G006843139304811271652e-13
PHYRA_5357013930395811633e-13
PYIW_17320133105631291635e-13
PYU1_G002895133105611331617e-13
PHALS_0928113930465791617e-13
PYVX_13615133105851341573e-12
PYIW_142318611412431361564e-12
PHYRA_79054133105631331554e-12
PYU1_G000896861147111371521e-11
PITG_16528133105611311512e-11
H257_0445313930423891512e-11
CCA27145139304631291503e-11
PPTG_05819133105611331493e-11
PITG_17383139304381331484e-11
PPTG_09003139304491331485e-11
PHYSO_24751745764794821477e-11
PHALS_02692133105571321451e-10
PHYCA_6458133105601361441e-10
PHYCA_12084513930444751413e-10
PHYCA_504114127148871251397e-10
HYAP_07918127148971251398e-10
PYIW_2104519797061261371e-09
H310_1226013930424961362e-09
H310_0521619797081251334e-09
H257_1843519796841251335e-09
PHALS_08498127148951251326e-09
PPTG_18280242463841251318e-09
PHYRA_73661127148841271311e-08
CCI45261133105581361301e-08
PYU1_G00474319797061241291e-08
SPRG_01255133105661311292e-08
SPRG_0071319796721231273e-08
SDRG_0156119796721231255e-08
PITG_15771127148831251256e-08
PHYSO_2555061271412281251231e-07
PYIR_13638133105431261202e-07
H257_01680133105711271161e-06
H310_03911133105701271151e-06
PYIR_1441619796941201151e-06
PHYRA_813773098421721141e-06
CCA22305133105611381123e-06
H257_00287127148931221123e-06
PHYSO_321565167766971371115e-06
H310_014931481489091221081e-05
H310_01496127149041221081e-05
PYAP_19903133105271161081e-05
PHYKE_9011127149021271072e-05
PPTG_14555167767031331062e-05
PYVX_1845013930386381035e-05
PYVX_2290519797081271028e-05
PHALS_004791979706841001e-04
SDRG_01828127148661261001e-04
SPRG_0628812714869126992e-04
PYAP_23247197971369992e-04
HYAP_008801979718128992e-04
PYAP_1974112714885131920.001
PYAR_1620212714893126920.002
PHYCA_558934266448982890.003
PHYKE_5851979713127890.003
PYVX_1506112714891126890.004
PHYSO_3537411979709127880.004
CCA2151912714929126880.005
CCI4598712714939124870.007
SDRG_1662113310531115870.007
PITG_030682664638138860.009
PPTG_09610211695320790.012
PHYCA_502791197970776850.014
PITG_02259197968969840.015
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_51904

Length=129
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_51904                                                           270        2e-94
PPTG_02121                                                            262        7e-90
PHYRA_72415                                                           275        2e-89
PHYRA_72463                                                           274        2e-89
PHYKE_6984                                                            268        5e-89
PHYCA_104429                                                          270        5e-88
PHYSO_480010                                                          271        5e-88
PHYCA_532912                                                          268        4e-87
PHYCA_104465                                                          268        4e-87
PHYSO_485614                                                          268        6e-87
PITG_11244                                                            268        6e-87
PHYCA_104335                                                          268        7e-87
PPTG_02122                                                            267        1e-86
PHYSO_486085                                                          266        2e-86
PHYSO_344705                                                          268        8e-86
PHALS_01338                                                           256        3e-85
PHALS_04330                                                           265        7e-85
PITG_11247                                                            262        8e-85
PITG_11249                                                            262        1e-84
PYIR_15857                                                            259        3e-84
PYVX_15641                                                            258        2e-83
PPTG_16727                                                            246        2e-83
PYIR_15859                                                            256        7e-83
PYAP_17334                                                            257        1e-82
H310_02604                                                            246        1e-82
PYU1_G013927                                                          256        1e-82
SDRG_11473                                                            253        2e-81
PYAP_19235                                                            250        3e-80
PPTG_19690                                                            248        4e-80
H310_02610                                                            248        2e-79
SPRG_00068                                                            248        2e-79
SPRG_04533                                                            247        8e-79
SDRG_11899                                                            247        8e-79
H257_17322                                                            244        2e-78
PHYSO_482793                                                          245        5e-78
H310_09557                                                            244        6e-78
PHYKE_7016                                                            244        6e-78
PITG_11252                                                            244        7e-78
PYU1_G013931                                                          244        8e-78
HYAP_01537                                                            244        1e-77
H257_12958                                                            243        2e-77
PYIW_16876                                                            242        4e-77
CCI43221                                                              242        7e-77
PHALS_09802                                                           241        8e-77
PYVX_22981                                                            240        9e-77
PHYCA_104444                                                          239        4e-76
PHYRA_41888                                                           237        1e-75
PHYRA_71655                                                           237        3e-75
PYAP_17333                                                            236        1e-74
CCI40249                                                              232        3e-73
CCA16153                                                              231        7e-73
CCA14967                                                              236        5e-72
PYAR_19807                                                            233        4e-71
CCI40247                                                              214        2e-66
CCA16151                                                              211        4e-65
HYAP_01538                                                            184        3e-60
H257_00007                                                            194        3e-58
HYAP_01540                                                            191        1e-57
H257_18885                                                            192        2e-57
H310_14759                                                            192        2e-57
SPRG_10519                                                            192        2e-57
SDRG_05778                                                            188        1e-56
SDRG_05777                                                            189        2e-56
SPRG_10477                                                            189        3e-56
PYU1_G001540                                                          185        1e-55
HYAP_12660                                                            186        3e-55
CCI46091                                                              186        5e-55
CCA20828                                                              185        6e-55
PYAP_22238                                                            182        2e-54
PYIR_24387                                                            182        2e-54
PYIW_22144                                                            182        2e-54
PPTG_03121                                                            182        6e-54
PYVX_18121                                                            181        8e-54
PITG_11913                                                            182        9e-54
PHYKE_10815                                                           180        4e-53
PHYRA_78193                                                           180        4e-53
PHALS_02079                                                           179        2e-52
PHYCA_509820                                                          177        5e-52
PHYRA_72238                                                           169        2e-49
PHYSO_339667                                                          151        6e-47
PHYSO_249902                                                          150        7e-47
PYAR_14487                                                            159        8e-47
PYIR_16738                                                            159        5e-46
HYAP_01005                                                            159        8e-46
HYAP_01004                                                            159        8e-46
PYIW_26567                                                            158        8e-46
PHYSO_286376                                                          159        1e-45
PITG_00527                                                            159        1e-45
SPRG_00333                                                            158        2e-45
PPTG_08245                                                            158        2e-45
PHYCA_510696                                                          158        2e-45
PHYKE_7992                                                            158        3e-45
H310_09434                                                            157        4e-45
CCI50234                                                              157        4e-45
PHYSO_525236                                                          149        4e-45
PYIW_21755                                                            157        5e-45
PYVX_16738                                                            156        9e-45
PYAP_13341                                                            156        9e-45
PHYRA_71042                                                           156        1e-44
SDRG_03564                                                            155        2e-44
PHALS_00833                                                           154        4e-44
PYAR_18354                                                            155        4e-44
PYU1_G004098                                                          154        5e-44
PYU1_G004097                                                          153        2e-43
CCA24936                                                              152        2e-43
PHYSO_339666                                                          140        5e-39
PHYSO_525429                                                          133        2e-36
HYAP_01993                                                            118        5e-31
PHYSO_552116                                                          117        1e-30
PHYRA_71591                                                           116        2e-30
PPTG_10122                                                            115        5e-30
PHYCA_532207                                                          113        4e-29
PITG_03546                                                            110        3e-28
SPRG_11133                                                            110        4e-28
PHYKE_64                                                              107        6e-27
CCI47582                                                              105        2e-26
PYAP_16216                                                            104        3e-26
PHALS_00390                                                           102        1e-25
CCA20229                                                              101        4e-25
H310_12765                                                            101        4e-25
PYU1_G003754                                                          99.8       2e-24
SPRG_15695                                                            99.4       3e-24
PHYKE_9008                                                            99.4       3e-24
SPRG_17185                                                            91.3       3e-24
SDRG_10038                                                            99.4       3e-24
PYU1_G006940                                                          98.6       5e-24
PHYRA_71123                                                           98.6       5e-24
H257_07650                                                            97.8       9e-24
PYIR_24123                                                            97.8       9e-24
PYVX_17692                                                            97.8       1e-23
PYIW_19165                                                            97.8       1e-23
PHYCA_541134                                                          97.4       1e-23
PITG_15786                                                            97.4       1e-23
PHALS_07616                                                           97.1       2e-23
PYVX_15051                                                            97.1       2e-23
PYAR_19930                                                            96.7       2e-23
H257_01277                                                            96.3       3e-23
PHYSO_500480                                                          96.3       3e-23
PPTG_18274                                                            96.3       3e-23
SDRG_01068                                                            96.3       4e-23
SDRG_01067                                                            95.5       6e-23
PYAP_19738                                                            94.7       1e-22
SPRG_02294                                                            94.4       1e-22
SDRG_11043                                                            94.0       3e-22
H310_06631                                                            93.2       4e-22
PYAR_24687                                                            90.1       5e-21
SPRG_00183                                                            89.7       7e-21
CCI45982                                                              89.4       9e-21
SPRG_00182                                                            89.4       1e-20
CCA21514                                                              87.8       3e-20
HYAP_04461                                                            82.0       9e-20
PHYCA_111740                                                          84.7       4e-19
HYAP_01510                                                            79.7       5e-19
PYVX_13288                                                            83.6       1e-18
PPTG_19375                                                            83.2       1e-18
CCA15913                                                              83.2       1e-18
CCI46709                                                              82.4       2e-18
PHYKE_6664                                                            81.6       4e-18
PHYRA_82545                                                           81.6       4e-18
H310_06229                                                            81.6       5e-18
PHALS_04095                                                           81.3       6e-18
HYAP_04460                                                            81.3       6e-18
PYAR_15468                                                            81.3       7e-18
H257_16484                                                            80.5       1e-17
PYU1_G008851                                                          79.7       2e-17
PYAP_18643                                                            79.3       3e-17
PYIR_18381                                                            77.4       1e-16
PYIW_19676                                                            77.4       1e-16
PYIR_19697                                                            76.6       3e-16
PYAR_22188                                                            75.9       5e-16
SPRG_06720                                                            75.5       6e-16
SDRG_16559                                                            74.3       1e-15
PYAR_24704                                                            73.6       3e-15
PYIW_19956                                                            72.4       7e-15
SDRG_03266                                                            72.4       8e-15
PYAR_14579                                                            72.4       9e-15
SPRG_08060                                                            72.0       1e-14
PYAP_21865                                                            70.5       3e-14
PHYSO_493381                                                          70.5       4e-14
PHYKE_7077                                                            68.6       2e-13
PYIR_25979                                                            68.2       2e-13
PYIR_21692                                                            68.2       2e-13
PYU1_G006843                                                          68.2       2e-13
PHYRA_53570                                                           67.4       3e-13
PYIW_17320                                                            67.4       5e-13
PYU1_G002895                                                          66.6       7e-13
PHALS_09281                                                           66.6       7e-13
PYVX_13615                                                            65.1       3e-12
PYIW_14231                                                            64.7       4e-12
PHYRA_79054                                                           64.3       4e-12
PYU1_G000896                                                          63.2       1e-11
PITG_16528                                                            62.8       2e-11
H257_04453                                                            62.8       2e-11
CCA27145                                                              62.4       3e-11
PPTG_05819                                                            62.0       3e-11
PITG_17383                                                            61.6       4e-11
PPTG_09003                                                            61.6       5e-11
PHYSO_247517                                                          61.2       7e-11
PHALS_02692                                                           60.5       1e-10
PHYCA_6458                                                            60.1       1e-10
PHYCA_120845                                                          58.9       3e-10
PHYCA_504114                                                          58.2       7e-10
HYAP_07918                                                            58.2       8e-10
PYIW_21045                                                            57.4       1e-09
H310_12260                                                            57.0       2e-09
H310_05216                                                            55.8       4e-09
H257_18435                                                            55.8       5e-09
PHALS_08498                                                           55.5       6e-09
PPTG_18280                                                            55.1       8e-09
PHYRA_73661                                                           55.1       1e-08
CCI45261                                                              54.7       1e-08
PYU1_G004743                                                          54.3       1e-08
SPRG_01255                                                            54.3       2e-08
SPRG_00713                                                            53.5       3e-08
SDRG_01561                                                            52.8       5e-08
PITG_15771                                                            52.8       6e-08
PHYSO_255506                                                          52.0       1e-07
PYIR_13638                                                            50.8       2e-07
H257_01680                                                            49.3       1e-06
H310_03911                                                            48.9       1e-06
PYIR_14416                                                            48.9       1e-06
PHYRA_81377                                                           48.5       1e-06
CCA22305                                                              47.8       3e-06
H257_00287                                                            47.8       3e-06
PHYSO_321565                                                          47.4       5e-06
H310_01493                                                            46.2       1e-05
H310_01496                                                            46.2       1e-05
PYAP_19903                                                            46.2       1e-05
PHYKE_9011                                                            45.8       2e-05
PPTG_14555                                                            45.4       2e-05
PYVX_18450                                                            44.3       5e-05
PYVX_22905                                                            43.9       8e-05
PHALS_00479                                                           43.1       1e-04
SDRG_01828                                                            43.1       1e-04
SPRG_06288                                                            42.7       2e-04
PYAP_23247                                                            42.7       2e-04
HYAP_00880                                                            42.7       2e-04
PYAP_19741                                                            40.0       0.001
PYAR_16202                                                            40.0       0.002
PHYCA_558934                                                          38.9       0.003
PHYKE_585                                                             38.9       0.003
PYVX_15061                                                            38.9       0.004
PHYSO_353741                                                          38.5       0.004
CCA21519                                                              38.5       0.005
CCI45987                                                              38.1       0.007
SDRG_16621                                                            38.1       0.007
PITG_03068                                                            37.7       0.009
PPTG_09610                                                            35.0       0.012
PHYCA_502791                                                          37.4       0.014
PITG_02259                                                            37.0       0.015
PPTG_18422                                                            37.0       0.018
PYVX_22561                                                            36.6       0.020
CCI11769                                                              36.6       0.023
SDRG_11277                                                            34.3       0.024
PHYSO_285382                                                          35.8       0.036
PYIR_24220                                                            35.8       0.044
HYAP_01856                                                            34.7       0.083
PYAR_13948                                                            34.7       0.10 
PYU1_G003764                                                          33.1       0.33 
PPTG_22091                                                            30.4       0.62 
PPTG_05521                                                            30.4       0.62 
PHYSO_501600                                                          32.3       0.69 
SDRG_17122                                                            32.0       0.73 
PPTG_23039                                                            31.2       0.78 
PHYRA_80453                                                           31.6       1.1  
PYVX_17117                                                            31.6       1.3  
PHYSO_300853                                                          31.2       1.9  
PHYCA_10022                                                           30.8       1.9  
PYAP_20766                                                            30.8       2.1  
HYAP_01857                                                            30.8       2.1  
SDRG_10969                                                            30.4       3.5  
SPRG_02218                                                            30.4       3.7  
CCA23736                                                              29.6       4.2  
PHYSO_305785                                                          29.3       6.0  
CCI11027                                                              28.5       6.4  
HYAP_02222                                                            28.5       8.5  
HYAP_02221                                                            28.5       8.5  

>PHYRA_51904
Length=129

 Score = 270 bits (690),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%), Gaps = 0/129 (0%)

Query  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
            MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI
Sbjct  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120

Query  121  SSMVLIKMR  129
            SSMVLIKMR
Sbjct  121  SSMVLIKMR  129

>PPTG_02121
Length=222

 Score = 262 bits (669),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 126/128 (98%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKRLIGRKFSDPIVQADIKHWPFK+TSG GDKPQITVQFKGESKTFQPEEIS
Sbjct  65   NAANTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQPEEIS  124

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  125  SMVLIKMR  132

>PHYRA_72415
Length=655

 Score = 275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%), Gaps = 0/129 (0%)

Query  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  5    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  64

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
            MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI
Sbjct  65   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  124

Query  121  SSMVLIKMR  129
            SSMVLIKMR
Sbjct  125  SSMVLIKMR  133

>PHYRA_72463
Length=658

 Score = 274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%), Gaps = 0/129 (0%)

Query  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  5    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  64

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
            MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI
Sbjct  65   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  124

Query  121  SSMVLIKMR  129
            SSMVLIKMR
Sbjct  125  SSMVLIKMR  133

>PHYKE_6984
Length=450

 Score = 268 bits (684),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 128/128 (100%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            ++GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  7    STGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFKL+SGAGDKPQITVQFKGESKTFQPEEIS
Sbjct  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  127  SMVLIKMR  134

>PHYCA_104429
Length=645

 Score = 270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/127 (100%), Positives = 127/127 (100%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>PHYSO_480010
Length=653

 Score = 271 bits (692),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/128 (98%), Positives = 128/128 (100%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQPEEIS
Sbjct  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  125  SMVLIKMR  132

>PHYCA_532912
Length=626

 Score = 268 bits (684),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 128/128 (100%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQPEEIS
Sbjct  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  126  SMVLIKMR  133

>PHYCA_104465
Length=653

 Score = 268 bits (685),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 128/128 (100%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQPEEIS
Sbjct  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  126  SMVLIKMR  133

>PHYSO_485614
Length=653

 Score = 268 bits (684),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 127/128 (99%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NAHNTVFDAKRLIGRKFSDP+VQADIKHWPFK++SG GDKPQITVQFKGESKTFQPEEIS
Sbjct  65   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFKISSGPGDKPQITVQFKGESKTFQPEEIS  124

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  125  SMVLIKMR  132

>PITG_11244
Length=663

 Score = 268 bits (685),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 127/127 (100%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDPIVQADIKHWPFK+T+GAGDKPQITVQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITAGAGDKPQITVQFKGESKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>PHYCA_104335
Length=656

 Score = 268 bits (684),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 128/128 (100%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQPEEIS
Sbjct  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  126  SMVLIKMR  133

>PPTG_02122
Length=657

 Score = 267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDPIVQADIKHWPFK+TSG GDKPQITVQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>PHYSO_486085
Length=653

 Score = 266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 127/128 (99%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NAHNTVFDAKRLIGRKFSDP+VQADI+HWPFK++SG GDKPQITVQFKGESKTFQPEEIS
Sbjct  65   NAHNTVFDAKRLIGRKFSDPVVQADIQHWPFKISSGPGDKPQITVQFKGESKTFQPEEIS  124

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  125  SMVLIKMR  132

>PHYSO_344705
Length=798

 Score = 268 bits (685),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 127/127 (100%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  147  SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  206

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQPEEISS
Sbjct  207  AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  266

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  267  MVLIKMR  273

>PHALS_01338
Length=383

 Score = 256 bits (653),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 126/128 (98%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            N+ NTVFDAKRLIGRK+SDP+V+ADIKHWPFK+T+G GDKPQITVQFKGE+KTFQPEEIS
Sbjct  65   NSSNTVFDAKRLIGRKYSDPVVKADIKHWPFKVTAGPGDKPQITVQFKGETKTFQPEEIS  124

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  125  SMVLIKMR  132

>PHALS_04330
Length=785

 Score = 265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDP+VQADIKHWPFK+TSGAGDKPQI VQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPLVQADIKHWPFKVTSGAGDKPQIVVQFKGESKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>PITG_11247
Length=653

 Score = 262 bits (670),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 126/128 (98%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKRLIGRKFSDP+VQADIKHWPFK+T+G GDKPQITVQFKGE+KTFQPEEIS
Sbjct  65   NAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQPEEIS  124

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  125  SMVLIKMR  132

>PITG_11249
Length=653

 Score = 262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 126/128 (98%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKRLIGRKFSDP+VQADIKHWPFK+T+G GDKPQITVQFKGE+KTFQPEEIS
Sbjct  65   NAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQPEEIS  124

Query  122  SMVLIKMR  129
            SMVLIKMR
Sbjct  125  SMVLIKMR  132

>PYIR_15857
Length=577

 Score = 259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    AGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>PYVX_15641
Length=629

 Score = 258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 123/127 (97%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  6    SGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDPIVQ+DIKHWPF LTSG GDKPQI VQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFTLTSGPGDKPQIQVQFKGESKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>PPTG_16727
Length=217

 Score = 246 bits (627),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)

Query  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            K +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  4    KVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
            MNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  GA +KPQ+ VQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQPEEI  123

Query  121  SSMVLIKMR  129
            SSMVLIKMR
Sbjct  124  SSMVLIKMR  132

>PYIR_15859
Length=626

 Score = 256 bits (655),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 126/129 (98%), Gaps = 0/129 (0%)

Query  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            + +G +VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  8    QVTGQTVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  67

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
            MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEEI
Sbjct  68   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQPEEI  127

Query  121  SSMVLIKMR  129
            SSMVLIKM+
Sbjct  128  SSMVLIKMK  136

>PYAP_17334
Length=650

 Score = 257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  6    SGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDPIVQADIKHWPF ++ GAGDKPQITVQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFTVSPGAGDKPQITVQFKGESKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVL KMR
Sbjct  126  MVLTKMR  132

>H310_02604
Length=312

 Score = 246 bits (629),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  63
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  123
             NTVFDAKRLIGRKF+DP++QADIKHWPFK+T GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  124  VLIKMR  129
            VLIKM+
Sbjct  126  VLIKMK  131

>PYU1_G013927
Length=649

 Score = 256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    AGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDPIVQAD KHWPF +++G GDKPQITVQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPIVQADCKHWPFTVSAGPGDKPQITVQFKGESKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>SDRG_11473
Length=636

 Score = 253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            T+ YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  2    TTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKRLIGRKF D +VQADIKHWPFK+TSGA DKPQITVQFKGESKTFQPEEIS
Sbjct  62   NATNTVFDAKRLIGRKFHDAVVQADIKHWPFKVTSGAADKPQITVQFKGESKTFQPEEIS  121

Query  122  SMVLIKMR  129
            SMVLIKM+
Sbjct  122  SMVLIKMK  129

>PYAP_19235
Length=643

 Score = 250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 122/127 (96%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  5    SGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  64

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKF+DP+VQAD+KHWPFK+ +GAGDKPQITV+FKGE K FQPEEISS
Sbjct  65   AHNTVFDAKRLIGRKFTDPVVQADMKHWPFKVVTGAGDKPQITVEFKGEKKVFQPEEISS  124

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  125  MVLTKMK  131

>PPTG_19690
Length=566

 Score = 248 bits (633),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)

Query  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            K +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  4    KVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
            MNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  GA +KPQ+ VQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQPEEI  123

Query  121  SSMVLIKMR  129
            SSMVLIKMR
Sbjct  124  SSMVLIKMR  132

>H310_02610
Length=650

 Score = 248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  63
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  123
             NTVFDAKRLIGRKF+DP++QADIKHWPFK+T GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  124  VLIKMR  129
            VLIKM+
Sbjct  126  VLIKMK  131

>SPRG_00068
Length=643

 Score = 248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 121/128 (95%), Gaps = 0/128 (0%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            T+ YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAKNQVAM
Sbjct  3    TTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKNQVAM  62

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKRLIGRKF D +VQADIKHWPFK+T GA DKPQITV+FKGESKTFQPEEIS
Sbjct  63   NAANTVFDAKRLIGRKFHDAVVQADIKHWPFKVTPGAADKPQITVEFKGESKTFQPEEIS  122

Query  122  SMVLIKMR  129
            SMVLIKM+
Sbjct  123  SMVLIKMK  130

>SPRG_04533
Length=652

 Score = 247 bits (630),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  63
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  123
             NTVFDAKRLIGRKF+DP  QADIKHWPFK+T GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  124  VLIKMR  129
            VLIKM+
Sbjct  126  VLIKMK  131

>SDRG_11899
Length=652

 Score = 247 bits (630),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  63
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  123
             NTVFDAKRLIGRKF+DP  QADIKHWPFK+T GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  124  VLIKMR  129
            VLIKM+
Sbjct  126  VLIKMK  131

>H257_17322
Length=606

 Score = 244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  63
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  123
             NTVFDAKRLIGRKF+D ++QADIKHWPFK+T GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDSVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  124  VLIKMR  129
            VLIKM+
Sbjct  126  VLIKMK  131

>PHYSO_482793
Length=658

 Score = 245 bits (625),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVARGPENKPQLVVQFKGESKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>H310_09557
Length=644

 Score = 244 bits (623),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)

Query  6    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  65
            SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  N
Sbjct  7    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  66

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            TVFDAKRLIGRKF+DP++QADIKHWPFK+ +G GDKPQI V+FKGESKTFQPEEISSMVL
Sbjct  67   TVFDAKRLIGRKFNDPMIQADIKHWPFKVVAGPGDKPQIVVEFKGESKTFQPEEISSMVL  126

Query  126  IKMR  129
            IKM+
Sbjct  127  IKMK  130

>PHYKE_7016
Length=650

 Score = 244 bits (624),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  7    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  66

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSD  VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQPEEISS
Sbjct  67   AHNTVFDAKRLIGRKFSDLEVQSDIKHWPFKVVRGPDNKPQVVVQFKGESKTFQPEEISS  126

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  127  MVLIKMR  133

>PITG_11252
Length=654

 Score = 244 bits (623),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 0/129 (0%)

Query  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            K +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  4    KVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
            MNAHNTVFD KRLIGRKF+DP VQ+DIKHWPF +  GA  KPQ+ VQFKGE KTFQPEEI
Sbjct  64   MNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFNVIRGAESKPQVVVQFKGEKKTFQPEEI  123

Query  121  SSMVLIKMR  129
            SSMVLIKMR
Sbjct  124  SSMVLIKMR  132

>PYU1_G013931
Length=663

 Score = 244 bits (623),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAA+NQVAMN
Sbjct  12   TGQSVGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAARNQVAMN  71

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKF+DP+VQAD KHWPFK+ +GA  KPQI VQFKGESKTFQPEEISS
Sbjct  72   AHNTVFDAKRLIGRKFTDPVVQADTKHWPFKVVAGAESKPQIVVQFKGESKTFQPEEISS  131

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  132  MVLTKMK  138

>HYAP_01537
Length=651

 Score = 244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKFSDP VQ+DIKHWPFK+T  + DKPQ+ VQFKGE+K FQPEEISS
Sbjct  66   AHNTVFDAKRLIGRKFSDPEVQSDIKHWPFKVTRDSADKPQVEVQFKGETKRFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>H257_12958
Length=649

 Score = 243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)

Query  6    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  65
            SVGIDLGTTYSCVG WQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  N
Sbjct  8    SVGIDLGTTYSCVGTWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  67

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            TVFDAKRLIGRKF+DP++QADIKHWPFK+ +GAGDKPQI V+FKGE KTFQPEEISSMVL
Sbjct  68   TVFDAKRLIGRKFNDPMIQADIKHWPFKVIAGAGDKPQIVVEFKGERKTFQPEEISSMVL  127

Query  126  IKMR  129
            IKM+
Sbjct  128  IKMK  131

>PYIW_16876
Length=643

 Score = 242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 119/127 (94%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    AGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
              NTVFDAKRLIGRKFSD +VQAD+KHWPFK+ +GA +KPQI V FKGE+KTFQPEEISS
Sbjct  66   PANTVFDAKRLIGRKFSDQVVQADLKHWPFKVVAGADNKPQIVVHFKGETKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>CCI43221
Length=660

 Score = 242 bits (617),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)

Query  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            + SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    QVSGPSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
            MNA NTVFDAKRLIGR+ SDP+VQADIKHWPFK+TS  GDK  ITVQ+KGE+K+F+PEEI
Sbjct  63   MNATNTVFDAKRLIGRRCSDPVVQADIKHWPFKVTSSEGDKTMITVQYKGETKSFRPEEI  122

Query  121  SSMVLIKMR  129
            SSMVLIKMR
Sbjct  123  SSMVLIKMR  131

>PHALS_09802
Length=651

 Score = 241 bits (616),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 118/127 (93%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFD KRLIGRKF+D  VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFADSEVQSDIKHWPFKVVCGPENKPQVVVQFKGESKTFQPEEISS  125

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  126  MVLIKMR  132

>PYVX_22981
Length=612

 Score = 240 bits (613),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQN+RVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  13   TGQSVGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  72

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            A NTVFDAKRLIGRKF+DP+VQ DI+HWPFK+++G+  KPQITVQF+GE KTFQPEEISS
Sbjct  73   AANTVFDAKRLIGRKFNDPVVQQDIRHWPFKVSAGSDSKPQITVQFQGERKTFQPEEISS  132

Query  123  MVLIKMR  129
            MVL+KMR
Sbjct  133  MVLMKMR  139

>PHYCA_104444
Length=644

 Score = 239 bits (611),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 116/127 (91%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFD KRLIGRKF+DP VQ+DIKHWPFKL  G   KP + VQFKGE +TFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKLVRGPESKPLVEVQFKGEKRTFQPEEISS  125

Query  123  MVLIKMR  129
            MVL+KMR
Sbjct  126  MVLVKMR  132

>PHYRA_41888
Length=586

 Score = 237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFD KRLIGRKF+DP VQ+DI+HWPFK+  G  +KP++ VQFKGE  TFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQPEEISS  125

Query  123  MVLIKMR  129
            MVL+KMR
Sbjct  126  MVLVKMR  132

>PHYRA_71655
Length=653

 Score = 237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFD KRLIGRKF+DP VQ+DI+HWPFK+  G  +KP++ VQFKGE  TFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQPEEISS  125

Query  123  MVLIKMR  129
            MVL+KMR
Sbjct  126  MVLVKMR  132

>PYAP_17333
Length=657

 Score = 236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 116/127 (91%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT TERLIGDAAKNQVAMN
Sbjct  7    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGTERLIGDAAKNQVAMN  66

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKF DP+VQAD+KHWPF++ +G  DKPQI V+FKGESK F  EEISS
Sbjct  67   AHNTVFDAKRLIGRKFRDPVVQADLKHWPFQVVAGPDDKPQIIVEFKGESKRFYAEEISS  126

Query  123  MVLIKMR  129
            MVL KMR
Sbjct  127  MVLTKMR  133

>CCI40249
Length=660

 Score = 232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)

Query  6    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  65
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            TVFDAKRLIGR FSDPIVQAD+KHWPF + +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVTFKGEKKIFQPEEISSMVL  124

Query  126  IKMR  129
            +KMR
Sbjct  125  VKMR  128

>CCA16153
Length=663

 Score = 231 bits (590),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)

Query  6    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  65
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            TVFDAKRLIGR FSDPIVQAD+KHWPF + +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVIFKGEKKIFQPEEISSMVL  124

Query  126  IKMR  129
            +KMR
Sbjct  125  VKMR  128

>CCA14967
Length=1431

 Score = 236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
             IDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA NTV
Sbjct  22   SIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAINTV  81

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            FDAKRLIGR+ SDP+VQADIKHWPFK+TS  GDKP ITVQ+KGE+K+F+PEEISSMVLIK
Sbjct  82   FDAKRLIGRRCSDPVVQADIKHWPFKVTSCEGDKPMITVQYKGETKSFRPEEISSMVLIK  141

Query  128  MR  129
            MR
Sbjct  142  MR  143

>PYAR_19807
Length=1613

 Score = 233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  8    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  67

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFDAKRLIGRKF+D +VQADIKHWPF++ + + +KPQI VQFKGE+K F  EEISS
Sbjct  68   AHNTVFDAKRLIGRKFTDAVVQADIKHWPFRVMADSANKPQIVVQFKGETKKFYAEEISS  127

Query  123  MVLIKMR  129
            MVL KMR
Sbjct  128  MVLTKMR  134

>CCI40247
Length=643

 Score = 214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 106/127 (83%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AAKNQVAMN
Sbjct  7    SGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAKNQVAMN  66

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            A NTVFDAKRLIGRKF D  VQ D KHWPF++  G  DKPQI V+ KG  K F  EEIS+
Sbjct  67   AENTVFDAKRLIGRKFHDQAVQQDTKHWPFRVVCGPEDKPQIVVEVKGAKKMFYAEEISA  126

Query  123  MVLIKMR  129
            MVL KMR
Sbjct  127  MVLSKMR  133

>CCA16151
Length=643

 Score = 211 bits (536),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 104/127 (82%), Gaps = 0/127 (0%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AAKNQVAMN
Sbjct  7    SGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAKNQVAMN  66

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            A NTVFDAKRLIGRKF D  VQ D KHWPF +  G  DKPQI V+  G  K F  EEIS+
Sbjct  67   AENTVFDAKRLIGRKFHDQTVQQDTKHWPFSVVCGPEDKPQIVVEVNGAKKMFYAEEISA  126

Query  123  MVLIKMR  129
            MVL KMR
Sbjct  127  MVLSKMR  133

>HYAP_01538
Length=130

 Score = 184 bits (466),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 85/88 (97%), Positives = 87/88 (99%), Gaps = 0/88 (0%)

Query  3   SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
           SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6   SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  63  AHNTVFDAKRLIGRKFSDPIVQADIKHW  90
           AHNTVFDAKRLIGRKFSD +VQAD+KHW
Sbjct  66  AHNTVFDAKRLIGRKFSDAVVQADVKHW  93

>H257_00007
Length=787

 Score = 194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANAEGNRTTPSWVAFNETERLIGEAAKLQAAS  248

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+T G GDKP I V F+GE+K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITKGEGDKPLIEVSFRGEAKSFTPEEIS  308

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  309  SMVLTRMK  316

>HYAP_01540
Length=634

 Score = 191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 99/127 (78%), Gaps = 18/127 (14%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            S YSVGID+GT YS VGVWQND VEIIA DQGNRT+                    VAMN
Sbjct  6    SDYSVGIDVGTMYSRVGVWQNDSVEIIAKDQGNRTSAV------------------VAMN  47

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            AHNTVFD KRLIGRKFSD +VQAD+KHWPFKLTSGAGDKPQITVQFKGESKTFQ EEISS
Sbjct  48   AHNTVFDGKRLIGRKFSDAVVQADVKHWPFKLTSGAGDKPQITVQFKGESKTFQSEEISS  107

Query  123  MVLIKMR  129
            MVLIKMR
Sbjct  108  MVLIKMR  114

>H257_18885
Length=786

 Score = 192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  247

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+T+G  DKP I V FKGE+K+F PEEIS
Sbjct  248  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITAGDDDKPLIEVTFKGEAKSFTPEEIS  307

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  308  SMVLTRMK  315

>H310_14759
Length=787

 Score = 192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  248

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK++ G GDKP I V F+GE K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKISKGEGDKPLIQVTFRGEDKSFTPEEIS  308

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  309  SMVLTRMK  316

>SPRG_10519
Length=782

 Score = 192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  183  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  242

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G GDKP I V FKGE K F PEEIS
Sbjct  243  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGEGDKPLIQVTFKGEEKNFSPEEIS  302

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  303  SMVLTRMK  310

>SDRG_05778
Length=618

 Score = 188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 103/128 (80%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  247

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  308  SMVLTRMK  315

>SDRG_05777
Length=786

 Score = 189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 104/128 (81%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAAS  247

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  308  SMVLTRMK  315

>SPRG_10477
Length=762

 Score = 189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 101/123 (82%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A NA NT
Sbjct  184  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAASNATNT  243

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
            VFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEISSMVL 
Sbjct  244  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDDDKPLIQVSFKGEDKRFTPEEISSMVLT  303

Query  127  KMR  129
            +M+
Sbjct  304  RMK  306

>PYU1_G001540
Length=633

 Score = 185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  93

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NAHNTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGE K F PEEIS
Sbjct  94   NAHNTVFDAKRIIGRNFNDEIVKKDAKHFPFKIVEGDDNKVLIEVEFKGEQKRFTPEEIS  153

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  154  SMVLTRMK  161

>HYAP_12660
Length=786

 Score = 186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 106/128 (83%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSD +V+ D KH+PFK+  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFKIKEGDDDKVLIEVEFKGEKKSFTPEEIS  306

Query  122  SMVLIKMR  129
            SMVL++M+
Sbjct  307  SMVLLRMK  314

>CCI46091
Length=787

 Score = 186 bits (471),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 106/128 (83%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTD+ERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDSERLIGEAAKIQAAS  247

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            N  NTVFDAKR+IGR F+D  VQ D +H+PFK+ SG GDKP I V+FK E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEFKKETKQFTPEEIS  307

Query  122  SMVLIKMR  129
            +MVL +M+
Sbjct  308  AMVLTRMK  315

>CCA20828
Length=787

 Score = 185 bits (470),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 106/128 (83%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTDTERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDTERLIGEAAKIQAAS  247

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            N  NTVFDAKR+IGR F+D  VQ D +H+PFK+ SG GDKP I V++K E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEYKKETKQFTPEEIS  307

Query  122  SMVLIKMR  129
            +MVL +M+
Sbjct  308  AMVLTRMK  315

>PYAP_22238
Length=633

 Score = 182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAS  93

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            N  NTVFDAKR+IGR FSD IV+ D  H+PFK+T G  +K  I V+FKGE+K+F PEEIS
Sbjct  94   NPSNTVFDAKRIIGRNFSDEIVKKDATHFPFKITEGDDNKVLIQVEFKGETKSFTPEEIS  153

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  154  SMVLTRMK  161

>PYIR_24387
Length=633

 Score = 182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  154  SMVLTRMK  161

>PYIW_22144
Length=633

 Score = 182 bits (461),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  122  SMVLIKMR  129
            SMVL +M+
Sbjct  154  SMVLTRMK  161

>PPTG_03121
Length=786

 Score = 182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 106/128 (83%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSD +V+ D  H+PFK+  G  DK  I V+FKGE+K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFKIKEGDDDKVLIEVEFKGENKSFTPEEIS  306

Query  122  SMVLIKMR  129
            SMVL++M+
Sbjct  307  SMVLLRMK  314

>PYVX_18121
Length=633

 Score = 181 bits (458),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 105/128 (82%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSD +V+ D  H+PFK+  G  +K  I V+FKGE+K F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFSDEVVKKDATHFPFKIVEGDDNKVLIEVEFKGEAKRFTPEEIS  153

Query  122  SMVLIKMR  129
            SMVL++M+
Sbjct  154  SMVLLRMK  161

>PITG_11913
Length=786

 Score = 182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDEDKVLIEVEFKGEKKSFTPEEIS  306

Query  122  SMVLIKMR  129
            SMVL++M+
Sbjct  307  SMVLLRMK  314

>PHYKE_10815
Length=786

 Score = 180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 104/128 (81%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEMVKKDAKHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  122  SMVLIKMR  129
            SMVL++M+
Sbjct  307  SMVLLRMK  314

>PHYRA_78193
Length=786

 Score = 180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 105/128 (82%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FKG+ K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDDDKVLIEVEFKGDKKSFTPEEIS  306

Query  122  SMVLIKMR  129
            SMVL++M+
Sbjct  307  SMVLLRMK  314

>PHALS_02079
Length=786

 Score = 179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 103/128 (80%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  246

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NT+FDAKR+IGR FSD +V+ D  H+PF +  G  DK  I V FKGE K+F PEEIS
Sbjct  247  NATNTIFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVDFKGEKKSFTPEEIS  306

Query  122  SMVLIKMR  129
            SMVL++M+
Sbjct  307  SMVLLRMK  314

>PHYCA_509820
Length=786

 Score = 177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 103/128 (80%), Gaps = 2/128 (2%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            NA NTVFDAKR+IGR FSD +V+ D  H+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  122  SMVLIKMR  129
            SMVL++M+
Sbjct  307  SMVLLRMK  314

>PHYRA_72238
Length=601

 Score = 169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (78%), Gaps = 0/126 (0%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  63
            G  VGIDLGTT++ VGVWQN+RVEI+ +  G+ +TPSYVAFT+T RLIG AAK Q+  NA
Sbjct  8    GPVVGIDLGTTFARVGVWQNNRVEIVPSCDGSYSTPSYVAFTETSRLIGHAAKYQLTRNA  67

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  123
             NTVF   +L+GRKFSDP VQ  +KHWPFK+  G  D P++ VQF+GE+KTFQP EI +M
Sbjct  68   RNTVFGMNQLVGRKFSDPEVQRSMKHWPFKVICGQNDNPEVEVQFRGETKTFQPVEILAM  127

Query  124  VLIKMR  129
            +L ++R
Sbjct  128  LLAELR  133

>PHYSO_339667
Length=160

 Score = 151 bits (381),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            VGIDLGTT S  GVW+N+ VEII N  G  +TPSYVAFTDT  L G+AAK Q   NA NT
Sbjct  8    VGIDLGTTCSRDGVWRNEDVEIIPNGDGAYSTPSYVAFTDTALLTGNAAKRQPTRNAENT  67

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
            VF+  +LIGRKFSDP +Q  I++WPFK+  G  D  Q+ VQ+KGE+K FQP EI +++L 
Sbjct  68   VFNIHQLIGRKFSDPALQLSIRYWPFKVECGPKDTAQVVVQYKGETKRFQPIEIVAILLC  127

Query  127  KMR  129
            +MR
Sbjct  128  EMR  130

>PHYSO_249902
Length=130

 Score = 150 bits (378),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GIDLG+ YS V VW NDRVEI+ +  G+R TP+ VAFT+TE LIG+ A +Q+  NA NT+
Sbjct  9    GIDLGSKYSRVAVWLNDRVEIVPSKSGDRFTPTIVAFTETEVLIGEPATHQLLQNAQNTI  68

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            FD  RLIGRKFSDP +Q  IK WPFK+  G  DKP + V FKG SK+F+  EI +M+L +
Sbjct  69   FDITRLIGRKFSDPEIQEGIKLWPFKVVCGPDDKPLVVVTFKGASKSFEAVEILAMLLSE  128

Query  128  MR  129
            +R
Sbjct  129  LR  130

>PYAR_14487
Length=467

 Score = 159 bits (402),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 86/127 (68%), Gaps = 37/127 (29%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  6    TGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  65

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            A NT                                     ITV FKGESKTFQPEEISS
Sbjct  66   AENT-------------------------------------ITVTFKGESKTFQPEEISS  88

Query  123  MVLIKMR  129
            MVL KMR
Sbjct  89   MVLTKMR  95

>PYIR_16738
Length=555

 Score = 159 bits (401),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 95/127 (75%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  31   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  90

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGR ++D  VQAD K  P+K+    G KP I V  KGE K F PEEIS+
Sbjct  91   PEQTLFDVKRLIGRSYNDKSVQADKKLLPYKIVDKDG-KPAIEVPIKGEKKLFSPEEISA  149

Query  123  MVLIKMR  129
            M+L KM+
Sbjct  150  MILTKMK  156

>HYAP_01005
Length=660

 Score = 159 bits (403),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQ+D K  P++L +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  148  MVLTKMK  154

>HYAP_01004
Length=660

 Score = 159 bits (403),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQ+D K  P++L +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  148  MVLTKMK  154

>PYIW_26567
Length=564

 Score = 158 bits (399),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 2/129 (2%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVA  60
            + G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  
Sbjct  28   SRGPIIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQAT  87

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
            +N   T+FD KRLIGR +SD  VQAD K  P+ + +  G KP I V  KGE K F PEEI
Sbjct  88   INPEKTIFDVKRLIGRDYSDKSVQADKKLLPYHIVNKDG-KPMIEVLIKGEKKLFSPEEI  146

Query  121  SSMVLIKMR  129
            S+M+L KM+
Sbjct  147  SAMILTKMK  155

>PHYSO_286376
Length=660

 Score = 159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQAD K  P++L +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVEVKGEKRQFAPEEVSA  147

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  148  MVLTKMK  154

>PITG_00527
Length=656

 Score = 159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQAD K  P++L +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  147  MVLTKMK  153

>SPRG_00333
Length=615

 Score = 158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
              NT+FD KRLIGR+++D  VQAD K  PF++ +  G +P I V+ KGE+KTF  EE+S+
Sbjct  89   PENTLFDVKRLIGRQYNDKSVQADKKLLPFEIINKEG-RPYIQVKVKGETKTFSAEEVSA  147

Query  123  MVLIKMR  129
            M+L KM+
Sbjct  148  MILTKMK  154

>PPTG_08245
Length=658

 Score = 158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQAD K  P+ L +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYNLVNKDG-KPFIEVEVKGEKRQFAPEEVSA  147

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  148  MVLTKMK  154

>PHYCA_510696
Length=659

 Score = 158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 98/127 (77%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYEIVNKEG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  147  MVLTKMK  153

>PHYKE_7992
Length=657

 Score = 158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQAD K  P+ L +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYTDKSVQADKKLLPYDLINKDG-KPFIQVEVKGEKRQFAPEEVSA  146

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  147  MVLTKMK  153

>H310_09434
Length=658

 Score = 157 bits (397),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
              NT+FD KRLIGR ++D  VQAD K  PF + +  G +P I V+ KGE+K F PEE+S+
Sbjct  89   PENTLFDVKRLIGRSYNDKSVQADKKLLPFHIVNKDG-RPFIEVKIKGEAKQFSPEEVSA  147

Query  123  MVLIKMR  129
            M+L KM+
Sbjct  148  MILTKMK  154

>CCI50234
Length=665

 Score = 157 bits (397),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 94/128 (73%), Gaps = 2/128 (2%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  61
            +G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  RLIGDAAKNQ   
Sbjct  34   TGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDATGTRLIGDAAKNQAVH  93

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            N   T+FD KRLIGRKF+D  VQAD K  P+++ +  G KP I V  KGE K F PEEIS
Sbjct  94   NPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTVKGEQKVFAPEEIS  152

Query  122  SMVLIKMR  129
            +MVL KM+
Sbjct  153  AMVLQKMK  160

>PHYSO_525236
Length=246

 Score = 149 bits (376),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 91/132 (69%), Gaps = 4/132 (3%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            T G S+GID+GT YS V +W  DR EI+ N  GNR T SYVAFTD++ L+GDAA +Q   
Sbjct  6    TGGPSIGIDIGTAYSRVAIWHKDRAEILPNRFGNRLTSSYVAFTDSKVLVGDAAADQRLQ  65

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGD----KPQITVQFKGESKTFQP  117
            NA NTVF   RL+GRKFSDP VQ  IKHWPFK+  G  D     P + VQF+G++K F P
Sbjct  66   NAENTVFGITRLLGRKFSDPEVQERIKHWPFKVIRGPHDTPPPPPHVMVQFRGQTKIFHP  125

Query  118  EEISSMVLIKMR  129
             +I S++L +MR
Sbjct  126  VQILSLLLSEMR  137

>PYIW_21755
Length=658

 Score = 157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGR ++D  VQAD K  P+ + +  G KP I V  KGE KTF PEE+S+
Sbjct  89   PEQTLFDVKRLIGRGYNDKSVQADKKLLPYNIINKDG-KPLIEVSVKGEKKTFSPEEVSA  147

Query  123  MVLIKMR  129
            M+L KM+
Sbjct  148  MILTKMK  154

>PYVX_16738
Length=658

 Score = 156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 95/127 (75%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQAD K  P+ +    G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYADKSVQADKKLLPYHIADKQG-KPFIEVTVKGEKRQFAPEEVSA  146

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  147  MVLTKMK  153

>PYAP_13341
Length=657

 Score = 156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KGE+K F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPFIQVTIKGENKLFAPEEVSA  147

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  148  MVLTKMK  154

>PHYRA_71042
Length=654

 Score = 156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  25   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  84

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQ+D K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  85   PEKTLFDVKRLIGRKYNDKSVQSDKKLLPYEIINKDG-KPFIQVEVKGEKREFAPEEVSA  143

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  144  MVLTKMK  150

>SDRG_03564
Length=658

 Score = 155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 97/127 (76%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
              NT+FD KRLIGR+++D  VQAD K  P+++ +  G +P I V  KGE+KTF  EE+S+
Sbjct  89   PENTLFDVKRLIGRQYNDKSVQADKKLLPYEIVNKEG-RPYIQVIVKGETKTFSAEEVSA  147

Query  123  MVLIKMR  129
            M+L KM+
Sbjct  148  MILTKMK  154

>PHALS_00833
Length=652

 Score = 154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEII NDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIPNDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGRK++D  VQAD K  P++L +  G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVVIKGEKRQFAPEEVSA  146

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  147  MVLSKMK  153

>PYAR_18354
Length=1084

 Score = 155 bits (393),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 95/127 (75%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  30   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  89

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGR ++D  VQAD K  PF + +  G KP I V  KGE K F PEEIS+
Sbjct  90   PEKTLFDVKRLIGRPYNDKSVQADKKLLPFDIVNKDG-KPFIQVTIKGEKKQFSPEEISA  148

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  149  MVLSKMK  155

>PYU1_G004098
Length=656

 Score = 154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 96/127 (76%), Gaps = 2/127 (2%)

Query  4    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  62
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
               T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KGE K F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRGYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGEKKHFSPEEVSA  146

Query  123  MVLIKMR  129
            M+L KM+
Sbjct  147  MILTKMK  153

>PYU1_G004097
Length=663

 Score = 153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 96/124 (77%), Gaps = 2/124 (2%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNAHN  65
            +GIDLGTTYSCVGV+++ +V+IIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N   
Sbjct  36   IGIDLGTTYSCVGVFKDGKVDIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATINPEK  95

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KG++K F PEEIS+MVL
Sbjct  96   TIFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGQTKLFSPEEISAMVL  154

Query  126  IKMR  129
             KM+
Sbjct  155  GKMK  158

>CCA24936
Length=661

 Score = 152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 93/128 (73%), Gaps = 2/128 (2%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  61
            +G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  R+IGDAAKNQ   
Sbjct  30   TGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDVTGTRMIGDAAKNQAIH  89

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            N   T+FD KRLIGRKF+D  VQAD K  P+++ +  G KP I V  K E K F PEEIS
Sbjct  90   NPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTIKDEQKVFAPEEIS  148

Query  122  SMVLIKMR  129
            +MVL KM+
Sbjct  149  AMVLQKMK  156

>PHYSO_339666
Length=585

 Score = 140 bits (353),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 88/123 (72%), Gaps = 2/123 (2%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            VGIDLGTT S VGVW+N+RVE I N Q    TPSYVAFT+T  L+G+AAK Q+  N  NT
Sbjct  5    VGIDLGTTGSRVGVWRNERVEFIPNRQQAYWTPSYVAFTETALLVGEAAKRQLTTNPENT  64

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
            VFD  + +GRKFS+  ++  +  WPFK+  G  D PQ+ VQ+KGE+K+F P EI +++L 
Sbjct  65   VFDLTQFVGRKFSE--LRESVIDWPFKVECGPEDTPQVVVQYKGETKSFMPVEIMAILLY  122

Query  127  KMR  129
            +MR
Sbjct  123  EMR  125

>PHYSO_525429
Length=610

 Score = 133 bits (334),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 82/117 (70%), Gaps = 3/117 (3%)

Query  13   TTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKR  72
            TT   VGVW N+ V ++ +D   R  PS+VAFTDTERL+GD AK QVA N +NTVF   R
Sbjct  3    TTCLRVGVWVNNNVAVLTSD---RPLPSFVAFTDTERLVGDVAKRQVATNVNNTVFGTTR  59

Query  73   LIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMR  129
            LIGRKFSD  VQ D+KHWPFK+  G  D P + VQ  G++KTF+P EI +M+L + R
Sbjct  60   LIGRKFSDLEVQEDLKHWPFKVVGGPNDGPLVEVQAAGQTKTFRPVEILAMLLAEAR  116

>HYAP_01993
Length=569

 Score = 118 bits (295),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 57/122 (47%), Positives = 77/122 (63%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+GTT+ CVGVWQN +V IIANDQG RTTP+YV F   E ++GD A N++A +A NT+
Sbjct  5    GIDIGTTHGCVGVWQNGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKLASHADNTI  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KRL+G+  +D   +  +K WPF +T GA    Q   Q  GE     P E   ++L  
Sbjct  65   FHLKRLLGKAHADVKDREFVKEWPFGVTEGADGVAQAETQRNGEKHAVDPVEFMMLLLQN  124

Query  128  MR  129
            ++
Sbjct  125  LK  126

>PHYSO_552116
Length=570

 Score = 117 bits (292),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KRL+G+  +D   +  +K WPF +T+GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVADRDFVKEWPFDITAGADGVAQAETQRNGEKHPVSPVEFMALLLQN  124

Query  128  MR  129
            ++
Sbjct  125  LK  126

>PHYRA_71591
Length=570

 Score = 116 bits (290),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KRL+G+  +D   +  +K WPF +T+GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVSDRDYVKEWPFNVTAGADGVAQAETQRNGEKHPVTPVEFMALLLQN  124

Query  128  MR  129
            ++
Sbjct  125  LK  126

>PPTG_10122
Length=569

 Score = 115 bits (287),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 78/122 (64%), Gaps = 1/122 (1%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KRL+G+  +D   +  +K WPF +T GA +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVKDRDFVKEWPFDVTQGA-EGAQVETQRSGEKHPVTPVEFMAVLLQN  123

Query  128  MR  129
            ++
Sbjct  124  LK  125

>PHYCA_532207
Length=1118

 Score = 113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 77/124 (62%), Gaps = 2/124 (2%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GID+GTT+ CVGVW N +V +IANDQG RTTP+YV F   E ++GD A N++  +A NT
Sbjct  552  IGIDIGTTHGCVGVWHNGKVNVIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNT  611

Query  67   VFDAKRLIGRKFSDPIVQAD-IKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            +F  KRL+G K  D I   D +K WPF +T GA    Q   +  GE     P E  +++L
Sbjct  612  IFHLKRLLG-KAHDEIKDRDFVKEWPFDVTEGAEGVAQAETKRNGEKHPVTPVEFMTLLL  670

Query  126  IKMR  129
              ++
Sbjct  671  QNLK  674

>PITG_03546
Length=569

 Score = 110 bits (275),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 77/122 (63%), Gaps = 1/122 (1%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F   R++G+  +D   +  +K WPF +T G+ +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLNRILGKAHADIKDRDFVKEWPFDVTQGS-EGAQVETQRNGEKHPVTPVEFMAVLLQN  123

Query  128  MR  129
            ++
Sbjct  124  LK  125

>SPRG_11133
Length=676

 Score = 110 bits (275),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 79/123 (64%), Gaps = 7/123 (6%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GIDLGTT   VGVW++ +VE++ ND GN +TPS VAFTD  RL+GD AK+Q   NA NT
Sbjct  10   IGIDLGTTTCSVGVWRHGQVEMVRNDNGNLSTPSCVAFTDAGRLVGDFAKSQAPRNAPNT  69

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
            VF+  R+IGR++       D      ++  G  + P I V  KGE+K   PEEI + +++
Sbjct  70   VFNIMRIIGRRY-------DEVRKKTQVVCGPKNNPMIRVVEKGETKELHPEEILAELVV  122

Query  127  KMR  129
            K++
Sbjct  123  KLK  125

>PHYKE_64
Length=569

 Score = 107 bits (266),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (60%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A +T+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADSTI  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            +  KRL+G+  +D   +  +K WPF +  GA           GE     P +  +++L  
Sbjct  65   YHLKRLLGKSHADVASRDFVKSWPFDVMEGAKGGAHAETVRNGEKHEVSPVDFMALLLQN  124

Query  128  MR  129
            ++
Sbjct  125  LK  126

>CCI47582
Length=582

 Score = 105 bits (262),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 74/121 (61%), Gaps = 0/121 (0%)

Query  6    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  65
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHADN  62

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
             VF  +RL+G+K+ +      +  W FK+     D+ Q     K   + ++   +  + L
Sbjct  63   IVFHLRRLLGKKYEEIAENPHVNEWFFKVEKDGKDEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  126  I  126
            +
Sbjct  123  L  123

>PYAP_16216
Length=564

 Score = 104 bits (260),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 74/122 (61%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+G+T+ CVGVWQN +V IIANDQG RTTP++V F   E ++GD A N++  +A NTV
Sbjct  5    GIDIGSTHGCVGVWQNGKVNIIANDQGFRTTPAFVCFEGEEVIVGDTAVNKLHSHAANTV  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KR++G+   +   +  +  W F+LT GA           GE+    P +  S+++  
Sbjct  65   FHLKRVLGKNHEEIASRDFVSEWSFELTKGADGLAVAKTARNGEAHEVSPVDFVSILIKN  124

Query  128  MR  129
            ++
Sbjct  125  LK  126

>PHALS_00390
Length=569

 Score = 102 bits (255),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 73/122 (60%), Gaps = 1/122 (1%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KRL+G+   +   +  +K W F +   A +   +  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKNHDEIKDRNFVKEWSFSVAQNA-EGVTVETQRNGEKHHVTPVEFMALLLQN  123

Query  128  MR  129
            ++
Sbjct  124  LK  125

>CCA20229
Length=583

 Score = 101 bits (252),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 73/121 (60%), Gaps = 0/121 (0%)

Query  6    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  65
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHAEN  62

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
             VF   RL+G+   +    A +  W FK+   + ++ Q     K   + ++   +  + L
Sbjct  63   IVFHLGRLLGKSHEEVAENAHVNEWFFKVEKDSKNEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  126  I  126
            +
Sbjct  123  L  123

>H310_12765
Length=560

 Score = 101 bits (252),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 75/124 (60%), Gaps = 2/124 (2%)

Query  6    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  65
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCMVSFASDDVVVGDSAVAKLHNNAAN  62

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            TV+  KR++G+K  D      +K W F L +     P I     G S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKDVHAHEYVKDWSFDLAADKHGAP-IAKILDG-SRDIHAVEFCTIVL  120

Query  126  IKMR  129
             K++
Sbjct  121  RKLK  124

>PYU1_G003754
Length=650

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 71/124 (57%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  30   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  89

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKF D   Q   K   +K+ SG   K    V+ KG  K + P +I SMVL
Sbjct  90   TFYAVKRLIGRKFQDKETQEVSKVVSYKIVSGPNGK-DAWVEAKG--KKYSPSQIGSMVL  146

Query  126  IKMR  129
             KM+
Sbjct  147  TKMK  150

>SPRG_15695
Length=581

 Score = 99.4 bits (246),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA NT
Sbjct  30   IGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAANT  89

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
            V+  KR++G+K SD      IK W F + + A       V  K   +     E +S+VL 
Sbjct  90   VYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKREISATEFASLVLG  149

Query  127  KMR  129
            K++
Sbjct  150  KLK  152

>PHYKE_9008
Length=650

 Score = 99.4 bits (246),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 71/124 (57%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  28   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAIIDNDERLVGMPAKRQAVTNPEN  87

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKFSD   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  88   TFYAVKRLIGRKFSDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  144

Query  126  IKMR  129
             KM+
Sbjct  145  TKMK  148

>SPRG_17185
Length=83

 Score = 91.3 bits (225),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)

Query  7   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
           +GIDLGTT   VGVW++ +VE++ ND GN +TPS VAFTD  RL+GD AK+Q   NA NT
Sbjct  10  IGIDLGTTTCSVGVWRHGQVEMVRNDNGNLSTPSCVAFTDAGRLVGDFAKSQAPRNAPNT  69

Query  67  VFDAKRLIGRKFSD  80
           VF+  R+IGR++ +
Sbjct  70  VFNIMRIIGRRYDE  83

>SDRG_10038
Length=565

 Score = 99.4 bits (246),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA NT
Sbjct  4    IGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAANT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
            V+  KR++G+K SD      IK W F + + A       V  K   +     E +S+VL 
Sbjct  64   VYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKRDVSATEFASLVLG  123

Query  127  KMR  129
            K++
Sbjct  124  KLK  126

>PYU1_G006940
Length=565

 Score = 98.6 bits (244),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLHSHAENTI  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KR++G+   D +    I+ W FK++              GE     P E  S+++  
Sbjct  65   FHLKRVLGKNHEDVVDHDYIQEWSFKVSKADDGAVHAATSRNGEPHHVTPVEFVSLLIKN  124

Query  128  MR  129
            ++
Sbjct  125  LK  126

>PHYRA_71123
Length=633

 Score = 98.6 bits (244),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 70/124 (56%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKAARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKYSPSQIGSMVL  127

Query  126  IKMR  129
             KM+
Sbjct  128  TKMK  131

>H257_07650
Length=563

 Score = 97.8 bits (242),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 75/124 (60%), Gaps = 2/124 (2%)

Query  6    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  65
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCIVSFASDDVVVGDSAVAKLHNNAAN  62

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            TV+  KR++G+K  +      +K W F L +     P I     G S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKEVHEHDYVKDWSFDLAADTHGAP-IAKILDG-SRDISSVEFCTIVL  120

Query  126  IKMR  129
             K++
Sbjct  121  RKLK  124

>PYIR_24123
Length=567

 Score = 97.8 bits (242),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 46/122 (38%), Positives = 73/122 (60%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E ++GD A N+++ +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIVGDTAVNKLSSHAENTI  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KR++G+   + + +  I+ W FK+               GE+    P E  S+++  
Sbjct  65   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSEDGAVHAATSRNGEAHHVTPVEFVSLLIKN  124

Query  128  MR  129
            ++
Sbjct  125  LK  126

>PYVX_17692
Length=551

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 76/122 (62%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GIDLG+T+ CVGVW N +V IIANDQG RTTP++V F   E ++GD A +++  +A +TV
Sbjct  5    GIDLGSTHGCVGVWHNGKVNIIANDQGFRTTPAFVCFEGDEVIVGDTAVHKLPAHADSTV  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KR++G+  +D   +  ++ WPF + +G G     T Q  G +    P +  +++L  
Sbjct  65   FHLKRVLGKSQADVASRPFVQDWPFDVAAGEGGAAVATTQKNGAAHQVAPVDFLALLLRN  124

Query  128  MR  129
            +R
Sbjct  125  LR  126

>PYIW_19165
Length=1124

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 72/122 (59%), Gaps = 0/122 (0%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  585  GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLTSHAENTI  644

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  127
            F  KR++G+   + + +  I+ W FK+               G++    P E  S+++  
Sbjct  645  FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSDDGAVHAATSRNGDAHHVTPVEFVSLLIKN  704

Query  128  MR  129
            ++
Sbjct  705  LK  706

>PHYCA_541134
Length=633

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 70/124 (56%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  126  IKMR  129
             KM+
Sbjct  128  TKMK  131

>PITG_15786
Length=633

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 70/124 (56%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  126  IKMR  129
             KM+
Sbjct  128  TKMK  131

>PHALS_07616
Length=677

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 70/124 (56%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  55   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  114

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  115  TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKYSPSQIGSMVL  171

Query  126  IKMR  129
             KM+
Sbjct  172  TKMK  175

>PYVX_15051
Length=632

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 72/124 (58%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKAPRVIENSEGARTTPSVVAILENDERLVGMPAKRQAVTNPQN  70

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKF+D   Q   K   +++ SG   K    V+ KG  K + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFTDKETQEVSKVVSYEIVSGPNGK-DAWVEAKG--KKYSPSQIGSMVL  127

Query  126  IKMR  129
             KM+
Sbjct  128  TKMK  131

>PYAR_19930
Length=625

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 2/65 (3%)

Query  4    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D ERLIG+AAK Q A 
Sbjct  168  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDQERLIGEAAKIQAAS  227

Query  62   NAHNT  66
            N  NT
Sbjct  228  NPTNT  232

>H257_01277
Length=652

 Score = 96.3 bits (238),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 74/124 (60%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N +N
Sbjct  28   IGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPYN  87

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T++  KRLIGRKF D   Q   K   +K+ +G  +     V+ +G+   + P +I SMVL
Sbjct  88   TLYAVKRLIGRKFQDKETQEVAKVVSYKIVAGT-NGTDAWVEAQGQK--YSPSQIGSMVL  144

Query  126  IKMR  129
             KM+
Sbjct  145  TKMK  148

>PHYSO_500480
Length=633

 Score = 96.3 bits (238),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 70/124 (56%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  126  IKMR  129
             KM+
Sbjct  128  TKMK  131

>PPTG_18274
Length=648

 Score = 96.3 bits (238),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 69/124 (56%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  86

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG    + P +I SMVL
Sbjct  87   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGTK--YSPSQIGSMVL  143

Query  126  IKMR  129
             KM+
Sbjct  144  TKMK  147

>SDRG_01068
Length=621

 Score = 96.3 bits (238),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 1/120 (1%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQ-GNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  65
            + ID+GT+   VGVW+NDRVE++A D  G    P+YVAFTD  RL+G  AK   A +A N
Sbjct  5    IAIDIGTSNLRVGVWRNDRVELLALDSDGATALPAYVAFTDAGRLVGRRAKAYAATDAAN  64

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
             VF   R +GR   D  V+AD    PF++ + + DKPQ+ V   G+  TF  EE+ + +L
Sbjct  65   VVFRMTRFLGRSMRDRGVRADCDKVPFQVVASSDDKPQVRVTLNGQPSTFDLEEVLATLL  124

>SDRG_01067
Length=611

 Score = 95.5 bits (236),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 51/128 (40%), Positives = 79/128 (62%), Gaps = 1/128 (1%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            ++ + V ID+GT+   VGVW+N RV ++A D G  + P+ VAFTDT  L G  AK     
Sbjct  3    SNTHCVAIDIGTSRVRVGVWRNGRVHVLALD-GAESLPAVVAFTDTLTLFGHQAKAYAQD  61

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            +  N V +A +L+GR+ +DPIVQA +   PF++ + +   P I VQ +  + T+ P+EI 
Sbjct  62   HPTNVVSNALQLLGRRMNDPIVQAAVAGAPFRIRASSDKTPLICVQHQRSACTYYPQEII  121

Query  122  SMVLIKMR  129
            +M+L  +R
Sbjct  122  AMLLEHVR  129

>PYAP_19738
Length=648

 Score = 94.7 bits (234),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 70/124 (56%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  29   IGIDLGTTNSCVAVMEGKTPRVIENAEGARTTPSVVAILENDERLVGMPAKRQAVTNPDN  88

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  89   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVPGPNGK-DAWVEAKG--KKYSPSQIGSMVL  145

Query  126  IKMR  129
             KM+
Sbjct  146  TKMK  149

>SPRG_02294
Length=634

 Score = 94.4 bits (233),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 71/124 (57%), Gaps = 4/124 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            T++  KRLIGRKFSD   Q   K   + + +G   +       + + + + P +I SMVL
Sbjct  87   TLYAVKRLIGRKFSDKETQEVSKVVSYNIVAGTNGQ---DAWVEAQGQKYSPSQIGSMVL  143

Query  126  IKMR  129
             KM+
Sbjct  144  TKMK  147

>SDRG_11043
Length=649

 Score = 94.0 bits (232),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 71/125 (57%), Gaps = 6/125 (5%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGA-GDKPQITVQFKGESKTFQPEEISSMV  124
            T++  KRLIGRKF+D   Q   K   +K+  G  G    +  Q     + + P +I SMV
Sbjct  87   TLYAVKRLIGRKFNDKETQEVSKVVSYKIVPGTNGSDAWVEAQ----GQKYSPSQIGSMV  142

Query  125  LIKMR  129
            L KM+
Sbjct  143  LTKMK  147

>H310_06631
Length=651

 Score = 93.2 bits (230),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 74/127 (58%), Gaps = 10/127 (8%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  65
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  28   IGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPFN  87

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQIT---VQFKGESKTFQPEEISS  122
            T++  KRLIGRK+ D   Q   K   +K+ +G    P  T   V+ +G+   + P +I S
Sbjct  88   TLYAVKRLIGRKYQDKETQDVSKVVSYKIVAG----PNGTDAWVEAQGQK--YSPSQIGS  141

Query  123  MVLIKMR  129
            MVL KM+
Sbjct  142  MVLTKMK  148

>PYAR_24687
Length=618

 Score = 90.1 bits (222),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 5/132 (4%)

Query  2    TSGYSVGIDLGTTYSCVGVWQND--RVEIIANDQGNRTTPSYVAFTDT--ERLIGDAAKN  57
            ++ + + ID GT+ +   V +N   +VEII ND+G+  TP+YV +     E ++G  AK 
Sbjct  35   SAHHMIAIDFGTSNTRAAVVRNTTGQVEIIPNDKGHSATPTYVTWDSVTGEVIVGRDAKQ  94

Query  58   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  117
            Q  +   NT FD K+L+GR F    VQ+ I   P+ +     +KP I V+ KGE++ F  
Sbjct  95   QALLQPKNTAFDFKQLLGRSFDSKEVQSAIAQLPYTIID-RDNKPFIQVEMKGETREFSV  153

Query  118  EEISSMVLIKMR  129
            EE+++MVL +M+
Sbjct  154  EEVTAMVLTRMK  165

>SPRG_00183
Length=609

 Score = 89.7 bits (221),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 46/124 (37%), Positives = 72/124 (58%), Gaps = 1/124 (1%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            ++ + + ID+G +   VGVW+N R  ++A D  N   P+ VAFTDT  L G+ AK     
Sbjct  3    SNTHCIAIDIGASTIRVGVWRNGRATVLALDGAN-GLPAVVAFTDTTTLFGNQAKAIAQN  61

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            +  N VF+   L+GR+ +DP VQA +   PF++ + +   P I VQ +  + T+ P+EI 
Sbjct  62   DPTNVVFNVLHLLGRRMNDPTVQAMVTSAPFRIIASSDKTPLIHVQHRRSACTYYPQEIV  121

Query  122  SMVL  125
             M+L
Sbjct  122  GMLL  125

>CCI45982
Length=661

 Score = 89.4 bits (220),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 4/128 (3%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAM  61
            SG  +GIDLGTT SCV   +     +I N +G RTTPS VA  D  ERL+G  AK Q   
Sbjct  32   SGAVIGIDLGTTNSCVATMEGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQAVT  91

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            N  +T +  KRLIGRK++D       +   +K+  G   K    V+ KG+   + P +I 
Sbjct  92   NPESTFYAVKRLIGRKYNDGETNKVKEVVSYKIVPGPNGK-DAWVETKGQK--YSPSQIG  148

Query  122  SMVLIKMR  129
            SMVL KM+
Sbjct  149  SMVLAKMK  156

>SPRG_00182
Length=615

 Score = 89.4 bits (220),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/118 (41%), Positives = 69/118 (58%), Gaps = 1/118 (1%)

Query  9    IDLGTTYSCVGVWQNDRVEIIAND-QGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            +D+GT+   VGV +N+RVE++A D  G    P+YVAFTD+ RL G  AK   A    N +
Sbjct  7    LDIGTSSLRVGVKRNNRVELLALDGDGATAMPAYVAFTDSGRLFGRRAKAYAASAPENVI  66

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            F   R +G    D  V+AD    PF++ + + DKPQ+ V   G+  TF  EE+ +M+L
Sbjct  67   FRMLRFLGGSMRDLNVRADCDKVPFRVVASSDDKPQVRVTVNGQPSTFDLEEVMAMLL  124

>CCA21514
Length=659

 Score = 87.8 bits (216),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 4/128 (3%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAM  61
            SG  +GIDLGTT SCV         +I N +G RTTPS VA  D  ERL+G  AK Q   
Sbjct  31   SGAVIGIDLGTTNSCVATMDGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQAVT  90

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
            N  +T +  KRLIGRK++D       +   +K+  G+  K    V+ KG+   + P +I 
Sbjct  91   NPESTFYAVKRLIGRKYNDHETNKVKEVVSYKIVPGSNGK-DAWVETKGQK--YSPSQIG  147

Query  122  SMVLIKMR  129
            SMVL KM+
Sbjct  148  SMVLGKMK  155

>HYAP_04461
Length=160

 Score = 82.0 bits (201),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 64/123 (52%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSMARMHYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +++   F     +     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFKHPEVQQELQQLAFTCVELSSGDVGIVLTYNDEPVTFSCEQVVAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PHYCA_111740
Length=810

 Score = 84.7 bits (208),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +IK   +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIKQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>HYAP_01510
Length=138

 Score = 79.7 bits (195),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)

Query  76   RKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMR  129
            +K +  ++QA++KHWP KLTS A ++ QITVQFK ES TFQP EISSMVLIKMR
Sbjct  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90

>PYVX_13288
Length=810

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAISVARMHYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +I    +     A     I +Q+  E  TF  E+I +MVL 
Sbjct  64   ATDIKRLIGRKFKHPEVQREIAQLAYPCVELANGDVGIVLQYNDEPVTFSCEQIVAMVLN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PPTG_19375
Length=809

 Score = 83.2 bits (204),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +I    +K    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>CCA15913
Length=857

 Score = 83.2 bits (204),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  43   IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  102

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQA+I    FK    A     I +++     TF  E+I +M+L 
Sbjct  103  ATDIKRLIGRKFKHPEVQAEIAQLSFKCDEMANGDVGIVLKYNDADVTFSCEQIIAMILN  162

Query  127  KMR  129
            KM+
Sbjct  163  KMQ  165

>CCI46709
Length=819

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQA+I    F+    A     I +++     TF  E+I +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQAEIAQLSFRCEEMANGDVGIVLKYNDADVTFSCEQIIAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PHYKE_6664
Length=804

 Score = 81.6 bits (200),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +I    ++    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYECVELASGDVGIVLSYNDEPVTFSCEQVVAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PHYRA_82545
Length=806

 Score = 81.6 bits (200),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 64/123 (52%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ ++    +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQELAQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>H310_06229
Length=800

 Score = 81.6 bits (200),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKFS P VQ +IK++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIKNYGFKCVELPSGQVGIVLNYNDNPVTYTCEQVVAMMLN  123

Query  127  KMR  129
            K++
Sbjct  124  KLQ  126

>PHALS_04095
Length=803

 Score = 81.3 bits (199),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +I    +     A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDLKRLIGRKFKHPEVQKEIAQLAYTCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>HYAP_04460
Length=818

 Score = 81.3 bits (199),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 64/123 (52%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSMARMHYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +++   F     +     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFKHPEVQQELQQLAFTCVELSSGDVGIVLTYNDEPVTFSCEQVVAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PYAR_15468
Length=769

 Score = 81.3 bits (199),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G T   +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNTDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +I    F           + +++  E+ TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAFPCVELPNGDVGVVLRYNDEAVTFTCEQVVAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>H257_16484
Length=795

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKFS P VQ +I+++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIQNYGFKCVELPSGQVGIVLNYNDNPVTYSCEQVVAMMLN  123

Query  127  KMR  129
            K++
Sbjct  124  KLQ  126

>PYU1_G008851
Length=795

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 63/123 (51%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSVARAHFKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E+I +MVL 
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQIVAMVLN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PYAP_18643
Length=804

 Score = 79.3 bits (194),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNVDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +I    +K          + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAYKCVELPNGDVGVVLNYNDEPVTFTCEQVVAMILN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PYIR_18381
Length=747

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEISQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PYIW_19676
Length=664

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PYIR_19697
Length=608

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 58/103 (56%), Gaps = 4/103 (4%)

Query  28   IIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQAD  86
            +I N +G RTTPS VA  D  ERL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  87   IKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMR  129
             K   +K+ +G   K    V+ KG  K + P +I SMVL KM+
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMK  107

>PYAR_22188
Length=634

 Score = 75.9 bits (185),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 58/103 (56%), Gaps = 4/103 (4%)

Query  28   IIANDQGNRTTPSYVAFTDTE-RLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQAD  86
            +I N +G RTTPS VA  D E RL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENAEGARTTPSVVAILDNEERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  87   IKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMR  129
             K   +K+ +G   K    V+ KG  K + P +I SMVL KM+
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMK  107

>SPRG_06720
Length=425

 Score = 75.5 bits (184),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 68/127 (54%), Gaps = 2/127 (2%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMNA  63
            +SVGIDLGTTYS V V Q D V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  31   HSVGIDLGTTYSVVAVNQKDNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  90

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGE-SKTFQPEEISS  122
             +T+F+AKR IGR F   +   +  H+ F L      +    +   G  ++   P ++ +
Sbjct  91   RHTIFNAKRFIGRAFDATVETEEAPHYEFGLGRDEAHRVCFPLSVTGHATRCVSPVDVGA  150

Query  123  MVLIKMR  129
             ++ +++
Sbjct  151  HIVSQLK  157

>SDRG_16559
Length=461

 Score = 74.3 bits (181),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 3/127 (2%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMNA  63
            +SVGIDLGTTYS V V Q   V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  68   HSVGIDLGTTYSVVAVNQKGNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  127

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGE-SKTFQPEEISS  122
             +T+F+AKR IGR F D  V+ +  H+ F L     ++    +   G  ++   P ++ +
Sbjct  128  RHTIFNAKRFIGRAF-DAAVETEASHYEFGLDRDEANRVCFPLSVTGHATRCASPIDVGA  186

Query  123  MVLIKMR  129
             ++ +++
Sbjct  187  HIVSQLK  193

>PYAR_24704
Length=525

 Score = 73.6 bits (179),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 0/107 (0%)

Query  23   NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPI  82
            N +V IIANDQG RTTP+YV F   E ++GD A N+V  +A NT+F  KR++G+   D  
Sbjct  1    NGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKVHSHAANTIFHLKRVLGKNHEDVA  60

Query  83   VQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMR  129
                +  W F +  GA           G      P E  S++L  ++
Sbjct  61   ASDFVSEWSFDVAKGADGAVVAKTSRNGADHEVTPVEFLSILLKNLK  107

>PYIW_19956
Length=459

 Score = 72.4 bits (176),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 4/127 (3%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  64
            + VGIDLGTTYS V + Q + V +I +  G+   PS VAF   E L+G  A+     +  
Sbjct  61   HVVGIDLGTTYSVVAIAQKNNVSVIPDAFGHVIIPSIVAFLPGEVLVGRQARAHRTRDPK  120

Query  65   NTVFDAKRLIGRKFSDPIVQADIKHWPFKL--TSGAGDKPQITVQFKGESKTFQPEEISS  122
            +T+F+AKR IGR + D +   D   + + +  T   G   Q++V   G  K   P  I S
Sbjct  121  HTIFNAKRFIGRTYKDVVQSKDDASYEYTVARTPEGGVCFQLSV--AGHPKCVTPVAIGS  178

Query  123  MVLIKMR  129
             ++  +R
Sbjct  179  AIVSHLR  185

>SDRG_03266
Length=792

 Score = 72.4 bits (176),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 59/123 (48%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFSCEQVVGMFLN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PYAR_14579
Length=567

 Score = 72.4 bits (176),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 74/130 (57%), Gaps = 8/130 (6%)

Query  7    VGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTERLIGDAAKNQVA  60
            +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  +  E L+G+AA  +  
Sbjct  23   IGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVHFLPSSHEVLVGNAAIAREY  81

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESK-TFQPEE  119
                NTV   KRL+G++F    VQ   K     + + A     + VQ  G+     QPEE
Sbjct  82   EPPGNTVRAIKRLMGQRFDSRAVQLASKFATHSIVATAQGNAAVQVQRGGDGVIAVQPEE  141

Query  120  ISSMVLIKMR  129
            I++ VL +++
Sbjct  142  IAAEVLRELK  151

>SPRG_08060
Length=793

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 59/123 (48%), Gaps = 0/123 (0%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  126
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFTCEQVVGMFLN  123

Query  127  KMR  129
            KM+
Sbjct  124  KMQ  126

>PYAP_21865
Length=481

 Score = 70.5 bits (171),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 69/130 (53%), Gaps = 9/130 (7%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  64
            ++VGIDLGTTYS V + QN+ V +I ++ G+  TPS VA+    R    A + +   +  
Sbjct  71   HTVGIDLGTTYSVVAISQNNSVTVIPDEHGHLITPSIVAYLPNGRREARAYRTK---DPR  127

Query  65   NTVFDAKRLIGRKFSDPIVQADIKHWPFKLT-SGAGDKPQITVQFK----GESKTFQPEE  119
            +T+F+AKR IGR F D    A    WP++ T    G+    TV F+    G      P +
Sbjct  128  HTIFNAKRFIGRSFRDVSDDASTT-WPYEFTIKRYGEHDNATVCFELETVGHPNCISPVD  186

Query  120  ISSMVLIKMR  129
            + + ++  ++
Sbjct  187  VGTRIVQHLK  196

>PHYSO_493381
Length=562

 Score = 70.5 bits (171),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 74/132 (56%), Gaps = 9/132 (7%)

Query  6    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERL--IGDAA-KNQ  58
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  T +   +G+AA + +
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVRFEPTTQRADVGNAAVQLE  80

Query  59   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQP  117
                  NTV   KRL+G+KF          +  +K+ S A     + V   G+ K   QP
Sbjct  81   TQEPVGNTVRSVKRLMGQKFESKAADVARIYATYKVVSTAQGNAAVQVARGGQKKVHVQP  140

Query  118  EEISSMVLIKMR  129
            EE+S+ VL +++
Sbjct  141  EEVSACVLAELK  152

>PHYKE_7077
Length=631

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 9/132 (7%)

Query  6    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLI--GDAA-KNQ  58
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  T + +  G+AA   +
Sbjct  155  CLGIDLGTTNSCVGMWHVERNHVKILKNKEDRG-RTTPSVVRFDPTSQSVKTGNAAVALE  213

Query  59   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKG-ESKTFQP  117
             +    NTV   KRL+G+KF    V     +  +K+         I V+  G ++   QP
Sbjct  214  TSEPVENTVRSVKRLMGQKFESKAVDVARMYATYKVAPTIHGNVAIQVERGGKKAVVIQP  273

Query  118  EEISSMVLIKMR  129
            EE+S+ VL +++
Sbjct  274  EEVSACVLAELK  285

>PYIR_25979
Length=438

 Score = 68.2 bits (165),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 70/143 (49%), Gaps = 18/143 (13%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQG-------NRTTPSYVAFTDTERLIGDAAKN  57
            +SVGIDLGT      + ++  V  ++ D+        N   PS+V+ TD+  L+G  A+ 
Sbjct  34   WSVGIDLGTQVCSAALIRDGIVIDVSFDEEQQQDSSPNLLLPSFVSATDSGFLVGADARR  93

Query  58   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES-----  112
            +      +TVFD  RL+GRK  D   Q  +  WPFK+  G  DK  I +           
Sbjct  94   RARSGDPSTVFDFVRLVGRKIEDLSSQDILCKWPFKVVPGENDKAMIEISAIDTKDSAST  153

Query  113  ------KTFQPEEISSMVLIKMR  129
                  +TF PEE+ + +++K++
Sbjct  154  STSDVIRTFHPEELVAALIMKIK  176

>PYIR_21692
Length=468

 Score = 68.2 bits (165),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (52%), Gaps = 5/128 (4%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMNAHN  65
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  67   VGIDLGTTYSVVAISQKNNVSVIPDAFGHVIIPSIVAFLPGGDVLVGRQARAHRTKDPEH  126

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFK----GESKTFQPEEIS  121
            T+F+AKR IGR + D     D + + + +   +  +P+  V F+    G  K   P  + 
Sbjct  127  TIFNAKRFIGRIYDDVKQSKDDESYEYTVARASLSEPESGVCFQLSLPGHPKCVTPVSVG  186

Query  122  SMVLIKMR  129
            S ++  +R
Sbjct  187  SAIVRHLR  194

>PYU1_G006843
Length=481

 Score = 68.2 bits (165),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 4/127 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNAHN  65
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  80   VGIDLGTTYSVVAISQKNNVTVIPDVLGHVLIPSMVAFVPGGKVLVGRDARAHRTKDPAH  139

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQ---ITVQFKGESKTFQPEEISS  122
            T+F+AKR IGR + D +   D   + F ++    D        V   G  K   P  I +
Sbjct  140  TIFNAKRFIGRTYEDVVQSKDAASYEFAVSKAPNDVHHGVCFPVNVPGHRKCVSPIAIGA  199

Query  123  MVLIKMR  129
             ++  +R
Sbjct  200  TIVGHLR  206

>PHYRA_53570
Length=395

 Score = 67.4 bits (163),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query  7   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNAHN  65
           VGIDLGTTYS V + Q + V  IA+D+G    PS VAF    E L+G  A+     +  +
Sbjct  1   VGIDLGTTYSVVAISQKNNVTAIADDEGYILVPSTVAFLPHGEMLVGREARAHRTTDPQH  60

Query  66  TVFDAKRLIGRKFSDPIVQAD  86
           T+F+AKR IGRK+ D +V+++
Sbjct  61  TIFNAKRFIGRKY-DEVVRSE  80

>PYIW_17320
Length=563

 Score = 67.4 bits (163),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 69/129 (53%), Gaps = 6/129 (5%)

Query  7    VGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAF---TDTERLIGDAAKNQVA  60
            +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS V F   ++    +G AA  Q  
Sbjct  24   IGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPSVVRFDPQSEHAYEVGHAAIAQET  83

Query  61   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  120
                NT+   KRL+G+K++   V+       + +T+       + V    ++   QPEE+
Sbjct  84   QPVGNTIRSVKRLMGQKYTSKAVEVAKSFGTYTITATKQGGAAVQVVRANKTAVVQPEEV  143

Query  121  SSMVLIKMR  129
            ++ +L  ++
Sbjct  144  AACILADLK  152

>PYU1_G002895
Length=561

 Score = 66.6 bits (161),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 69/133 (52%), Gaps = 8/133 (6%)

Query  4    GYSVGIDLGTTYSCVGVWQNDR--VEII--ANDQGNRTTPSYVAF---TDTERLIGDAAK  56
            G  +GIDLGTT SC+G+W  +R  V+I+  A D+  RTTPS V F   ++    +G AA 
Sbjct  21   GLCIGIDLGTTNSCIGMWHVERNHVKILKSAKDR-KRTTPSVVRFDPASEHAYEVGHAAI  79

Query  57   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  116
             Q      NTV   KRL+G+K++   V+       + + S       + V    +    Q
Sbjct  80   AQETQPVGNTVRSIKRLMGQKYASKAVEVAKSFGTYTVASTKQGNAAVQVVRNEKPALLQ  139

Query  117  PEEISSMVLIKMR  129
            PEE+S+ +L  ++
Sbjct  140  PEEVSACILSDLK  152

>PHALS_09281
Length=465

 Score = 66.6 bits (161),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 1/79 (1%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  63
            + VGIDLGTTYS V ++Q + V  IA+++G+   PS VA+  D   LIG  A+    ++ 
Sbjct  68   HVVGIDLGTTYSVVAIFQKNNVTAIADNEGHVLVPSTVAYLPDGGVLIGREARTHRTIDP  127

Query  64   HNTVFDAKRLIGRKFSDPI  82
             +T+F+AKR IG+ + D I
Sbjct  128  QHTIFNAKRFIGQSYDDVI  146

>PYVX_13615
Length=585

 Score = 65.1 bits (157),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 75/134 (56%), Gaps = 12/134 (9%)

Query  7    VGIDLGTTYSC---VGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTERLIG-DAAK  56
            VGIDLGTT SC   VG+W+ +R  V+I+ N  D+G RTTPS V F     + L+G +A  
Sbjct  22   VGIDLGTTNSCATRVGIWKTERNHVKILKNRRDRG-RTTPSVVRFGPESDQVLVGNEAIA  80

Query  57   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKG-ESKTF  115
            +++     NTV   KRL+G+ F    V+   K   FKL         I++   G ++ T 
Sbjct  81   HELEDPVGNTVRAVKRLMGQPFESKAVEVATKFAAFKLEPTKQGNTAISIDRSGSKTDTV  140

Query  116  QPEEISSMVLIKMR  129
             PE++S+ VL +++
Sbjct  141  LPEDVSAAVLSELK  154

>PYIW_14231
Length=1243

 Score = 64.7 bits (156),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 72/136 (53%), Gaps = 18/136 (13%)

Query  5    YSVGIDLG-----TTYSCVGVWQNDRVEIIANDQGNRTT---PSYVAFTDTERLIGDAAK  56
            + +GID+G     TT S  GV  +  V +  ++Q +  T   P+YV+ TD++ ++G  A+
Sbjct  12   WCIGIDIGAHFFSTTVSKDGVAVD--VPLEEHEQDDTKTHLLPAYVSVTDSDFIVGSEAR  69

Query  57   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT--  114
             +      NT+FD  R++GRK SD +   D+  WPFK+  G  DK  + ++      T  
Sbjct  70   KRAKSGDSNTIFDFVRIVGRKISD-LNAGDLSKWPFKVVPGDNDKAVVEIRTSTNGSTAS  128

Query  115  -----FQPEEISSMVL  125
                 F PEE+ ++++
Sbjct  129  VSFRMFHPEELLAVLV  144

>PHYRA_79054
Length=563

 Score = 64.3 bits (155),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 69/133 (52%), Gaps = 11/133 (8%)

Query  6    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F D      D     VA+
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRSDRG-RTTPSVVRF-DPSSQAADVGNAAVAL  79

Query  62   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQ  116
                   NT+   KRL+G+KF          +  +++   A     + V   G+     Q
Sbjct  80   ETCEPLGNTIRSVKRLMGQKFDSKAADVARIYAGYRVLPTAQGNVAVQVLRGGKRDIQVQ  139

Query  117  PEEISSMVLIKMR  129
            PEE+S+ VLI+++
Sbjct  140  PEEVSACVLIELK  152

>PYU1_G000896
Length=711

 Score = 63.2 bits (152),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 16/137 (12%)

Query  7    VGIDLGTTYSCVGVWQNDRVEI----------IANDQGNRTTPSYVAFTDTERLIGDAAK  56
            +GID GT + C      D + +          I +++     P++V+ TDT  LIG  A+
Sbjct  60   LGIDFGT-HLCSAAVSRDGIVVDVPVPGDAAAIDDNKSPLAVPAFVSVTDTGYLIGTEAR  118

Query  57   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES----  112
                    NTVFD  RL+GRK  D +  AD   WPF + +G  DK  + +     S    
Sbjct  119  TLARRGDLNTVFDLTRLVGRKVGD-LSDADQARWPFHVVAGDHDKVLVAILGTNNSVSNP  177

Query  113  KTFQPEEISSMVLIKMR  129
            +   PEE+ +++ ++++
Sbjct  178  RKLYPEELLAVLFLQLK  194

>PITG_16528
Length=561

 Score = 62.8 bits (151),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 72/131 (55%), Gaps = 10/131 (8%)

Query  7    VGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTER--LIGDAAKN-QV  59
            +GIDLGTT SCVG+W  DR  V+I  N  D+G RTTPS V F    +   +G+ A   + 
Sbjct  23   LGIDLGTTNSCVGMWYVDRNHVKIFKNHLDRG-RTTPSVVRFDPKSQSVAVGNVAVGLET  81

Query  60   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQPE  118
            +    NT+   KRL+G+KF    V     +  +++   A     + V  +G+ K   QPE
Sbjct  82   SEPVENTIRSVKRLMGQKFDSKAVDVARIYASYEVAPTAQGNVAVQV-VRGQKKVQVQPE  140

Query  119  EISSMVLIKMR  129
            E+S+ VL +++
Sbjct  141  EVSACVLRELK  151

>H257_04453
Length=423

 Score = 62.8 bits (151),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNAHN  65
            VGIDLGTTYS V V ++  V ++ +  GN   PS VAF      L+G  A++   ++  +
Sbjct  34   VGIDLGTTYSVVAVNRHGNVTVMPDANGNLLLPSIVAFKPHGGVLVGRDARHHRRVDPKH  93

Query  66   TVFDAKRLIGRKFSDPIVQADIKHWPFKL  94
            T+ +AKR IGRKF D  ++AD   + F L
Sbjct  94   TISNAKRFIGRKF-DATIEADASLYDFPL  121

>CCA27145
Length=463

 Score = 62.4 bits (150),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 67/129 (52%), Gaps = 8/129 (6%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  63
            + +GIDLGTTYS V + Q++ V II +   +   PS V F  +   L+G  A+     + 
Sbjct  57   HVIGIDLGTTYSVVAISQHNNVTIIPDRHHHTLIPSIVTFLPEGALLVGRQARAYRTKDP  116

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHW---PFKLTSGAGDK----PQITVQFKGESKTFQ  116
             +T+++AKR IGR +++ I  A+   +   PF+  S +  +    P  ++   G      
Sbjct  117  RHTIYNAKRFIGRSYNESIQAAEPYGFSIEPFRNESASEPESLPGPCFSLSVSGHPACVT  176

Query  117  PEEISSMVL  125
            P EI S+++
Sbjct  177  PIEIGSLII  185

>PPTG_05819
Length=561

 Score = 62.0 bits (149),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 12/133 (9%)

Query  6    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + + D     V +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKILKNSLDRG-RTTPSVVRFDPKSQSV-DVGNVAVGL  79

Query  62   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQ  116
                   NT+   KRL+G++F +  V     +  +++   A     + V  +G  K   Q
Sbjct  80   ETSEPVGNTIRSVKRLMGQRFENKAVDVARIYASYEVAPTAQGNVAVQV-VRGHKKVQVQ  138

Query  117  PEEISSMVLIKMR  129
            PEE+S+ VL +++
Sbjct  139  PEEVSACVLRELK  151

>PITG_17383
Length=438

 Score = 61.6 bits (148),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 66/133 (50%), Gaps = 8/133 (6%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  63
            + VGIDLGTTYS V + Q + V  IA+  G+   PS VAF  +   L+G  A+     + 
Sbjct  36   HVVGIDLGTTYSVVAISQKNNVTAIADKNGHVLVPSTVAFLPSGAVLVGREARAHRTTDP  95

Query  64   HNTVFDAKRLIGRKFSDPIV-QADIKHW-PFK-----LTSGAGDKPQITVQFKGESKTFQ  116
             +T+F+AKR IG+ + D +  +AD     P++     L     D    T+  +   K   
Sbjct  96   QHTIFNAKRFIGQSYEDVLTSEADENGGTPYEFSVKMLRDNEHDGVCFTLDLQDHPKCVT  155

Query  117  PEEISSMVLIKMR  129
            P  I + V+  +R
Sbjct  156  PVNIGTAVVQHLR  168

>PPTG_09003
Length=449

 Score = 61.6 bits (148),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 44/133 (33%), Positives = 66/133 (50%), Gaps = 8/133 (6%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  63
            + VGIDLGTTYS V + Q + V  I + +G    PS VAF      L+G  A+    ++ 
Sbjct  49   HVVGIDLGTTYSVVAISQKNNVTAIKDKEGYVLVPSTVAFLPHGGVLVGREARAHRTLDP  108

Query  64   HNTVFDAKRLIGRKFSDPIV-QAD---IKHWPF---KLTSGAGDKPQITVQFKGESKTFQ  116
             +TVF+AKR IG+ + D +  +AD   +  + F    L     D    T+   G+     
Sbjct  109  QHTVFNAKRFIGQSYGDVLASEADENGVTPYEFGVKMLQDNKHDGVCFTLDLSGQPGCVT  168

Query  117  PEEISSMVLIKMR  129
            P EI + V+  +R
Sbjct  169  PVEIGTAVVRHLR  181

>PHYSO_247517
Length=794

 Score = 61.2 bits (147),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)

Query  48   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQ  107
            +R IG+AA +   M+  NT  D KRLIGRKF  P VQ +I    +K    A     I + 
Sbjct  30   QRFIGEAAISMARMHYKNTATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGDVGIVLN  89

Query  108  FKGESKTFQPEEISSMVLIKMR  129
            +  E  TF  E++ +M+L KM+
Sbjct  90   YNDEPVTFSCEQVVAMILNKMQ  111

>PHALS_02692
Length=557

 Score = 60.5 bits (145),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 71/132 (54%), Gaps = 10/132 (8%)

Query  6    SVGIDLGTTYSCVGVWQNDR--VEIIANDQGN-RTTPSYVAFTDTERL--IGDAAKN-QV  59
             +GIDLGTT SCVG+W  DR  V+I  N     RTTPS V F  T +   +G AA + + 
Sbjct  18   CLGIDLGTTNSCVGMWYVDRNHVKIFKNRLNRGRTTPSVVHFDPTSQSVDVGQAAIDLET  77

Query  60   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQF-KGESKT-FQP  117
            +    NT+   KRL+G+K+          +  +++   A  +  + VQ  +G  K   QP
Sbjct  78   SEPVGNTIRSIKRLMGQKYESKATDVARIYASYEVAPTA--QKNVAVQLVRGHKKVQVQP  135

Query  118  EEISSMVLIKMR  129
            EE+S+ +L +++
Sbjct  136  EEVSAYILTELK  147

>PHYCA_6458
Length=560

 Score = 60.1 bits (144),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 71/136 (52%), Gaps = 18/136 (13%)

Query  6    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + + D     + +
Sbjct  21   CLGIDLGTTNSCVGMWHVDRHHVKILKNRLDRG-RTTPSVVRFNPQSQSV-DVGNVAIGL  78

Query  62   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQ---FKGESKT  114
                   NT+   KRL+G+KF+         +  +++       PQ  V     +G+ K 
Sbjct  79   ETSEPVGNTIRSVKRLMGQKFASKATDVARIYASYEVAP----TPQGNVAAQVVRGQKKV  134

Query  115  -FQPEEISSMVLIKMR  129
              QPEE+S+ +L +++
Sbjct  135  QVQPEEVSACILTELK  150

>PHYCA_120845
Length=444

 Score = 58.9 bits (141),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  63
            + VGIDLGTTYS V + + + V  IA+ +G+   PS VAF  D   L+G  A+     + 
Sbjct  50   HVVGIDLGTTYSVVAISRKNNVTAIADSEGHVLVPSTVAFLPDGGVLVGREARVHRTTDP  109

Query  64   HNTVFDAKRLIGRKF  78
             +T+F+AKR IG+ +
Sbjct  110  QHTIFNAKRFIGQSY  124

>PHYCA_504114
Length=887

 Score = 58.2 bits (139),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (49%), Gaps = 4/125 (3%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+DLG  +  + + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDLGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  67   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  124
                +RL+G + SDP V +  D +H+P++L   A     I+++  G+S+TF  EE+ +MV
Sbjct  88   YAQIRRLLGTRLSDPQVSSLLDEEHFPYELVQNATRGGTISLKH-GKSQTFHAEELVAMV  146

Query  125  LIKMR  129
                R
Sbjct  147  FAHAR  151

>HYAP_07918
Length=897

 Score = 58.2 bits (139),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 61/125 (49%), Gaps = 4/125 (3%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+DLG+ +  V + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  29   GVDLGSEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRKPQTA  88

Query  67   VFDAKRLIGRKFSDPIVQADI--KHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  124
                +RL+G K SDP V + +  +H+P++L S A     I ++   ++ TF  EE+ +MV
Sbjct  89   YAQIRRLLGTKLSDPQVVSLLTDEHFPYQLVSNATRGGAIALKHANDA-TFHAEELVAMV  147

Query  125  LIKMR  129
            L   R
Sbjct  148  LTHAR  152

>PYIW_21045
Length=706

 Score = 57.4 bits (137),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 10/126 (8%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID GT  S V     D   ++ N+ G+ TT + V+F   ERLIG+AA    + N  NTV
Sbjct  12   GIDFGTQRSVVAESSGD---VVLNELGSMTTATLVSFKGDERLIGEAAVLSSSTNPRNTV  68

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGA---GDKPQIT--VQFKGESKTFQPEEISS  122
                 L+G+ F+   VQA     P +  + A    D  Q+   V++ GE+K F  E+++ 
Sbjct  69   DCLNLLLGKDFAH--VQAITSELPGQRVTFAQAPTDDSQVVAQVEYLGEAKQFSLEQLTG  126

Query  123  MVLIKM  128
            M+  K+
Sbjct  127  MLFGKL  132

>H310_12260
Length=424

 Score = 57.0 bits (136),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 57/96 (59%), Gaps = 3/96 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNAHN  65
            VGIDLGTTYS V V ++  V ++ +  G+   PS VAF  +   L+G  A++   ++  +
Sbjct  34   VGIDLGTTYSVVAVNRHGNVTVMPDVHGHFLLPSVVAFKPNGGVLVGRDARHYRRVDPKH  93

Query  66   TVFDAKRLIGRKFSDPI-VQADIKHWPFKLTSGAGD  100
            T+ +AKR IGR+F + I  +A +  +P  L +  GD
Sbjct  94   TISNAKRFIGRQFDESIAAEAALYDFPL-LANTTGD  128

>H310_05216
Length=708

 Score = 55.8 bits (133),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 65/125 (52%), Gaps = 8/125 (6%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            VG+D+G+    V     D   I+ N+ G  TT + V+F D ERL+G+AA    + N  NT
Sbjct  14   VGLDIGSKQCVVARPSGD---IVLNELGGMTTATLVSFKDKERLLGEAAVLASSTNPTNT  70

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDK---PQITVQFKGESKTFQPEEISSM  123
            V     L+G+ F    V   ++ +P + ++   +    P  +V++ G +  F P ++ +M
Sbjct  71   VDYVNLLLGKTFDQ--VMHQLQAFPCQRSNFKANDAGLPVASVEYNGSTVEFSPVQLMAM  128

Query  124  VLIKM  128
            +L K+
Sbjct  129  LLAKI  133

>H257_18435
Length=684

 Score = 55.8 bits (133),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 8/125 (6%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +G+D+G+    V     D   I+ N+ G  TT + V+F D ERL+G+AA    + N  NT
Sbjct  15   IGLDIGSKQCVVARPSGD---IVLNELGGMTTATLVSFKDKERLLGEAAVLASSTNPKNT  71

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFK---LTSGAGDKPQITVQFKGESKTFQPEEISSM  123
            V     L+G+     + Q  +  +P +    T  A   P  +V + G +  F P ++ +M
Sbjct  72   VDYLNLLLGKTLDQVVAQ--LSAFPCQRSNFTVNAAGLPVASVDYNGATTEFSPVQLMAM  129

Query  124  VLIKM  128
            +L K+
Sbjct  130  LLAKI  134

>PHALS_08498
Length=895

 Score = 55.5 bits (132),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 56/125 (45%), Gaps = 4/125 (3%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  Y  V + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  27   GVDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAATVGVRRPQTA  86

Query  67   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  124
                +RL+G K SDP V A  D +H P++L   A     + +Q  G+ + F  EE+ +MV
Sbjct  87   YMQIRRLLGTKLSDPQVIALRDEEHLPYELIQNATRGGTVMLQH-GKKQFFHAEELVAMV  145

Query  125  LIKMR  129
                R
Sbjct  146  FTHAR  150

>PPTG_18280
Length=384

 Score = 55.1 bits (131),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 4/125 (3%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  +  V + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  67   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  124
                +RL+G   SDP V +  D +H+P++L   A     I+++  G+ +TF  EE+ +MV
Sbjct  88   YAQIRRLLGTTLSDPQVSSLLDEEHFPYELVQNATRGGTISLK-HGKDQTFHAEELVAMV  146

Query  125  LIKMR  129
                R
Sbjct  147  FAHAR  151

>PHYRA_73661
Length=884

 Score = 55.1 bits (131),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 63/127 (50%), Gaps = 8/127 (6%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  65
            G+D G  +  + + +     EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  27   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVGVRRPQ  84

Query  66   TVFDA-KRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            T +   +RL+G   SDP V A  D +H+P+ L   A     I+++  G+ + FQ EE+ +
Sbjct  85   TAYSQIRRLLGTTLSDPQVSALLDEEHFPYDLVQNASRGGTISLKH-GKDQAFQAEELVA  143

Query  123  MVLIKMR  129
            MV    R
Sbjct  144  MVFAHAR  150

>CCI45261
Length=558

 Score = 54.7 bits (130),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 72/136 (53%), Gaps = 14/136 (10%)

Query  6    SVGIDLGTTYSCVGVWQND--RVEIIANDQGNR---TTPSYVAFTDTERLIGDAAKNQVA  60
            ++GID GTT SCVG+W  D  RV+I+ +D   +     PS V +  T+  +    +  V 
Sbjct  24   AIGIDFGTTNSCVGIWLKDQSRVKILKHDFDTKRYYLLPSVVRYDPTDVSLVSVGQEAVR  83

Query  61   MNA----HNTVFDAKRLIGRKFSD---PIVQADIKHWPFKLTSGAGDKPQITVQFKGESK  113
            + A     NT+   KRL+G+++++     +Q+   H    +++  G+     +  K +  
Sbjct  84   LEATPPCKNTIRCVKRLMGQRYTNDRISYLQSSSTHQI--VSTKRGNVGICIITEKNDES  141

Query  114  TFQPEEISSMVLIKMR  129
              +PE++++ +L+K++
Sbjct  142  IVEPEQVAACILLKLK  157

>PYU1_G004743
Length=706

 Score = 54.3 bits (129),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 63/124 (51%), Gaps = 8/124 (6%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID GT  S V     D   ++ N+ G+ TT + V+F   ERLIG++A    + N  NTV
Sbjct  13   GIDFGTQRSVVAESNGD---VVLNELGSMTTATLVSFKGDERLIGESAVLSSSTNPRNTV  69

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTS--GAGDKP-QITVQFKGESKTFQPEEISSMV  124
                 L+G+ F+   VQ      P +  S    GD      V+++ E+KTF  E+++ M+
Sbjct  70   DCLNLLLGKSFAG--VQTITSQCPGQRVSFEQIGDNNVAARVEYQNETKTFSLEQLTGML  127

Query  125  LIKM  128
              K+
Sbjct  128  FGKL  131

>SPRG_01255
Length=566

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 11/131 (8%)

Query  6    SVGIDLGTTYSCVGVWQ--NDRVEII---ANDQGNRTTPSYVAFTDT-ERLIGDAAKNQV  59
             +GIDLGTT SCVG W+   + V+I+   A D   +T PS V+F  T    +G AA    
Sbjct  24   CIGIDLGTTNSCVGYWKLHANHVKIVNHSAGDTKAKTLPSVVSFPPTGAPAVGFAAVAAE  83

Query  60   AMNAH-NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  118
            A +A   TV  AKRL+G+  +D     D K+  + L    G+   +++       +  P 
Sbjct  84   ASDADVVTVRSAKRLLGQSLAD--ASPDQKYLSYTLCD--GESGHVSIALPARKTSVTPS  139

Query  119  EISSMVLIKMR  129
            E+++++L K++
Sbjct  140  EVAALLLSKLK  150

>SPRG_00713
Length=672

 Score = 53.5 bits (127),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 56/123 (46%), Gaps = 4/123 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GIDLG+    V        EI+ N+ G  TT + VAF D ERL+G+AA    + N  NT
Sbjct  4    IGIDLGSQRCVVA---RPSGEIVLNELGGMTTATLVAFKDKERLLGEAAVLSSSTNPANT  60

Query  67   VFDAKRLIGRKFSDPIVQADIKHWP-FKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            V      +G+   + + Q      P       A  +    VQ+    K F P ++ +MV 
Sbjct  61   VDHINMFLGKSHQEVLAQMTAYPCPRATYVQTASGEAAAQVQYNDGEKLFTPVQLLAMVF  120

Query  126  IKM  128
             K+
Sbjct  121  GKI  123

>SDRG_01561
Length=672

 Score = 52.8 bits (125),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 56/123 (46%), Gaps = 4/123 (3%)

Query  7    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            +GIDLG+    V        EI+ N+ G  TT + VAF D ERL+G+AA    + N  NT
Sbjct  4    IGIDLGSQRCVVA---RPSGEIVLNELGGMTTATLVAFKDKERLLGEAAVLSSSTNPANT  60

Query  67   VFDAKRLIGRKFSDPIVQADIKHWP-FKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  125
            V      +G+   + + Q      P       A  +    VQ+    K F P ++ +MV 
Sbjct  61   VDHINMFLGKSHQEVLAQMAAFPCPRAAYVQTASGEAAAQVQYNNGEKLFTPVQLLAMVF  120

Query  126  IKM  128
             K+
Sbjct  121  GKI  123

>PITG_15771
Length=883

 Score = 52.8 bits (125),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 58/125 (46%), Gaps = 4/125 (3%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  +  V + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  67   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  124
                +RL+G   SDP V +  D +H+P++L   A     I+++  G+ +T+  EE+ +MV
Sbjct  88   YAQIRRLLGTTLSDPQVSSLLDEEHFPYELIQNATRGGTISLKH-GKEQTYHAEELVAMV  146

Query  125  LIKMR  129
                R
Sbjct  147  FTHAR  151

>PHYSO_255506
Length=1228

 Score = 52.0 bits (123),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 55/125 (44%), Gaps = 4/125 (3%)

Query  8    GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  364  GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  423

Query  67   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  124
                +RL+G   SDP V A  D +H+P++L   A     +++Q   + + F  EE+ +MV
Sbjct  424  YAQIRRLLGTTLSDPQVAALLDEEHFPYQLLQNATRGGTVSLQ-HAKDRVFHAEELVAMV  482

Query  125  LIKMR  129
                R
Sbjct  483  FAHAR  487

>PYIR_13638
Length=543

 Score = 50.8 bits (120),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 62/126 (49%), Gaps = 20/126 (16%)

Query  7    VGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAFTDTERLIGDAAKNQVAMNA  63
            +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS     +T  +             
Sbjct  24   IGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPS----VETAPV-------------  66

Query  64   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  123
             NT+   KRL+G+K++    +       +K+ +       + V    +  T +PEE+S+ 
Sbjct  67   GNTIRSIKRLMGQKYTSKAAEVAKSFGTYKIAATKQGSAAVQVVRAQKLVTVEPEEVSAC  126

Query  124  VLIKMR  129
            +L  ++
Sbjct  127  ILSDLK  132

>H257_01680
Length=571

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query  7    VGIDLGTTYSCVGVWQN--DRVEII---ANDQGNRTTPSYVAF-TDTERLIG-DAAKNQV  59
            +GIDLGTT SCVG W+   +  +II   A D  ++T PS V+F +     +G DA +++ 
Sbjct  22   IGIDLGTTNSCVGYWKEGANHAKIINHTATDGKHKTVPSVVSFPSQGNPFVGFDAVEHEQ  81

Query  60   AMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  118
                   T+  AKRL+G+  ++  +  + K+  + L    G    + +    +     P 
Sbjct  82   KYEPDTVTIRSAKRLMGKTLAE--MADEQKYLSYTLCDADG---HVAIDLPSKESIATPS  136

Query  119  EISSMVL  125
            E+S+++L
Sbjct  137  EVSAILL  143

>H310_03911
Length=570

 Score = 48.9 bits (115),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 13/127 (10%)

Query  7    VGIDLGTTYSCVGVWQNDR-----VEIIANDQGNRTTPSYVAF-TDTERLIG-DAAKNQV  59
            +GIDLGTT SCVG W+        V  +  D  ++T PS V+F       +G DA +++ 
Sbjct  22   IGIDLGTTNSCVGYWKEGANFAKIVNHVGKDGKHKTVPSVVSFPPQGNPFVGFDAVEHEQ  81

Query  60   AMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  118
             +     T+  AKRL+G+  ++  V  + K+  + L     D   + +    +     P 
Sbjct  82   KLEPDTVTIRSAKRLMGKTLAE--VGDEQKYLSYSLCD---DGDHVAIDLPSKKTVVAPS  136

Query  119  EISSMVL  125
            E+S+++L
Sbjct  137  EVSAILL  143

>PYIR_14416
Length=694

 Score = 48.9 bits (115),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 8/120 (7%)

Query  12   GTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAK  71
            GT  S V     D   ++ N+ G+ TT + V+F   ERLIG++A    + N  NTV    
Sbjct  4    GTQRSVVAESNGD---VVLNELGSMTTATLVSFKGDERLIGESAVLSSSTNPRNTVDCLN  60

Query  72   RLIGRKFSDPIVQADIKHWP---FKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKM  128
             L+G+ F+   VQA     P          G +    V+++ +SK F  E+++ M+  K+
Sbjct  61   LLLGKDFAQ--VQAITNQLPGQRVAFEKAEGGQVLAQVEYQNDSKKFSLEQLAGMLFGKL  118

>PHYRA_81377
Length=421

 Score = 48.5 bits (114),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 38/72 (53%), Gaps = 12/72 (17%)

Query  9    IDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVF  68
            +D+GTT  CVGVW + ++            P +      E ++GD A N++  +A NT+F
Sbjct  126  VDIGTTPGCVGVWHSSKI------------PHHACSEREEVIVGDTAVNKLPSHAENTIF  173

Query  69   DAKRLIGRKFSD  80
              K L+G+  ++
Sbjct  174  HLKLLLGKAHAN  185

>CCA22305
Length=561

 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 68/138 (49%), Gaps = 16/138 (12%)

Query  6    SVGIDLGTTYSCVGVWQND--RVEIIAN---DQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            ++GID GTT SCVGVW  D  RV+I  +    + +   PS V +   +  +    K  + 
Sbjct  24   AIGIDFGTTNSCVGVWLKDQNRVKIFKHGIETKWSHLLPSVVRYDPVDISLVLVGKEAIE  83

Query  61   MNA----HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES----  112
            + +     NT+   KRL+G+K+ +  +        +++ S    +    +Q  G+     
Sbjct  84   LESKPPCKNTIRCVKRLMGQKYVNDRIAYLQSSSIYEIVS--TQRGNAAIQIDGDHGDDK  141

Query  113  -KTFQPEEISSMVLIKMR  129
              + +PEE+++ +LIK++
Sbjct  142  RTSVEPEEVAAHILIKLK  159

>H257_00287
Length=893

 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 7/122 (6%)

Query  8    GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  +  + + +  +  EI+ N    R T + V+F   ERL G  A N       N 
Sbjct  29   GVDFGGEFFKIALVKPGKSFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQNA  88

Query  67   VFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-TFQPEEISSM  123
                +RL+G   + P+V++  K  ++P+ LT    ++ + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPLVESMTKSEYFPYTLTH---NETRGSVGLKHDDEHTFHAEELVAM  145

Query  124  VL  125
            V 
Sbjct  146  VF  147

>PHYSO_321565
Length=697

 Score = 47.4 bits (111),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 42/137 (31%), Positives = 66/137 (48%), Gaps = 12/137 (9%)

Query  3    SGYSVGIDLGTTYSCVGVWQND------RVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  55
            +G ++GID G T     V   D       +E++A ++   + PSYV+   T E  +G  A
Sbjct  36   TGCTIGIDFGRTKCEAAVVAEDGSAALIPLELLAPEKC-FSLPSYVSMGATGEWEVGLQA  94

Query  56   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  115
             ++       TV+D   L+G+K  D + Q D++ W F L SG  DK  +    K  +   
Sbjct  95   VSRAKAGHPYTVYDLTMLLGKKL-DALRQRDVERWAFILRSGVADKAVVECPTKSNTPDL  153

Query  116  Q-PEEISSMVL--IKMR  129
              PE++ S +L  IK R
Sbjct  154  AYPEQLVSKLLSTIKQR  170

>H310_01493
Length=909

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 7/122 (6%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  +  + + +   + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  67   VFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-TFQPEEISSM  123
                +RL+G   + P+V++ +K  ++P+ LT    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  124  VL  125
            V 
Sbjct  146  VF  147

>H310_01496
Length=904

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 7/122 (6%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  +  + + +   + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  67   VFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-TFQPEEISSM  123
                +RL+G   + P+V++ +K  ++P+ LT    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  124  VL  125
            V 
Sbjct  146  VF  147

>PYAP_19903
Length=527

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (51%), Gaps = 6/116 (5%)

Query  20   VWQNDR--VEIIAN-DQGNRTTPSYVAFT--DTERLIGDAAKNQVAMNAHNTVFDAKRLI  74
            +W  +R  V+I+ N D   RTTPS V F     E ++G+AA  +      NTV   KRL+
Sbjct  1    MWHVERNHVKILKNRDDRGRTTPSVVHFKPDSQEVVVGNAAIAREYDPPGNTVRTIKRLM  60

Query  75   GRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQPEEISSMVLIKMR  129
            G++F    V+   +     +         ++V+  G+     QPEE+SS VL++++
Sbjct  61   GQRFDSDAVRVAKRFATHSIVETKQGNAAVSVKRSGQDAVDVQPEEVSSHVLMELK  116

>PHYKE_9011
Length=902

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (49%), Gaps = 8/127 (6%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  65
            G+D G  +  V + +     EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAA--TVGVRRPQ  85

Query  66   TVFDA-KRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122
            T +   +RL+G K  +P V+A  + +H+P+ L         ++++ + +   +Q EE+ +
Sbjct  86   TAYQQIRRLLGTKLENPQVKALLEEEHFPYNLLQNVTRGGTVSLKHR-DGHIYQAEELVA  144

Query  123  MVLIKMR  129
            MV    R
Sbjct  145  MVFTHAR  151

>PPTG_14555
Length=703

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 58/133 (44%), Gaps = 10/133 (8%)

Query  2    TSGYSVGIDLGTTYSCVGVWQNDRVEII-----ANDQGNRTTPSYVAFTDT---ERLIGD  53
            T+  S+GID G T     V  +  V  +      N +   + PS+V+   T   E  +G 
Sbjct  39   TAECSIGIDFGRTKCEAAVVSDTGVATLIPLEPQNKENCYSLPSFVSMGVTRTGEWEVGL  98

Query  54   AAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGE-S  112
             A N+       TVFD   L+G+K    +   D+  W F L +G   K  +    KG   
Sbjct  99   QAINRAKAGHPYTVFDLTMLLGQKVK-ALSPQDVDRWAFNLQAGVAGKAVVECPAKGNVP  157

Query  113  KTFQPEEISSMVL  125
                PE++++M+L
Sbjct  158  DLLYPEQVAAMLL  170

>PYVX_18450
Length=386

 Score = 44.3 bits (103),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)

Query  7   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF  44
           VGIDLGTTYS V + Q + V +I +  G+   PS VAF
Sbjct  58  VGIDLGTTYSVVAISQRNNVTVIPDSHGHLIIPSMVAF  95

>PYVX_22905
Length=708

 Score = 43.9 bits (102),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 35/127 (28%), Positives = 60/127 (47%), Gaps = 10/127 (8%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            G+D G+    V     D   ++ N+ G+ TT + VAF   ERLIG++A    + N  NTV
Sbjct  8    GVDFGSQRCVVAESSGD---VVLNELGSMTTATLVAFKGDERLIGESAVLSASTNPLNTV  64

Query  68   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQIT----VQFKGESKT-FQPEEISS  122
                 L+G+  +   V+  +   P +      D    T    V++  + K  F  E++++
Sbjct  65   DFLNLLVGKDLAG--VEKQLARLPGQRVIFEADAATSTVVASVEYGADQKARFSVEQLTA  122

Query  123  MVLIKMR  129
            M+  K+R
Sbjct  123  MLFGKLR  129

>PHALS_00479
Length=706

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 5/84 (6%)

Query  8   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
           G+D G    CV    N   +++ N  G  TT + V+F   ERL+G++A    + N  NTV
Sbjct  8   GVDFGAQ-RCVVAESNG--DVVLNQLGGMTTATLVSFKGEERLLGESAVLSTSTNPSNTV  64

Query  68  FDAKRLIGRKFSDPIVQADIKHWP  91
                L+G+K +D  VQ  ++  P
Sbjct  65  GFLSGLVGKKLAD--VQRQLERLP  86

>SDRG_01828
Length=866

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 5/126 (4%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            S    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N    
Sbjct  19   SASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIEVR  78

Query  62   NAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  119
                     +R +G     P+V +  + +++P+ LT     +  + +Q   E  TF  EE
Sbjct  79   RPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSE-HTFHAEE  136

Query  120  ISSMVL  125
            +++MV 
Sbjct  137  LAAMVF  142

>SPRG_06288
Length=869

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 5/126 (4%)

Query  3    SGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            S    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N    
Sbjct  19   SASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIEVR  78

Query  62   NAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  119
                     +R +G     P+V +  + +++P+ LT     +  + +Q   E  TF  EE
Sbjct  79   RPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSE-HTFHAEE  136

Query  120  ISSMVL  125
            +++MV 
Sbjct  137  LAAMVF  142

>PYAP_23247
Length=713

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query  8   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
           G+DLG+    V     D   ++ N+ G  TT + V+F   ERLIG+AA    + N  NT+
Sbjct  21  GVDLGSQRCVVAAETGD---VVLNELGGMTTATLVSFKGDERLIGEAAVLSSSTNPQNTI  77

Query  68  FDAKRLIGR  76
                LIG+
Sbjct  78  DFINLLIGK  86

>HYAP_00880
Length=718

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 60/128 (47%), Gaps = 12/128 (9%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID G T  CV    N   +++ N+ G  TT S V+F   ERL+G++A    + N  NT+
Sbjct  11   GIDFGAT-RCVVAENNG--DVVLNELGGMTTASLVSFKGEERLVGESAVLSSSTNPRNTI  67

Query  68   FDAKRLIG-RKFSDPIVQADIKHWP-FKLTSGAGDKPQITVQFK-----GESKTFQPEEI  120
                 L+G R+ +D  VQ  ++  P  + T    D  ++    +     G    F  E++
Sbjct  68   GFLSGLVGKRQLAD--VQHQLERLPGLQSTFEVDDAGRVVASVEYGKQDGSRTQFTVEQL  125

Query  121  SSMVLIKM  128
            + M+   +
Sbjct  126  TGMLFANL  133

>PYAP_19741
Length=885

 Score = 40.0 bits (92),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 56/131 (43%), Gaps = 7/131 (5%)

Query  3    SGYSVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61
            S    G+D G  +  + + +     EI+ N    R T + VAF   ERL G  A      
Sbjct  23   SANVAGVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVR  82

Query  62   NAHNTVFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGES-KTFQPE  118
                     +R +G    DP + + ++  ++P++L     +  + TV  K E+ + F  E
Sbjct  83   RPQTCYAQVRRFLGTTPEDPAIASLLQEEYFPYELLQ---NDTRGTVALKHENDQVFHAE  139

Query  119  EISSMVLIKMR  129
            E+ +MV    R
Sbjct  140  ELVAMVFTHAR  150

>PYAR_16202
Length=893

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 54/126 (43%), Gaps = 7/126 (6%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  +  + + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  33   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGEERLYGADAATVGVRRPQTC  92

Query  67   VFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGES-KTFQPEEISSM  123
                +R +G    DP + A I+  ++P++L     +  + TV  K +  + F  EE+ +M
Sbjct  93   YAQIRRFLGTTKEDPAISALIQDEYFPYELLH---NDTRGTVALKHDKGQVFSAEELVAM  149

Query  124  VLIKMR  129
            V    R
Sbjct  150  VFTHAR  155

>PHYCA_558934
Length=489

 Score = 38.9 bits (89),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (49%), Gaps = 4/82 (5%)

Query  51   IGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKG  110
            +G  A N        TVFD   L+G+K  + +   D+  WPF + +G   K  +    + 
Sbjct  11   VGKRAVNHAKAGHPYTVFDLTMLLGQKM-ESLSPQDMDRWPFTIRAGVAGKALVECPQRL  69

Query  111  ESKTF-QPEEISSMVL--IKMR  129
            +S     PE++++M+L  IK R
Sbjct  70   QSPALVYPEQVAAMLLSTIKHR  91

>PHYKE_585
Length=713

 Score = 38.9 bits (89),  Expect = 0.003, Method: Composition-based stats.
 Identities = 33/127 (26%), Positives = 56/127 (44%), Gaps = 11/127 (9%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            GID G     V     D   ++ N+ G  TT + V+F   ERL+G+AA    + N  NTV
Sbjct  12   GIDFGAQRCVVAESTGD---VVLNELGAVTTATLVSFKGEERLVGEAAVLSSSTNPRNTV  68

Query  68   FDAKRLIG-RKFSDPIVQADIKHWP-----FKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
                 L+G R+ ++  VQ +++  P     F++         +     G    F  E+++
Sbjct  69   GCLSGLVGKRQLAE--VQQELERLPGHQAIFEVDEAGRVVATVDYGKDGSKTQFSVEQLT  126

Query  122  SMVLIKM  128
             M+   +
Sbjct  127  GMLFANL  133

>PYVX_15061
Length=891

 Score = 38.9 bits (89),  Expect = 0.004, Method: Composition-based stats.
 Identities = 36/126 (29%), Positives = 52/126 (41%), Gaps = 7/126 (6%)

Query  8    GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+DLG  +  V  V      EI+ N    R T + VAF   ERL G  A         + 
Sbjct  27   GVDLGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATIGVRRPQSA  86

Query  67   VFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKT-FQPEEISSM  123
                +R +G    DP V A  + +  P++L     D  + ++  K   K  F  EE+ +M
Sbjct  87   YAQVRRFLGATLDDPQVVALLEDERLPYELEQ---DLARGSIALKHSDKQLFHAEELVAM  143

Query  124  VLIKMR  129
            V    R
Sbjct  144  VFSHAR  149

>PHYSO_353741
Length=709

 Score = 38.5 bits (88),  Expect = 0.004, Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 11/127 (9%)

Query  8    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
            G+D G     V     D   ++ N+ G  TT + V+F   ERL+G++A    + N  NT+
Sbjct  11   GVDFGAQRCVVAESTGD---VVLNELGAMTTATLVSFKGEERLVGESAVLSSSTNPRNTI  67

Query  68   FDAKRLIG-RKFSDPIVQADIKHWP-----FKLTSGAGDKPQITVQFKGESKTFQPEEIS  121
                 L+G R+ +D  VQ  ++  P     F++         +     G    F  E+++
Sbjct  68   AFLSGLVGKRQLAD--VQQQLERLPGHQATFEVNEAGHVVATVDYGKDGSKTQFTVEQLT  125

Query  122  SMVLIKM  128
             M+   +
Sbjct  126  GMLFANL  132

>CCA21519
Length=929

 Score = 38.5 bits (88),  Expect = 0.005, Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 57/126 (45%), Gaps = 7/126 (6%)

Query  8    GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  Y  V + +  +  EI+ N    R T + VAF   ERL G  A        H  
Sbjct  41   GLDFGGEYFKVALVKPGKPFEIVTNVHSKRKTETMVAFDGEERLYGADADTIGVRRPHTG  100

Query  67   VFDAKRLIGRKFSDPIVQADI--KHWPFKLTSGAGDKPQITVQFKGE-SKTFQPEEISSM  123
                +R +G       + + I  +++P+ L++   ++ + ++  K E  K +  EE+ +M
Sbjct  101  YAQIRRFLGSSLDQYGIVSLILEEYYPYSLST---NEKRGSIHIKHEDEKHYHAEEVVAM  157

Query  124  VLIKMR  129
            V   +R
Sbjct  158  VFSHVR  163

>CCI45987
Length=939

 Score = 38.1 bits (87),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 51/124 (41%), Gaps = 3/124 (2%)

Query  8    GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  66
            G+D G  Y  V + +     EI+ N    R T + VAF   ER+ G  A        H  
Sbjct  41   GLDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGEERIYGADADTIGVRRPHTG  100

Query  67   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGE-SKTFQPEEISSMVL  125
                +R +G     P V + +    F  T    +K + T+  + E  + +  EE+ +MV 
Sbjct  101  YAQIRRFLGSSLDHPGVLSLVTQEYFPYTLKLNEK-RGTIHLEHEIEQLYHAEEVVAMVF  159

Query  126  IKMR  129
              +R
Sbjct  160  SHVR  163

>SDRG_16621
Length=531

 Score = 38.1 bits (87),  Expect = 0.007, Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 57/115 (50%), Gaps = 17/115 (15%)

Query  24   DRVEIIANDQGN---RTTPSYVAFTDTERLIGDAAKNQVAMNAHN------TVFDAKRLI  74
            + V+I+ +  G+   +T PS V+F  T    G  A   VA+ A        TV  AKRL+
Sbjct  3    NHVKIVNHSTGDAKAKTLPSVVSFPST----GAPAVGFVAVAAEASDADVVTVRSAKRLL  58

Query  75   GRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMR  129
            G+  +D +   D K+  +KL    G+   +++       +  P E+++++L +++
Sbjct  59   GQSLADAL--PDQKYLSYKLCE--GESGHVSIALPARKTSVTPSEVAALLLSELK  109

>PITG_03068
Length=638

 Score = 37.7 bits (86),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 61/138 (44%), Gaps = 10/138 (7%)

Query  1    KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
            +T+  S+GID G +     V  +    I+   + + T   Y   +     +  + + +V 
Sbjct  35   ETASCSIGIDFGRSKCEAAVVSDTGSVILIPFEPHSTENCYSLSSFVSMGVAHSGEGEVG  94

Query  61   MNAHN--------TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES  112
            + + N        TV+D   L+G+K ++ +   D+  W F L +GA  K  +    KG  
Sbjct  95   LQSINRAKAGHSYTVYDLTMLLGQK-TETLSAQDVNRWAFTLQAGAAGKAVVESPAKGNV  153

Query  113  KTF-QPEEISSMVLIKMR  129
                 PE++++++   ++
Sbjct  154  PDLVYPEQVAALLFATIK  171

>PPTG_09610
Length=53

 Score = 35.0 bits (79),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)

Query  106  VQFKGESKTFQPEEISSMVL  125
            +Q KGESKTF PEEISSM L
Sbjct  1    MQVKGESKTFNPEEISSMEL  20

>PHYCA_502791
Length=707

 Score = 37.4 bits (85),  Expect = 0.014, Method: Composition-based stats.
 Identities = 25/76 (33%), Positives = 38/76 (50%), Gaps = 3/76 (4%)

Query  1   KTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  60
           K S    G+D G    CV    N   +++ N+ G  TT + V+F   ERL+G++A    +
Sbjct  4   KQSPRVFGVDFGAQ-RCVIAESNG--DVVLNELGGMTTATLVSFKGEERLVGESAVLSSS  60

Query  61  MNAHNTVFDAKRLIGR  76
            N  NTV     L+G+
Sbjct  61  TNPRNTVGFLPGLVGK  76

>PITG_02259
Length=689

 Score = 37.0 bits (84),  Expect = 0.015, Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query  8   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  67
           G+D G    CV    N   +++ N+ G  TT + V+F   ERL+G++A    + N  NTV
Sbjct  11  GVDFGAQ-RCVVAESNG--DVVLNELGAMTTATLVSFKGEERLVGESAVLSSSTNPRNTV  67

Query  68  FDAKRLIGR  76
                L+G+
Sbjct  68  SFLSGLVGK  76

Lambda      K        H        a         alpha
   0.317    0.132    0.388    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3346599168

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40