Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_508551475348947825650.0
PHYCA_5561601475364948024460.0
PHYSO_3489011475352648024330.0
PHYKE_83911475377847923900.0
PITG_184521475385648023820.0
HYAP_070951475361348022400.0
PHALS_064811475364447921630.0
PYAP_177619907562247821080.0
PYIR_134521475364548820880.0
PYAR_135699907549447820350.0
PYIW_199721475360948920110.0
PYVX_181701475351047019020.0
H257_084361475364249017460.0
H310_085901475364049017340.0
SPRG_141031475362849116110.0
SDRG_167201475362849116040.0
SPRG_0407412408750949710864e-143
SDRG_1440812408752849910842e-142
PHALS_08068109044974876767e-82
PYAP_21882109045024896532e-78
SDRG_038221356704944746496e-78
PYAR_17512109045335086492e-77
SDRG_150451241574944746462e-77
SDRG_12187109044624756432e-77
SPRG_11769109044534746422e-77
PHYSO_254571109044894956427e-77
SDRG_111311368074944746411e-76
PYIR_17506109045094846376e-76
SDRG_03823114284974746322e-75
PHYKE_103271090612004876581e-74
PPTG_18033109045004906235e-74
H257_09722114285184816247e-74
PYAP_234351008029514786451e-73
PHYRA_71927109044854956139e-73
SPRG_05609114284964776141e-72
PHYCA_504517114284934766104e-72
PYIW_25301109045124926106e-72
PPTG_09787114284934766087e-72
H310_144471462305014766043e-71
PITG_14083114284934776034e-71
CCA23647114284964645991e-70
CCI11048114284964645983e-70
PHYRA_72037114284934765973e-70
PHYSO_550665114284914765956e-70
H257_170371462304984595922e-69
PHYCA_7619109044624765859e-69
H310_11259114285194805844e-68
PITG_13427109044634765788e-68
PHALS_09136114284934755773e-67
HYAP_08763114284734635735e-67
PHYKE_6836114284934765642e-65
PYVX_21517109044825005283e-60
HYAP_04843109044304185165e-59
PYIR_23431114284684614942e-55
PYAR_177141008024444744895e-55
PYVX_16175114284464624502e-49
PYIR_20273124015054864016e-42
CCA22989124014944833921e-40
CCI10477124014944823902e-40
PYAP_226451707615654803984e-40
HYAP_12621124015014833621e-36
SPRG_199431356703432573401e-34
PYU1_G014259109042442183285e-34
PYVX_21248124015024413312e-32
PHALS_09942124014964403223e-31
PHYSO_556052124015004803215e-31
SPRG_09825124014924893199e-31
PHYKE_9680124014984403172e-30
PHYRA_72215124014994853128e-30
SDRG_06945124014924893129e-30
PITG_15359124014964823111e-29
PHYCA_123621124014954803022e-28
PYAR_20075170764694822932e-27
H310_02523124014944452749e-25
CCA16670151565204872731e-24
H257_01186151564964822712e-24
H257_16541124014944462712e-24
CCI50816151568074872742e-24
PYIW_251901648732061852563e-24
PYAP_19280151565124892651e-23
PYVX_20512151565284982606e-23
H310_00561151564974822596e-23
PHYRA_47253151564814962571e-22
PHYRA_7388315665515162581e-22
PITG_18935150674804812561e-22
PYIW_19795151565194892518e-22
PYAR_16840151565365062511e-21
PYU1_G011605151565244862492e-21
PPTG_0093815665505192456e-21
PYIW_24688114282592822347e-21
PPTG_09121151565204992447e-21
PPTG_13000124013873442409e-21
PHYCA_50444515665485162412e-20
SDRG_14446151564954802393e-20
SDRG_0506015665595252393e-20
SPRG_1205415665585252384e-20
PYIR_1413215665135172375e-20
H310_0764115665485152367e-20
PHALS_1202815665795152377e-20
PHALS_10055151565164942332e-19
PYU1_G00569915665505172322e-19
PYIW_2025715665035092322e-19
PHYCA_555180151565215002296e-19
PYAP_1914815665355262215e-18
PYVX_2349915665195152199e-18
PHYKE_980715665575192191e-17
H257_0745015665673682181e-17
CCI3999315665505142172e-17
PHYKE_2864151564864972162e-17
HYAP_0414915665645202111e-16
CCA1403015665605212082e-16
PHYSO_48941815664714782021e-15
PYAR_1666415665773902003e-15
HYAP_08069650262552191834e-14
PYIR_21896151565184991879e-14
PITG_0177815664704781842e-13
PHYSO_562795151564153321787e-13
PITG_19065151564163391752e-12
SPRG_04114151563763701511e-09
PPTG_247122910367621272e-08
PITG_19802156311851641352e-08
HYAP_13613151564232311235e-06
PYIW_27568124011281201112e-05
SPRG_0423112415790521002e-04
SPRG_176261324081481201014e-04
HYAP_080686502510069984e-04
PHYSO_507629634703161960.011
PYU1_G014369634703164930.022
SPRG_186431333348533840.024
CCI409892416552136920.034
PYU1_G000378105671070177890.079
PHALS_10960634702226880.091
PITG_00703634703168870.15
PPTG_08060634725162860.15
PYAP_17256634705164850.24
PHYKE_6590105671054167850.25
PHYRA_72196634691164830.39
PHYCA_524942105671028173830.44
PYAP_15943241513930780.48
PHYRA_8732873619486164810.58
CCI50227539470775800.95
PHALS_1230816870526103791.3
HYAP_03065634701117771.9
PITG_02760241516530742.1
PYVX_183302416558138762.8
PYU1_G004385241656230762.8
PYAP_22849105671089169763.3
SDRG_051592416551139753.6
PHYKE_5677241621130734.1
PYVX_21196634604100744.3
PHYSO_317690105671057164744.4
H310_07705241654664744.8
SPRG_08354241655064735.2
PPTG_05518241655430735.9
PYVX_224912742164076736.0
H257_04036125006104962736.5
H310_0629614909759031736.6
PHYRA_736034215115959737.0
PYAR_1582363470559727.2
PITG_01001884848126728.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_50855

Length=489
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_50855                                                           992        0.0   
PHYCA_556160                                                          946        0.0   
PHYSO_348901                                                          941        0.0   
PHYKE_8391                                                            925        0.0   
PITG_18452                                                            922        0.0   
HYAP_07095                                                            867        0.0   
PHALS_06481                                                           837        0.0   
PYAP_17761                                                            816        0.0   
PYIR_13452                                                            808        0.0   
PYAR_13569                                                            788        0.0   
PYIW_19972                                                            779        0.0   
PYVX_18170                                                            737        0.0   
H257_08436                                                            677        0.0   
H310_08590                                                            672        0.0   
SPRG_14103                                                            625        0.0   
SDRG_16720                                                            622        0.0   
SPRG_04074                                                            422        4e-143
SDRG_14408                                                            422        2e-142
PHALS_08068                                                           265        7e-82 
PYAP_21882                                                            256        2e-78 
SDRG_03822                                                            254        6e-78 
PYAR_17512                                                            254        2e-77 
SDRG_15045                                                            253        2e-77 
SDRG_12187                                                            252        2e-77 
SPRG_11769                                                            251        2e-77 
PHYSO_254571                                                          251        7e-77 
SDRG_11131                                                            251        1e-76 
PYIR_17506                                                            249        6e-76 
SDRG_03823                                                            248        2e-75 
PHYKE_10327                                                           258        1e-74 
PPTG_18033                                                            244        5e-74 
H257_09722                                                            244        7e-74 
PYAP_23435                                                            253        1e-73 
PHYRA_71927                                                           240        9e-73 
SPRG_05609                                                            241        1e-72 
PHYCA_504517                                                          239        4e-72 
PYIW_25301                                                            239        6e-72 
PPTG_09787                                                            238        7e-72 
H310_14447                                                            237        3e-71 
PITG_14083                                                            236        4e-71 
CCA23647                                                              235        1e-70 
CCI11048                                                              234        3e-70 
PHYRA_72037                                                           234        3e-70 
PHYSO_550665                                                          233        6e-70 
H257_17037                                                            232        2e-69 
PHYCA_7619                                                            229        9e-69 
H310_11259                                                            229        4e-68 
PITG_13427                                                            227        8e-68 
PHALS_09136                                                           226        3e-67 
HYAP_08763                                                            225        5e-67 
PHYKE_6836                                                            221        2e-65 
PYVX_21517                                                            207        3e-60 
HYAP_04843                                                            203        5e-59 
PYIR_23431                                                            194        2e-55 
PYAR_17714                                                            192        5e-55 
PYVX_16175                                                            177        2e-49 
PYIR_20273                                                            159        6e-42 
CCA22989                                                              155        1e-40 
CCI10477                                                              154        2e-40 
PYAP_22645                                                            157        4e-40 
HYAP_12621                                                            144        1e-36 
SPRG_19943                                                            135        1e-34 
PYU1_G014259                                                          130        5e-34 
PYVX_21248                                                            132        2e-32 
PHALS_09942                                                           128        3e-31 
PHYSO_556052                                                          128        5e-31 
SPRG_09825                                                            127        9e-31 
PHYKE_9680                                                            126        2e-30 
PHYRA_72215                                                           124        8e-30 
SDRG_06945                                                            124        9e-30 
PITG_15359                                                            124        1e-29 
PHYCA_123621                                                          120        2e-28 
PYAR_20075                                                            117        2e-27 
H310_02523                                                            110        9e-25 
CCA16670                                                              109        1e-24 
H257_01186                                                            108        2e-24 
H257_16541                                                            108        2e-24 
CCI50816                                                              110        2e-24 
PYIW_25190                                                            103        3e-24 
PYAP_19280                                                            106        1e-23 
PYVX_20512                                                            104        6e-23 
H310_00561                                                            104        6e-23 
PHYRA_47253                                                           103        1e-22 
PHYRA_73883                                                           103        1e-22 
PITG_18935                                                            103        1e-22 
PYIW_19795                                                            101        8e-22 
PYAR_16840                                                            101        1e-21 
PYU1_G011605                                                          100        2e-21 
PPTG_00938                                                            99.0       6e-21 
PYIW_24688                                                            94.7       7e-21 
PPTG_09121                                                            98.6       7e-21 
PPTG_13000                                                            97.1       9e-21 
PHYCA_504445                                                          97.4       2e-20 
SDRG_14446                                                            96.7       3e-20 
SDRG_05060                                                            96.7       3e-20 
SPRG_12054                                                            96.3       4e-20 
PYIR_14132                                                            95.9       5e-20 
H310_07641                                                            95.5       7e-20 
PHALS_12028                                                           95.9       7e-20 
PHALS_10055                                                           94.4       2e-19 
PYU1_G005699                                                          94.0       2e-19 
PYIW_20257                                                            94.0       2e-19 
PHYCA_555180                                                          92.8       6e-19 
PYAP_19148                                                            89.7       5e-18 
PYVX_23499                                                            89.0       9e-18 
PHYKE_9807                                                            89.0       1e-17 
H257_07450                                                            88.6       1e-17 
CCI39993                                                              88.2       2e-17 
PHYKE_2864                                                            87.8       2e-17 
HYAP_04149                                                            85.9       1e-16 
CCA14030                                                              84.7       2e-16 
PHYSO_489418                                                          82.4       1e-15 
PYAR_16664                                                            81.6       3e-15 
HYAP_08069                                                            75.1       4e-14 
PYIR_21896                                                            76.6       9e-14 
PITG_01778                                                            75.5       2e-13 
PHYSO_562795                                                          73.2       7e-13 
PITG_19065                                                            72.0       2e-12 
SPRG_04114                                                            62.8       1e-09 
PPTG_24712                                                            53.5       2e-08 
PITG_19802                                                            56.6       2e-08 
HYAP_13613                                                            52.0       5e-06 
PYIW_27568                                                            47.4       2e-05 
SPRG_04231                                                            43.1       2e-04 
SPRG_17626                                                            43.5       4e-04 
HYAP_08068                                                            42.4       4e-04 
PHYSO_507629                                                          41.6       0.011 
PYU1_G014369                                                          40.4       0.022 
SPRG_18643                                                            37.0       0.024 
CCI40989                                                              40.0       0.034 
PYU1_G000378                                                          38.9       0.079 
PHALS_10960                                                           38.5       0.091 
PITG_00703                                                            38.1       0.15  
PPTG_08060                                                            37.7       0.15  
PYAP_17256                                                            37.4       0.24  
PHYKE_6590                                                            37.4       0.25  
PHYRA_72196                                                           36.6       0.39  
PHYCA_524942                                                          36.6       0.44  
PYAP_15943                                                            34.7       0.48  
PHYRA_87328                                                           35.8       0.58  
CCI50227                                                              35.4       0.95  
PHALS_12308                                                           35.0       1.3   
HYAP_03065                                                            34.3       1.9   
PITG_02760                                                            33.1       2.1   
PYVX_18330                                                            33.9       2.8   
PYU1_G004385                                                          33.9       2.8   
PYAP_22849                                                            33.9       3.3   
SDRG_05159                                                            33.5       3.6   
PHYKE_5677                                                            32.7       4.1   
PYVX_21196                                                            33.1       4.3   
PHYSO_317690                                                          33.1       4.4   
H310_07705                                                            33.1       4.8   
SPRG_08354                                                            32.7       5.2   
PPTG_05518                                                            32.7       5.9   
PYVX_22491                                                            32.7       6.0   
H257_04036                                                            32.7       6.5   
H310_06296                                                            32.7       6.6   
PHYRA_73603                                                           32.7       7.0   
PYAR_15823                                                            32.3       7.2   
PITG_01001                                                            32.3       8.6   

>PHYRA_50855
Length=489

 Score = 992 bits (2565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/478 (100%), Positives = 478/478 (100%), Gaps = 0/478 (0%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL
Sbjct  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV
Sbjct  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180
            KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM
Sbjct  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180

Query  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG  240
            KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG
Sbjct  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG  240

Query  241  IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK  300
            IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK
Sbjct  241  IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK  300

Query  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360
            LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV
Sbjct  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
            CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD
Sbjct  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
            KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK
Sbjct  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478

>PHYCA_556160
Length=649

 Score = 946 bits (2446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/480 (94%), Positives = 471/480 (98%), Gaps = 2/480 (0%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            +YDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL
Sbjct  159  NYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  218

Query  61   MHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
            MHQSSLIGEV+HHD ANFGWN++S +G+APTFNWKQLVSNVD YIKSINFKYKVELRSKY
Sbjct  219  MHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKY  278

Query  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            VKYENFLGSFV+PHTLELWH RKGTKQITTRDVVIAVGGRPKEL+CPGGEHAISSDDIFW
Sbjct  279  VKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFW  338

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239
            MKKKEPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFDQDMA+KIGEYMEVQS
Sbjct  339  MKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQS  398

Query  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299
            GIEFIRKTVPQSIT LENGQLLVKWT+EDGESCEEAFDTVLNATGRDPDVAKL LDKAGV
Sbjct  399  GIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGV  458

Query  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359
            KLNEKSGRIWVKNEQTST NIYA+GDVIDAPELTPVAIQAGRLLSRRLYNNST QMDYEK
Sbjct  459  KLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEK  518

Query  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLS-ETRTSAESCYVKVI  418
            VCTAVFTPIEYGCCG+SEEDSKERFGEDN+EVYHTNFVPLEWSLS +TRT+AESCY+KVI
Sbjct  519  VCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI  578

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
            CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK
Sbjct  579  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  638

>PHYSO_348901
Length=526

 Score = 941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/480 (94%), Positives = 468/480 (98%), Gaps = 2/480 (0%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL
Sbjct  36   SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95

Query  61   MHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
            MHQSSLIGE+MHHDSANFGWN+AS +GSA TF+WKQLV+NVD YI+ INFKYKVELRSKY
Sbjct  96   MHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKY  155

Query  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            VKYENFLGSFVD HTLELWH RKGTKQITTRDVVIAVGGRPKEL+CPGGEHAISSDDIFW
Sbjct  156  VKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFW  215

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239
            MKKKEPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFDQDMANKIGEYMEVQS
Sbjct  216  MKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQS  275

Query  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299
            GIEFIRKTVPQSIT LENGQLLVKWT EDGESCEEAFDTVLNATGRDPDVAKLGLDKA V
Sbjct  276  GIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARV  335

Query  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359
            KLNEK+GRIWVKNEQTST NIYA+GDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDY+K
Sbjct  336  KLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDK  395

Query  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLS-ETRTSAESCYVKVI  418
            +CTAVFTPIEYGCCGLSEEDSKER+GEDN+EVYH NFVPLEWSLS ETRT+AESCY+KVI
Sbjct  396  ICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVI  455

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
            CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE+FTTLE+TK
Sbjct  456  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAETFTTLEITK  515

>PHYKE_8391
Length=778

 Score = 925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/479 (92%), Positives = 458/479 (96%), Gaps = 1/479 (0%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL
Sbjct  289  SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  348

Query  61   MHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
            MHQSSLIGE MHHDSANFGWNVAS EG   TF+WKQLVSNVD+YIKSINFKYKVELRSKY
Sbjct  349  MHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408

Query  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            VKYENFLGSF+DPHTLELWH RKGTKQITTR VV+AVGGRPK+L+CPG E+AISSDDIFW
Sbjct  409  VKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFW  468

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239
            MKK  PGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFDQDMANKIGEYMEVQ+
Sbjct  469  MKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQA  528

Query  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299
            GIEFIRKTVP+SIT LENGQLLVKWT ED ESCEE FDTVLNATGRDPDVAKLGLDKAGV
Sbjct  529  GIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGV  588

Query  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359
            KLNEK+GRIW KNEQTST NI+A+GDVIDAPELTPVAIQAGR LSRRLYNNST QMDY+K
Sbjct  589  KLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDK  648

Query  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVIC  419
            VCTAVFTPIEYGCCGLSEEDS ERFGEDNVEVYH NFVPLEWSLSE+RTS+ESCYVKVIC
Sbjct  649  VCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLEWSLSESRTSSESCYVKVIC  708

Query  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
            D TRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE+FTTLEVTK
Sbjct  709  DTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEVTK  767

>PITG_18452
Length=856

 Score = 922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/480 (91%), Positives = 464/480 (97%), Gaps = 2/480 (0%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL
Sbjct  161  SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  220

Query  61   MHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
            MHQSSLIGEV+HHDSA+FGWNV+S +GSAP F+WKQLV+NVD YI+ INFKYKVELRSKY
Sbjct  221  MHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKY  280

Query  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            VKYENFLGSF+DPHTLELWH RKG+KQITTRDVVIAVGGRP+EL+ PGGEHAISSDDIFW
Sbjct  281  VKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFW  340

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239
            MK KEPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFDQDMANKIGEYMEVQS
Sbjct  341  MKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQS  400

Query  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299
            GIEFIRKTVPQSIT LENGQLLVKWT+EDGESCEEAFD+VLNATGRDPD+AKL LDKAGV
Sbjct  401  GIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGV  460

Query  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359
            KLNEK+GRIWVK+EQTST NIYA+GDVIDAPELTPVAIQAGRLLSRRLYNN+T QMDY+K
Sbjct  461  KLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDK  520

Query  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLS-ETRTSAESCYVKVI  418
            VCTAVFTPIEYGCCGLSEEDS +RFG+D +EVYHTNFVPLEWSLS ETR +AESCYVKVI
Sbjct  521  VCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVI  580

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
            CD+ RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK
Sbjct  581  CDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  640

>HYAP_07095
Length=613

 Score = 867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/480 (86%), Positives = 448/480 (93%), Gaps = 2/480 (0%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKL
Sbjct  123  SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKL  182

Query  61   MHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
            MHQSSLIGE++HHD A+FGWNV S  G  PTF+WKQLVSNV +YIKSI+FKYKVELRSK 
Sbjct  183  MHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRSKQ  242

Query  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            VKYEN LGSFVDPHTL+LWH +KGTK+ITTR VVIAVGGRP++L+C GGE A+SSDDIFW
Sbjct  243  VKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFW  302

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239
            MK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+QS
Sbjct  303  MKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEMQS  362

Query  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299
            GIEFIRKTVPQSIT L++GQLLVKW  EDG+  EE FDTVLNATGRDPDVAKLGLD+AGV
Sbjct  363  GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGV  422

Query  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359
            KLNEK+GRIWV NEQT+T N+YA+GDVIDAPELTPVAIQAGRLLSRRLYN  T QMDY+K
Sbjct  423  KLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDK  482

Query  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSE-TRTSAESCYVKVI  418
            +CTAVFTPIEYGCCGLSEEDSKE +G+D+VEVYH NFVPLEWSL+E TR +AESCYVKV+
Sbjct  483  ICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV  542

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
            CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHPTTAE+FTTLE TK
Sbjct  543  CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFTTLETTK  602

>PHALS_06481
Length=644

 Score = 837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/479 (83%), Positives = 447/479 (93%), Gaps = 2/479 (0%)

Query  2    YDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            +DYDLVVIGGG GGLACSKEAASFG+KVCVLDYVKPSPQGT+WGLGGTCVNVGCIPKKL+
Sbjct  155  FDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214

Query  62   HQSSLIGEVMHHDSANFGWNVASEG-SAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            HQSSLIGE++ HDSA FGW   +EG + P F+WKQLV+NVD YIK+INFKYKV+LRSK V
Sbjct  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180
            KYENFLGSFVDPHT++L H RKGTKQITTR+VVIAVG RP+EL+CPGGE+A+SSDDIFWM
Sbjct  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334

Query  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG  240
            K+KEPGKTLV+GASYVALECAGFLKGMGYEVKVMVRSILLR FDQ+MA+KIGEYMEVQSG
Sbjct  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSG  394

Query  241  IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK  300
            I+FIRKTVPQSI+ LEN QLLVKW +E G++CEEAF+TVLNATGRDP+VA LGLDKAGVK
Sbjct  395  IKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVK  454

Query  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360
            LNEK+GRI VKNEQTSTSNIYA+GDV+DAPELTPVAIQ+GRLLS+RLYNNS+ QMDY+KV
Sbjct  455  LNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKV  514

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL-SETRTSAESCYVKVIC  419
            CT VFTPIEYGCCGLSEE SK R+GEDN+E+YHTNFVPLEWSL SETRT++ SCY+KV+C
Sbjct  515  CTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVC  574

Query  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
            DK+RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQMV+TVGIHP TAES T LEVTK
Sbjct  575  DKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTILEVTK  633

>PYAP_17761
Length=622

 Score = 816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/478 (80%), Positives = 430/478 (90%), Gaps = 5/478 (1%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            +YDYDLVVIGGGSGGLACSKEAA +GKKVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKL
Sbjct  139  TYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTCVNVGCIPKKL  198

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            MHQS+LIGE+MH D+  FGWN+  +     F W QLV +V+ YIK INFKYKVELR K V
Sbjct  199  MHQSALIGELMHKDAGAFGWNMGEQ----KFTWTQLVESVNNYIKGINFKYKVELRDKKV  254

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180
            KYENFLGSFVDPHT+ELWHH+KGTK ITTR VV+AVGGRP++LSCPGGEHAISSDDIFW 
Sbjct  255  KYENFLGSFVDPHTIELWHHKKGTKTITTRHVVVAVGGRPRQLSCPGGEHAISSDDIFW-  313

Query  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG  240
            +K EPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFD+DMAN+IG++M+ +S 
Sbjct  314  RKTEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMANRIGDFMQDESK  373

Query  241  IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK  300
            IEFIR  VP+SI  LENGQLLVKW + DGE+ EE FD+VLNATGRDPDV+KL LDKAGV+
Sbjct  374  IEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDVSKLNLDKAGVQ  433

Query  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360
            LN K+GRI V NEQTST N++A+GDVIDAPELTPVAIQAGRLL+RRLYNN T  MDY+KV
Sbjct  434  LNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKV  493

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
            CTAVFTPIEYGCCGLSEE +K+++GEDN+E+YH +F+PLEWSLS+ R +A +CYVKVICD
Sbjct  494  CTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLSQDRVAANTCYVKVICD  553

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
            KTRDK+VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV+ VGIHPTTAE FTTLEVTK
Sbjct  554  KTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHPTTAEVFTTLEVTK  611

>PYIR_13452
Length=645

 Score = 808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/488 (80%), Positives = 431/488 (88%), Gaps = 5/488 (1%)

Query  2    YDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            YDYDL+VIGGGSGGLACSKEA+ +GKKVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKLM
Sbjct  163  YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222

Query  62   HQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121
            HQSSLIGE +H D+  FGW V  +    TF+W Q++ +V++YIKSINFKYKVELR K VK
Sbjct  223  HQSSLIGETIHKDAKAFGWTVGEQ----TFDWSQMLKSVNSYIKSINFKYKVELRDKKVK  278

Query  122  YENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMK  181
            YEN LGSFVD HTLELWH +KGTK +TTRDVVIAVGGRPK LSC GG+ AISSDDIFW +
Sbjct  279  YENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW-R  337

Query  182  KKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSGI  241
            K+ PGKTLVVGASYVALECAGF+KGMGY+VK+MVRSILLRGFDQDMANKIGE+ME +S I
Sbjct  338  KEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKI  397

Query  242  EFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKL  301
            EFIR  VPQSIT LE+GQLLVKW + DGE+CEEAFDTVLNATGRDPDVAKLGLDK GVKL
Sbjct  398  EFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKL  457

Query  302  NEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVC  361
            N K+GRI V NEQTST NIYA+GDVIDAPELTPVAIQAGRLL+RRLYNN TA MDY+KVC
Sbjct  458  NPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVC  517

Query  362  TAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDK  421
            TAVFTPIEYGCCGLSEE S E++GE+N+E+YH NF PLEWSLS  R +A SCYVKVICD 
Sbjct  518  TAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDT  577

Query  422  TRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKssg  481
             R+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYDQMV+ VGIHPTTAE FTTLEVTKSSG
Sbjct  578  KRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSG  637

Query  482  gattgggC  489
             +   GGC
Sbjct  638  ESAASGGC  645

>PYAR_13569
Length=494

 Score = 788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/478 (78%), Positives = 420/478 (88%), Gaps = 5/478 (1%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            +YDYDLVVIGGGSGGLACSKEAA  GKKV VLDYVKPSP GT+WGLGGTCVNVGCIPKKL
Sbjct  11   TYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVGCIPKKL  70

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            MHQS+L+GE+MH D+  FGW   ++    +F W QLV++V+ YIK INFKYKVELR K V
Sbjct  71   MHQSALLGELMHKDAPAFGWTTGAQ----SFTWTQLVASVNNYIKGINFKYKVELRDKKV  126

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180
            KYENFLGSFVD HT+ELWHH+K  K +TTR VVIAVGGRP+ L+CPGGEHAISSDDIFW 
Sbjct  127  KYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISSDDIFW-  185

Query  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG  240
            +K EPGKTLVVGASYVALECAGFLKGMGY+VK+MVRSILLRGFDQDMAN+IG++M+ +S 
Sbjct  186  RKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDFMQDESR  245

Query  241  IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK  300
            IEFIR  VP+SI   ENG+LLVKW + DG+  EE FDTVLNATGRDPDV KL LDKAGV+
Sbjct  246  IEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNLDKAGVE  305

Query  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360
            LN KSGRI   NEQTST NI+A+GDVIDAPELTPVAIQAGRLL+RRLYNN T  MDY+K+
Sbjct  306  LNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKI  365

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
            CTAVFTPIEYGCCGLSEED+K ++GE+N+E+YH +F+PLEWSLSE R +A +CYVKVICD
Sbjct  366  CTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEERVAAATCYVKVICD  425

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
            KTRDK VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV+ VGIHPTTAE FTTLE+TK
Sbjct  426  KTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTTLEITK  483

>PYIW_19972
Length=609

 Score = 779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/489 (79%), Positives = 429/489 (88%), Gaps = 5/489 (1%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            +YDYDL+VIGGGSGGLACSKEAA +GKKVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKL
Sbjct  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            MHQSSLIGE +H D+A FGW+V  +     F+W Q++ +V++YIKSINFKYKVELR K V
Sbjct  186  MHQSSLIGETIHKDAAAFGWSVGEQ----KFDWAQMLKSVNSYIKSINFKYKVELRDKKV  241

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180
            KYEN LGSFVD HTLELWH +KGTK +TTRDVVIAVGGRPK LSC GGE AISSDDIFW 
Sbjct  242  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW-  300

Query  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG  240
            +K+ PGKTLV+GASYVALECAGF+KGMGY+VK+MVRSILLRGFDQDMA+KIGE+MEV+S 
Sbjct  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESK  360

Query  241  IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK  300
            IEFIR  VPQSIT LE+GQLLVKW + DG+ CEEAFDTVLNATGRDPDVAKL LD  GV+
Sbjct  361  IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQ  420

Query  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360
            LN K+GRI V NEQTS  NI+A+GDVIDAPELTPVAIQAGR+L+RRLYNN TA MDY+KV
Sbjct  421  LNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKV  480

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
            CTAVFTPIEYGCCGLSEE S E+FGED +E+YH NF PLEWSLS  R +A SCYVKVICD
Sbjct  481  CTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICD  540

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKss  480
             TR+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYD MV+ VGIHPTTAE FTTLEVTKSS
Sbjct  541  TTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSS  600

Query  481  ggattgggC  489
            G +   GGC
Sbjct  601  GESAAAGGC  609

>PYVX_18170
Length=510

 Score = 737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/470 (78%), Positives = 411/470 (87%), Gaps = 5/470 (1%)

Query  21   EAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFGW  80
            EA+ FG+KV VLDYVKPSPQGT WGLGGTCVNVGCIPKKLMHQS+LIGEVMH D+A FGW
Sbjct  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104

Query  81   NVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTLELWHH  140
               +   AP F+W QL S+V  YIK++NFKYKV+LR K VKYENFLG+FVDPHT+EL + 
Sbjct  105  QFEN---APKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNP  161

Query  141  RKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALEC  200
            RK +K +TTR VV+AVGGRP+ L CPGGE +I+SDDIFW +K  PGKTLVVGASYVALEC
Sbjct  162  RKPSKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFW-RKTAPGKTLVVGASYVALEC  220

Query  201  AGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQL  260
            AGFLKG GY+VKVMVRSILLRGFDQDMAN+IGEYMEV++GIEFIR+TVP SIT LE+G+L
Sbjct  221  AGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKL  280

Query  261  LVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNEQTSTSNI  320
            LVKWT  DG + EEAFDTVLNATGR+PDV KL LDKAGVKLN K+GRI V NEQTST NI
Sbjct  281  LVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNI  340

Query  321  YALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDS  380
            +A+GDVIDAPELTPVAIQAGRLL+RRLYNN T  MDYEKVCTAVFTPIEYGCCGLSEE+S
Sbjct  341  FAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEES  400

Query  381  KERFGEDNVEVYHTNFVPLEWSLS-ETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGE  439
             ERFGEDN+EVYH NF PLEW+LS +TR S  +CY+KVICDKTRD FVVGFHYLGPNAGE
Sbjct  401  IERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGE  460

Query  440  VTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKssggattgggC  489
            VTQA+GLAMKLGFTY+QMV  VGIHPTTAE+FTTLEVTKSSG +  GG C
Sbjct  461  VTQAIGLAMKLGFTYEQMVSVVGIHPTTAETFTTLEVTKSSGASAAGGNC  510

>H257_08436
Length=642

 Score = 677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/490 (69%), Positives = 388/490 (79%), Gaps = 12/490 (2%)

Query  2    YDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCIPKKLM
Sbjct  163  YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM  222

Query  62   HQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121
            HQSS+IGE++H D+  FGW+V    S  TF+W +LVS+V  YI  +NFKY+V+LR K VK
Sbjct  223  HQSSIIGEILHKDADQFGWSV----SNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVK  278

Query  122  YENFLGSFVDPHTLELWH--HRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            YEN LG+F D HTL L +   +KG   +T R  VIAVGGRPK LSCPG EHA+SSDDIF 
Sbjct  279  YENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF-  337

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239
             K   PGKTLVVGASYVALECAGFLKG G++V +MVRSILLRGFDQD+A +IGEYME +S
Sbjct  338  SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESES  397

Query  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299
            GI FI+++VP SI  LENGQ  V  T     + ++ +DT+LNATGR PDV KL LD AGV
Sbjct  398  GIAFIKESVPTSIVKLENGQFQVTHT-----TGQDVYDTILNATGRSPDVQKLNLDAAGV  452

Query  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359
             LN KSGRI V NEQTST NIYALGDVIDAPELTPVAIQAG+LLSRRL+ N T  MDY K
Sbjct  453  ALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTK  512

Query  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVIC  419
            +CTAVFTP+EYGCCGLSEED+    G +NVEVYH NF PLEWSLS  R  A+ CY K+I 
Sbjct  513  ICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIV  572

Query  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKs  479
            D T+ K V+GFHYLGPNAGEVTQA+G+A+KL  TYD  ++TVGIHPTTAE FTTLE+TK 
Sbjct  573  DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKE  632

Query  480  sggattgggC  489
            SG   +  GC
Sbjct  633  SGVDASASGC  642

>H310_08590
Length=640

 Score = 672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/490 (68%), Positives = 387/490 (79%), Gaps = 12/490 (2%)

Query  2    YDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCIPKKLM
Sbjct  161  YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM  220

Query  62   HQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121
            HQSS+IGE++H D+  FGW V    S  +F+W +LVS+V  YI  +NFKY+++LR K VK
Sbjct  221  HQSSIIGELLHKDAEQFGWTV----SNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVK  276

Query  122  YENFLGSFVDPHTLELWHH--RKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            YEN LG+F D HTL L +   +KG   +T R  VIAVGGRPK LSCPG EHAISSDDIF 
Sbjct  277  YENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIF-  335

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239
             K + PGKTLVVGASYVALECAGFLKG G++V +MVRSILLRGFDQD+A +IGEYME +S
Sbjct  336  SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENES  395

Query  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299
            GI FI+++VP SI  L NGQL V  T+ +G      +DTVLNATGR PDV  L L  AGV
Sbjct  396  GIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLPAAGV  450

Query  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359
             LN KSGRI V NEQTST +IYA+GDVIDAPELTPVAIQAG+LL+RRL+ N TA MDY K
Sbjct  451  TLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTK  510

Query  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVIC  419
            +CTAVFTP+EYGCCGLSEED+    G DN++VYH NF PLEWSLS  R  A+ CY K+I 
Sbjct  511  ICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIV  570

Query  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKs  479
            D T+ K VVGFHYLGPNAGEVTQA+G+AMKL  TYD  V+TVGIHPTTAE FTTLE+TK 
Sbjct  571  DTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKE  630

Query  480  sggattgggC  489
            SG   +  GC
Sbjct  631  SGEDASASGC  640

>SPRG_14103
Length=628

 Score = 625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/491 (65%), Positives = 380/491 (77%), Gaps = 12/491 (2%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            +YD+DLVVIGGGSGGLA SKEAA +G+KV VLDYVKPSPQG++WGLGGTCVNVGCIPKKL
Sbjct  148  TYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKL  207

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            MHQS+++GE++H D+  FGW V +     TF+W +LV++V  YI  +NFKY+V+LR K V
Sbjct  208  MHQSAIMGELLHKDAEAFGWAVPNA----TFDWTKLVTSVQDYIHGLNFKYRVDLRDKKV  263

Query  121  KYENFLGSFVDPHTLELWHHRKG--TKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIF  178
            KYENFLG+F D HTL L +  KG   K +T R  +IAVGGRPK L CPG + AISSDDIF
Sbjct  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323

Query  179  WMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQ  238
              +   PGKTLVVGASYVALECAGFLK  G++V VMVRSILLRGFD DMA +IG YME +
Sbjct  324  -SRPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMVRSILLRGFDTDMAARIGTYMEEE  382

Query  239  SGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAG  298
            + I+FI+  VP SI  L NGQL V  T  +G      +DTVLNATGR+PDV+ L L  AG
Sbjct  383  AKIDFIKGAVPTSIEQLANGQLKVTHTFGEG-----IYDTVLNATGRNPDVSGLNLPAAG  437

Query  299  VKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYE  358
            V LN K+GRI V +EQTS  +IYA+GDVID PELTPVAIQAGRLL++RL++NS   M Y+
Sbjct  438  VGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTPVAIQAGRLLAKRLFDNSATLMAYD  497

Query  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI  418
            KVCTAVFTPIEYGCCGLSE+ + E  G DN+ VYH +F PLEWSLS  R  A+ CY K+I
Sbjct  498  KVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLI  557

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
             D+T++  VVGFHYLGPNAGEVTQA+G+AMKL  +YD  V TVGIHPTTAE FTTLE+TK
Sbjct  558  VDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNASYDDFVSTVGIHPTTAEIFTTLEITK  617

Query  479  ssggattgggC  489
             SG   +  GC
Sbjct  618  ESGLDASAAGC  628

>SDRG_16720
Length=628

 Score = 622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/491 (65%), Positives = 380/491 (77%), Gaps = 12/491 (2%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            +YD+DLVVIGGGSGGLA SKEAA +G+KV VLDYVKPSPQG++WGLGGTCVNVGCIPKKL
Sbjct  148  TYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKL  207

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            MHQS+++GE++H D+  FGW V +     TF+W +L+++V  YI  +NFKY+V+LR K V
Sbjct  208  MHQSAIMGELLHKDAEAFGWAVPNA----TFDWTKLITSVQDYIHGLNFKYRVDLRDKKV  263

Query  121  KYENFLGSFVDPHTLELWHHRKG--TKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIF  178
            KYENFLG+F D HTL L +  KG   K +T R  +IAVGGRPK L CPG + AISSDDIF
Sbjct  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323

Query  179  WMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQ  238
              +   PGKTLVVGASYVALECAGFLKG G++V VMVRSILLRGFD DMA +IG YME +
Sbjct  324  -SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEE  382

Query  239  SGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAG  298
            + I FI+  VP SI  L NGQL V  T  +G      +DTVLNATGR PDV+ L L  AG
Sbjct  383  AKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLNLSAAG  437

Query  299  VKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYE  358
            V LN K+GRI V +EQTST +IYA+GDVID PELTPVAIQAGRLLS+RL++NS   M Y+
Sbjct  438  VGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYD  497

Query  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI  418
            KVCTAVFTPIEYGCCGLSE+ + E  G DN+ VYH +F PLEWSLS  R  A+ CY K+I
Sbjct  498  KVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLI  557

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478
             D+T++  VVGFHYLGPNAGEVTQA+G+A+KL  +Y+  V TVGIHPTTAE FTTLE+TK
Sbjct  558  VDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITK  617

Query  479  ssggattgggC  489
             SG   +  GC
Sbjct  618  ESGLDASAAGC  628

>SPRG_04074
Length=509

 Score = 422 bits (1086),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 245/497 (49%), Positives = 319/497 (64%), Gaps = 27/497 (5%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            ++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK+
Sbjct  3    NFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKI  62

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            MH S ++G  + HD+A+ GW V  +      NW+ LV  V A++K +NF Y+V LRS  V
Sbjct  63   MHYSGILGAGL-HDAAHLGWQVPEKVE---HNWETLVEAVQAHVKKLNFSYRVGLRSNKV  118

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPK-ELSCPG-GEHAISSDDIF  178
            +Y N L  F DPHTL        T+ +T   ++IA GGRP      PG  E+AI+SDD+F
Sbjct  119  QYINALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDDLF  178

Query  179  WMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQ  238
             +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + M V 
Sbjct  179  SLSTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-VA  236

Query  239  SGIEFIRKTVPQSITTLE-NGQLLVKWTN-EDGESCEEAFDTVLNATGRDPDVAKLGLDK  296
             G++F   T+P SI   E  GQL V + N E  E+  EAFDTVL A GR  D   +GL+K
Sbjct  237  QGMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGLEK  296

Query  297  AGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDA-PELTPVAIQAGRLLSRRLYN-NSTAQ  354
            AGVK    +G+    NE T+  +I+A+GDV+   PELTPVAI+AG  L RRL+  N T  
Sbjct  297  AGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKT  355

Query  355  MDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAES--  412
            M+Y+ + T VFTP+EYG  GLSEE++  R+G+D++ VY   F  LEW     R  AES  
Sbjct  356  MNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVH-RKKAESAQ  414

Query  413  -----------CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  461
                       C  K++C K+ ++ V+GFH++GPNAGEVTQ   +A+ +G T +   + +
Sbjct  415  EGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVI  474

Query  462  GIHPTTAESFTTLEVTK  478
            GIHPT AESF  L VTK
Sbjct  475  GIHPTDAESFMALTVTK  491

>SDRG_14408
Length=528

 Score = 422 bits (1084),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 245/499 (49%), Positives = 321/499 (64%), Gaps = 31/499 (6%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            ++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK+
Sbjct  22   NFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKI  81

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            MH S ++G  + HD+A+ GW +  +      NW+ LV  V A++K +NF Y+V LRS  V
Sbjct  82   MHYSGILGAGL-HDAAHLGWQLPEKVE---HNWETLVETVQAHVKKLNFSYRVGLRSNKV  137

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGR---PKELSCPG-GEHAISSDD  176
            +Y N L  F DPHTL        T+ +T   ++IA GGR   PKE+  PG GE+AI+SDD
Sbjct  138  QYINALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEI--PGVGEYAITSDD  195

Query  177  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYME  236
            +F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + M 
Sbjct  196  LFSLTTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-  253

Query  237  VQSGIEFIRKTVPQSITTLE-NGQLLVKWTN-EDGESCEEAFDTVLNATGRDPDVAKLGL  294
            V  G++F   T+P SI   +  GQL V + N E  E+  E FDTVL A GR  D   +GL
Sbjct  254  VAQGMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFNIGL  313

Query  295  DKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDA-PELTPVAIQAGRLLSRRLYN-NST  352
            +K GVK    +G+    NE T+  +I+A+GDV+   PELTPVAI+AG  L RRL+  N T
Sbjct  314  EKVGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYT  372

Query  353  AQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAES  412
              M+Y+ + T VFTP+EYG  GLSEE++  R+G+D+V VY   F  LEW     R  AES
Sbjct  373  KTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVH-RQKAES  431

Query  413  -------------CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVD  459
                         C  K++C K+ ++ V+GFH++GPNAGEVTQ   +A+ +G T +   +
Sbjct  432  AQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDN  491

Query  460  TVGIHPTTAESFTTLEVTK  478
             +GIHPT AESF  L VTK
Sbjct  492  VIGIHPTDAESFMALTVTK  510

>PHALS_08068
Length=497

 Score = 265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 262/487 (54%), Gaps = 36/487 (7%)

Query  3    DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            +YD +VIG GSGG+A ++ AAS+ G +V +++  +         LGGTCVNVGC+PKKLM
Sbjct  23   EYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLM  73

Query  62   HQSSLIGEVMHHDSANFGWNVASEGSAPT----FNWKQLVSNVDAYIKSINFKYKVELRS  117
            + ++ +   +HHD   +G+  A+ G   +    FNW +L +  DAY+  +N  Y+  L +
Sbjct  74   YIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYETNLAN  133

Query  118  KYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDI  177
              V        F +   +E+       K++  + ++IAVGGRP     PG E  I SD  
Sbjct  134  SKVDLIRGSAKFNERGNVEV-----DDKEVRAKKILIAVGGRPLIPDIPGKELCIDSDGF  188

Query  178  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYME  236
            F ++   P K  +VGA Y+A+E AG L  +G +  V  R   +LR FD  +   + E M 
Sbjct  189  FELETL-PTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNILRTTLEEAM-  246

Query  237  VQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDK  296
               G+     +    +    +G   +  TN    S    FD V+ ATGR P  + L L+K
Sbjct  247  ANDGVHLRPNSTVARVKEAADGTKTLVLTN---GSEHRGFDVVICATGRVPLTSTLNLEK  303

Query  297  AGVKLNEKSGRIWVKN-EQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQ  354
            AG+  ++ +G I V   ++T+ +N+YA+GDV + P LTPVAI AGR LS RL+     A+
Sbjct  304  AGITTDD-NGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGGMKDAK  362

Query  355  MDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESC-  413
            + YE + T +F+    G  GL+EE +++++G++N++VY + FV + + L      A    
Sbjct  363  LSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIEATGVP  422

Query  414  ------YVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  467
                   +K++C   ++K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT 
Sbjct  423  KEKPKTAMKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTA  481

Query  468  AESFTTL  474
             E   TL
Sbjct  482  GEELVTL  488

>PYAP_21882
Length=502

 Score = 256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 169/489 (35%), Positives = 265/489 (54%), Gaps = 43/489 (9%)

Query  4    YDLVVIGGGSGGLACSKEAASFGK-KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            YD +VIG GSGG+A S+ AA++   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  31   YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  81

Query  63   QSSLIGEVMHHDSANFGW------NVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELR  116
             ++ +G  +H D  ++G+      ++A E     F+WK+L    DAY+  +N  Y   L 
Sbjct  82   LAANLGHTLHRDLFHYGFESTKGEHLAHE---TQFHWKKLKERRDAYVLRLNGIYGRNLD  138

Query  117  SKYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDD  176
            +  V       +F     +E+       K+I  ++V+IAVGG+P     PG EH I SD 
Sbjct  139  NSKVDLFRGTATFNAKGNVEV-----DGKEIAAKNVLIAVGGKPLIPDIPGKEHCIDSDG  193

Query  177  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYM  235
             F + +++P K  VVGA Y+A+E AG L G+G +  +  R   +LRGFD+ +   + + M
Sbjct  194  FFEL-EEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDELIRTTLHDAM  252

Query  236  EVQSGIEF-IRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGL  294
              + G+      +V + I   +  + LV     DG S    FD+V+ A GR P    L L
Sbjct  253  -AKEGVNLRPHSSVTKVIKAADGTKTLVL---ADG-SEHSGFDSVIYAAGRVPLTESLNL  307

Query  295  DKAGVKLNEKSGRIWVKNEQ--TSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN-S  351
            + AG++ ++  G I +   Q  T+ +NI+A+GDV   P LTPVAI AGR L+ RL+    
Sbjct  308  EAAGIETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRLFGGMK  366

Query  352  TAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL------SE  405
             A+  YE + T VF+    G  GL+E+ ++ +FG+D ++VY + FV + + +        
Sbjct  367  DAKASYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINEFGEDG  426

Query  406  TRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  465
             +       +K++C + +D+ VVG H +G  A E+ Q  G+A+K+G T       V IHP
Sbjct  427  QQKPKPMTAMKLVC-QGKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCVAIHP  485

Query  466  TTAESFTTL  474
            T AE   T+
Sbjct  486  TAAEELVTM  494

>SDRG_03822
Length=494

 Score = 254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 162/474 (34%), Positives = 251/474 (53%), Gaps = 16/474 (3%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++L  E++H   A + +    +     F+W  + +  DAY+K +N  Y   +    V   
Sbjct  61   AALHAEMLHSARA-YAFKGVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDLV  119

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
                 FVD HT+E+   R   K I     +IAVGG P     PG EHAISSD  F + + 
Sbjct  120  MGAAKFVDNHTVEVNGDRYAAKHI-----LIAVGGVPAMPPLPGIEHAISSDGFFAL-ET  173

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME  +G+ 
Sbjct  174  QPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVR  232

Query  243  FIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLN  302
            F+R++   SI   E+G L ++ T          F+TVL A GR P    LGL+   + L+
Sbjct  233  FVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIALS  292

Query  303  EKSGRIWVKNEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNN-STAQMDYEKV  360
                      E T+  N++A+GDV     ELTPVAI AGR L+ RL+ N   A ++Y ++
Sbjct  293  PDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQI  352

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
             T VF+    G  GL+E  +  ++G  NV  + ++F  + +++S  +   ++  +K++C 
Sbjct  353  PTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKVQTA-MKLVCI  411

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
               +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  412  GVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PYAR_17512
Length=533

 Score = 254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 170/508 (33%), Positives = 269/508 (53%), Gaps = 52/508 (10%)

Query  3    DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  33   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIM  83

Query  62   HQSSLIGEVMHHDSANFGWNVASEG----SAPTFNWKQLVSNVDAYIKSINFKYKVELRS  117
            + ++ +G ++H D  ++G+     G        F+W +L    DAY+  +N  Y+  L +
Sbjct  84   YLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYERNLGN  143

Query  118  KYVKYENFLGSFVDPHTLEL----------------WHHRKGT-----KQITTRDVVIAV  156
              V+      +F     +E+                  + +G      K+I+ ++V+IAV
Sbjct  144  SKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEISAKNVLIAV  203

Query  157  GGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR  216
            GG+P   + PG EH I SD  F +++  P K  VVGA Y+A+E AG L G+G +  +  R
Sbjct  204  GGKPLIPNIPGKEHCIDSDGFFELEEM-PKKVAVVGAGYIAVELAGVLHGLGSDTTIFCR  262

Query  217  SI-LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEA  275
               +LRGFD+ + + + + M+ + G++    ++   +T   +G   +    +DG      
Sbjct  263  KDGVLRGFDELIRSTLHDAMD-KDGLKLRPHSLVAKVTKQADGTKTLVL--QDGTE-HAG  318

Query  276  FDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNEQTSTS--NIYALGDVIDAPELT  333
            FDTV+ A GR P    L L+ AGV+  +  G I +   Q +T+  NI+A+GDV   P LT
Sbjct  319  FDTVIYAAGRVPLTQSLNLEGAGVE-TDAQGFIKIDEYQRTTAKKNIFAVGDVCGTPALT  377

Query  334  PVAIQAGRLLSRRLYNN-STAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVY  392
            PVAI AGR LS RL+     A+M YE + T VF+    G  GL+E++++ + G+D V+VY
Sbjct  378  PVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVKVY  437

Query  393  HTNFVPLEWSLSE------TRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGL  446
             + FV + + +         +       +K++C    +K VVG H +G  A E+ Q  G+
Sbjct  438  SSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEK-VVGVHLIGMAADEILQGFGV  496

Query  447  AMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            A+K+G T       V IHPT AE   T+
Sbjct  497  AVKMGATKADFDSCVAIHPTAAEELVTM  524

>SDRG_15045
Length=494

 Score = 253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 160/474 (34%), Positives = 252/474 (53%), Gaps = 16/474 (3%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++L  E++H   A + +   S+     F+W  + +  DAY+  +N  Y   +    V   
Sbjct  61   AALHAEMLHSARA-YAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
                 FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD  F + + 
Sbjct  120  MGAAKFVDNHTIEVNGER-----YTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-ET  173

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  VVGA Y+A+E AG    +     V  R + +LR FD  + + +   ME  +G++
Sbjct  174  QPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQ  232

Query  243  FIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLN  302
            F+R++   +I    +G L ++ T          F+TVL A GR P    LGL+   + L+
Sbjct  233  FVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALS  292

Query  303  EKSGRIWVKNEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNN-STAQMDYEKV  360
             +        E T+  N+YA+GDV     ELTPVAI AGR L+ RL+ N   A ++Y ++
Sbjct  293  TEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQI  352

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
             T VF+    G  GL+E  + E++G  NV  + ++F  + +++   +   ++  +K++C 
Sbjct  353  PTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-MKLVCI  411

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
               +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  412  GVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_12187
Length=462

 Score = 252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 171/475 (36%), Positives = 256/475 (54%), Gaps = 26/475 (5%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVV+GGGSGG+A ++ AA++GKKV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++ +   M HD+  +G+         T +W  L    DAY+  +N  Y   L+   V + 
Sbjct  56   AADLAHSMRHDAPAYGFPAVPN---TTVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDFA  112

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
              L SF     +++             +V++AVGG+P     PG EH ISSD  F + ++
Sbjct  113  QGLCSFGSDGRVQI---DATPLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFELDER  169

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIE  242
             P +  VVGA Y+A+E AG L+G+G +  +  R   +LR FD DM   +      + GI 
Sbjct  170  -PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQAVLHDAFQRDGIT  227

Query  243  F-IRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKL  301
                 T+ +       G L V  T  +  S    FD VL ATGR P    LGL+  G++L
Sbjct  228  LQPHSTIARVDKDPTTGSLSVTTTAGEHHS---GFDCVLVATGRTPMTKDLGLEHRGIQL  284

Query  302  NEKSGRIWVKNEQ-TSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYEK  359
            +  +G I V   Q TS   ++ALGDV+D   LTPVAI AGR L+ RL+     A+ DY  
Sbjct  285  S-PNGFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADYTN  343

Query  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVIC  419
            + + VF+    G  GL+E+++++ + +D ++VY + FV + +SL E      +  +K+IC
Sbjct  344  IPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAHEKPTTAMKLIC  403

Query  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
                +K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  404  VGPSEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>SPRG_11769
Length=453

 Score = 251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 168/474 (35%), Positives = 256/474 (54%), Gaps = 33/474 (7%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVV+GGGSGG+A ++ AA++GKKV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++ +   M HD+  +G+         T +W  L    DAY+  +N  Y   L+   V + 
Sbjct  56   AADLAHSMRHDAPAYGFPAVPN---TTVDWATLKQRRDAYVTRLNGIYARNLQGSGVDFA  112

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
            + L SF           R+G +++      +AVGG+P     PG EH ISSD  F + ++
Sbjct  113  HGLCSFGS-------DGRRGDERL------VAVGGQPVMPDIPGIEHCISSDGFFELDER  159

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIE  242
             P +  VVGA Y+A+E AG L+G+G +  +  R   +LR FD DM   +      + GI 
Sbjct  160  -PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQSVLHDAFKRDGIT  217

Query  243  FIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLN  302
                +    +  ++     +  T   G+     FD VL ATGR P    LGL+  G++L+
Sbjct  218  LQPHSTVARVDKVDPATGTLSLTTTAGDY-HTGFDCVLVATGRTPMTKHLGLEHRGIELS  276

Query  303  EKSGRIWVKNEQ-TSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYEKV  360
              +G I V   Q TS   ++ALGDV++   LTPVAI AGR L+ RL+     A+ DY  +
Sbjct  277  -PNGFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYTSI  335

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
             + VF+    G  GL+E+++++ + ED ++VY + FV + +SL E      +  +K+IC 
Sbjct  336  PSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAHEKPTTAMKLICV  395

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
               +K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  396  GPTEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>PHYSO_254571
Length=489

 Score = 251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 174/495 (35%), Positives = 255/495 (52%), Gaps = 52/495 (11%)

Query  3    DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  15   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKKLM  65

Query  62   HQSSLIGEVMHHDSANFGWNVASE----GSAPTFNWKQLVSNVDAYIKSINFKYKVELRS  117
              ++ +   +HHD  ++G+         G    F+W +L +  DAY+  +N  Y+  L +
Sbjct  66   FIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  125

Query  118  KYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDI  177
              V        F D   +E+       K+I  ++V+IAVGG+P     PG E  I SD  
Sbjct  126  SKVALIRGSAKFNDKGNVEV-----DGKEILAKNVMIAVGGKPLIPDIPGKELCIDSDGF  180

Query  178  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFD-------QDMAN  229
            F ++   P K  VVGA Y+A+E AG L  +G +  +  R   +LR FD       +D   
Sbjct  181  FELETL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLEDAMA  239

Query  230  KIGEYMEVQSGIEFIRKTVPQSIT-TLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPD  288
            K G ++   S I  + K    + T  L +G            S    +D V+ A GR P 
Sbjct  240  KDGVHLRPHSNIARVEKADDGTKTLVLADG------------SEYSGYDVVIYAAGRVPL  287

Query  289  VAKLGLDKAGVKLNEKSGRIWVKN-EQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRL  347
             + L LDKAGV   +K+G I V   ++TS S + A+GDV   P LTPVAI AGR LS RL
Sbjct  288  TSNLQLDKAGVD-TDKNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRL  346

Query  348  YNN-STAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSET  406
            +     A++ YE + T VF+    G  GL+EE ++ ++G+D ++VY + FV + + L   
Sbjct  347  FGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINE  406

Query  407  RTSA-------ESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVD  459
               A           +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     +
Sbjct  407  MDEATGEPKDKPKTAMKLVCAGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDN  465

Query  460  TVGIHPTTAESFTTL  474
             V IHPT  E   TL
Sbjct  466  CVAIHPTAGEELVTL  480

>SDRG_11131
Length=494

 Score = 251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 159/474 (34%), Positives = 251/474 (53%), Gaps = 16/474 (3%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++L  E++H   A + +   S+     F+W  + +  DAY+  +N  Y   +    V   
Sbjct  61   AALHAEMLHSARA-YAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
                 FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD  F + + 
Sbjct  120  MGAAKFVDNHTIEVNGER-----YTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-ET  173

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  VVGA Y+A+E AG    +     V  R + +LR FD  + + +   ME  +G++
Sbjct  174  QPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQ  232

Query  243  FIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLN  302
            F+R++   +I    +G L ++ T          F+TVL A GR P    LGL+   + L+
Sbjct  233  FVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALS  292

Query  303  EKSGRIWVKNEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TAQMDYEKV  360
             +        E T+  N+YA+GDV     ELTPVAI AGR L+ RL+ N   A ++Y ++
Sbjct  293  TEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQI  352

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
             T VF+    G  GL+E  +  ++G  NV  + ++F  + +++   +   ++  +K++C 
Sbjct  353  PTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-MKLVCI  411

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
               +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  412  GVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PYIR_17506
Length=509

 Score = 249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 170/484 (35%), Positives = 262/484 (54%), Gaps = 34/484 (7%)

Query  4    YDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  63   QSSLIGEVMHHDSANFGW---NVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
             ++ +   +H D+  +G+   + +  G    F+W +L    DAYI  +N  Y+  L +  
Sbjct  90   LAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERNLGNSK  149

Query  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            V       +F     +E+       K I+ R+V+IAVGG+P     PG EH I SD  F 
Sbjct  150  VDLIQGTAAFNAQGEVEV-----DGKVISARNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  204

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYMEVQ  238
            +++  P K  VVGA Y+A+E AG L G+G +  +  R   +LR FD+ + + + + M   
Sbjct  205  LEEL-PNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDAMAKD  263

Query  239  SGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAG  298
              +   +  V +   TL+  + LV     DG S    FDTV+ A GR P  + L +  AG
Sbjct  264  GIVVRPQSNVARIEKTLDGKKTLVL---ADG-SEHAGFDTVIYAAGRIPLTSNLNISAAG  319

Query  299  VKLNEKSGRIWVKNEQ-TSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMD  356
            ++  +K G I V   Q TS +N++A+GDV     LTPVAI AGR LS RL+     A++ 
Sbjct  320  IE-TDKHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMEDAKIS  378

Query  357  YEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL-----SETRTSAE  411
            Y  + T VF+    G  GL+E++++E++G+  ++ Y + FV + + L     +E  T  +
Sbjct  379  YNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNELDAEGNTKPK  438

Query  412  S-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAES  470
                +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V IHPT  E 
Sbjct  439  PMTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCVAIHPTAGEE  497

Query  471  FTTL  474
              TL
Sbjct  498  LVTL  501

>SDRG_03823
Length=497

 Score = 248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 166/474 (35%), Positives = 256/474 (54%), Gaps = 16/474 (3%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +VIGGGSGG + ++ AA++G KV V++           G+GGTCVNVGC+PKK+M  
Sbjct  7    YDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKKVMFN  63

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            +++  E++H   A    N+  +    +F+W  L    DAY+  +N  Y+  L +  +   
Sbjct  64   AAMHAEMLHSAHAYTFKNI-QDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNKIPLI  122

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
                 FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD  F + + 
Sbjct  123  YGAAKFVDNHTIEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-ET  176

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME  +G+ 
Sbjct  177  QPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVR  235

Query  243  FIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLN  302
            F+R++   SI   E+G L ++ T          F+TVL A GR P    LGL+   + L+
Sbjct  236  FVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIALS  295

Query  303  EKSGRIWVKNEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLY-NNSTAQMDYEKV  360
                      E T+  N++A+GDV     ELTPVAI AGR L+ RL+ N   A ++Y ++
Sbjct  296  PDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQI  355

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
             T VF+    G  GL+E  + E++G  NV+VY + F  + +++SE +   +   +K++C 
Sbjct  356  PTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSE-QDEKQKTAMKLMCI  414

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
               ++ V+G H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  415  G-EEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  467

>PHYKE_10327
Length=1200

 Score = 258 bits (658),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 171/487 (35%), Positives = 266/487 (55%), Gaps = 36/487 (7%)

Query  3    DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  62   HQSSLIGEVMHHDSANFGWNVASEG----SAPTFNWKQLVSNVDAYIKSINFKYKVELRS  117
              ++ +G  +HHD  ++G+  A+ G        F+W +L +  DAY+  +N  Y+  L +
Sbjct  77   FIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRLNGIYERNLAN  136

Query  118  KYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDI  177
              V+      +F D   + +       K++  ++V+IAVGG+P     PG E  I SD  
Sbjct  137  SKVELIRGSAAFNDNGNVVV-----DGKEVRAKNVLIAVGGKPMIPDIPGKELCIDSDGF  191

Query  178  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYME  236
            F ++   P K  VVGA Y+A+E AG L  +G +  +  R   +LR FD  +   + + M+
Sbjct  192  FELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAMK  250

Query  237  VQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDK  296
             + G+   R +    +    +G   +     DG S    +D V+ A GR P  + L LDK
Sbjct  251  -KDGVHLQRHSNIARVNQAADGTKTLVLA--DG-SEHSGYDVVIYAAGRVPLTSTLKLDK  306

Query  297  AGVKLNEKSGRIWV-KNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQ  354
            AG+   +K+G I V K ++TS S + A+GDV   P LTPVAI AGR LS RL+     A+
Sbjct  307  AGIA-TDKNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMGGAK  365

Query  355  MDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL--SETRTSAE-  411
            + YE + T VF+    G  GL+EE +++++G+D+++VY + FV + + L      T+ E 
Sbjct  366  VSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLINEMDETTGEP  425

Query  412  ----SCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  467
                   +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + + IHPT 
Sbjct  426  KDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCMAIHPTA  484

Query  468  AESFTTL  474
             E   TL
Sbjct  485  GEELVTL  491

>PPTG_18033
Length=500

 Score = 244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 172/490 (35%), Positives = 260/490 (53%), Gaps = 42/490 (9%)

Query  3    DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  62   HQSSLIGEVMHHDSANFGWNVASE----GSAPTFNWKQLVSNVDAYIKSINFKYKVELRS  117
              ++ +   + HD  ++G+   +     G    F+W +L +  DAY+  +N  Y+  L +
Sbjct  77   FIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRLNGIYERNLAN  136

Query  118  KYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDI  177
              V+       F +   +E+       K++  ++V+IAVGG+P     PG E  I SD  
Sbjct  137  SKVELIRGSAKFNENGNVEV-----DGKELLAKNVLIAVGGKPLIPDIPGKELCIDSDGF  191

Query  178  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYME  236
            F ++   P K  VVGA Y+A+E AG L  +G +  +  R   +LR FD D+     E   
Sbjct  192  FELEIL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DIVRTTLEDAM  249

Query  237  VQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDK  296
            V+ G+     +    +    +G   V  T  DG S    +D V+ A GR P  + L LDK
Sbjct  250  VKDGVHLRPHSNVARVEQAADGTKTVVLT--DG-SEYNGYDVVMYAAGRVPLTSNLQLDK  306

Query  297  AGVKLNEKSGRIWVKN-EQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLY---NNST  352
            AGV  +E  G I V   ++TS S + A+GDV   P LTPVAI AGR LS RL+   NNS 
Sbjct  307  AGVTTDEH-GFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGLNNS-  364

Query  353  AQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL--------S  404
             ++ YE + T VF+    G  GL+E+ ++ ++G+D V+VY + FV + + L         
Sbjct  365  -KVSYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYGLINEVDESTG  423

Query  405  ETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  464
            E +   ++  +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     + + IH
Sbjct  424  EPKDKPKTA-MKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIH  481

Query  465  PTTAESFTTL  474
            PT  E   TL
Sbjct  482  PTAGEELVTL  491

>H257_09722
Length=518

 Score = 244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 170/481 (35%), Positives = 266/481 (55%), Gaps = 25/481 (5%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +V+GGGSGG++ ++ AAS+G  V V++  +   QG + GLGGTCVNVGC+PKK+M+ 
Sbjct  28   YDYIVLGGGSGGISSARRAASYGANVLVIE--RGREQGGA-GLGGTCVNVGCVPKKVMYN  84

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++   E++H   A + +    +    +F+W  + +  D+Y+  ++  Y+  L    +   
Sbjct  85   AAFHAEILHSAKA-YAFKGVQDVGFGSFDWATMKTKRDSYVARLHGIYERNLAKDNITLV  143

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
            +   SFVD HT+ +          T   +++AVGG P+  S PG EHAISSD  F + + 
Sbjct  144  SGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISSDGFFGL-ET  197

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  V+GA Y+A+E AG    +  E  V  R   +LR FD  + + + + M  +SG++
Sbjct  198  QPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-RSGVQ  256

Query  243  FIRKTVPQSITTLENGQLLVK--WTNEDGESCE----EAFDTVLNATGRDPDVAKLGLDK  296
            F+  +  QSI    +G L ++   T EDG S        FD ++ A GR P  +   ++ 
Sbjct  257  FVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSGF-MEH  315

Query  297  AGVKLNEKSGRIWVK-NEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-A  353
              +  NEK G I V   E TS   +YA+GDV +   ELTPVAI AGR L+ RL+     A
Sbjct  316  TTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFGGEPDA  374

Query  354  QMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESC  413
             + Y ++ T VF+    G  G +E D+  +FG  NV+VY ++FV L +S+       ++ 
Sbjct  375  CLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPENKPKTA  434

Query  414  YVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTT  473
             +K+IC   +++ VVG H  G  A E+ Q  G+A+K+G     + + V IHPT +E F T
Sbjct  435  -MKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPTASEEFVT  492

Query  474  L  474
            +
Sbjct  493  M  493

>PYAP_23435
Length=951

 Score = 253 bits (645),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 175/478 (37%), Positives = 262/478 (55%), Gaps = 23/478 (5%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD VVIGGGSGG+A ++ AA++G KV +++  +        GLGGTCVN GC+PKK+M  
Sbjct  471  YDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKKVMFN  527

Query  64   SSLIGEVMHHDSANFGWNVASEGSA---PTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            ++   E   H + N  +++ +   A     F+W  + +  DAYI  +N  Y+  + +  +
Sbjct  528  AAAHVE---HLARNGDYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNAGI  584

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180
                 + + V  + +E+       K  T + V++AVGG P   + PG EHAI SD  F +
Sbjct  585  DLVQGVATLVSSNQIEV-----DGKVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFFKL  639

Query  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQS  239
            +  +P K  VVGA Y+A+E AG    +  E  +  R   +LR FD  + + + E ME + 
Sbjct  640  ES-QPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-KH  697

Query  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299
            G+ F+R++  + I    +G+L +    +  +   E FD VL A GR+P    LGLDKAGV
Sbjct  698  GVNFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKAGV  757

Query  300  KLNEKSGRIWV-KNEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQMD  356
            KLN+  G I V   E TS   +YA+GD      ELTPVAI AGR L+ RL+ N   A + 
Sbjct  758  KLND-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACLH  816

Query  357  YEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVK  416
            Y ++ T VF+    G  G +E ++  +FG D V+VY + FV L  S+++     ++  +K
Sbjct  817  YHQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMADPENKGKTA-MK  875

Query  417  VICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            ++C    D+ VVG H  G  A E+ Q  G+AMK+  T     + V IHPT AE F T+
Sbjct  876  LVC-VGDDEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHPTAAEEFVTM  932

>PHYRA_71927
Length=485

 Score = 240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 165/495 (33%), Positives = 254/495 (51%), Gaps = 52/495 (11%)

Query  3    DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  11   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  61

Query  62   HQSSLIGEVMHHDSANFGWNVASEG----SAPTFNWKQLVSNVDAYIKSINFKYKVELRS  117
              ++ +   + HD  ++G+   + G        F+W +L +  DAY+  +N  Y+  L +
Sbjct  62   FIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  121

Query  118  KYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDI  177
              V+  +    F +   +E+       K++  ++V++AVGG+P     PG E  I SD  
Sbjct  122  SKVELIHGSAKFNEKGNVEV-----DGKELLAKNVLVAVGGKPLIPDIPGKELCIDSDGF  176

Query  178  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFD-------QDMAN  229
            F ++   P K  VVGA Y+A+E AG L  +G +  +  R   +LR FD       +D   
Sbjct  177  FELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAMA  235

Query  230  KIGEYMEVQSGIEFIRKTVPQSIT-TLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPD  288
            K G ++   S +  + +    + T  L +G            S    +D V+ A GR P 
Sbjct  236  KDGVHLRPHSNVTRVEQVADGTKTLVLADG------------SEHSGYDVVIYAAGRVPL  283

Query  289  VAKLGLDKAGVKLNEKSGRIWVKN-EQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRL  347
             + L LD A +   +K G I V   ++TS S + A+GDV   P LTPVAI AGR LS RL
Sbjct  284  TSNLQLDNADIA-TDKHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRL  342

Query  348  YNN-STAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSET  406
            +     A++ YE + T VF+    G  GL+EE ++ ++G+DN +VY + FV + + L   
Sbjct  343  FGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINE  402

Query  407  RTSA-------ESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVD  459
               A           +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     +
Sbjct  403  VDEATGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDN  461

Query  460  TVGIHPTTAESFTTL  474
             + IHPT  E   TL
Sbjct  462  CIAIHPTAGEELVTL  476

>SPRG_05609
Length=496

 Score = 241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 167/477 (35%), Positives = 258/477 (54%), Gaps = 22/477 (5%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +VIGGGSGG + ++ AA++G KV +++           G+GGTCVNVGC+PKK+M  
Sbjct  6    YDYIVIGGGSGGNSSARRAAAYGAKVLLIER---GHANDGAGMGGTCVNVGCVPKKIMFN  62

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++L  E++H   A    N+  +    +F+W  L    DAY+  +N  Y+  L +  +   
Sbjct  63   AALHAEMLHSAHAYTFKNI-QDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNQIPLV  121

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
                 FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD  F + + 
Sbjct  122  YGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-ET  175

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  VVGA Y+A+E AG    +  +  +  R + +LR FD  + + +   ME  +G+ 
Sbjct  176  QPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-HAGVH  234

Query  243  FIRKTVPQSITTLENGQLLVKWTNEDGESCEEA---FDTVLNATGRDPDVAKLGLDKAGV  299
            F+R++    IT++E         + DG    ++   F+TVL A GR P    LGL+   +
Sbjct  235  FVRES---GITSIEKAVDGYADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLETTDI  291

Query  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLY-NNSTAQMDY  357
             L+          E TS  N+YA+GDV     ELTPVAI AGR L+ RL+ N   A ++Y
Sbjct  292  ALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACINY  351

Query  358  EKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKV  417
             ++ T VF+    G  GL+E  +  ++G +NV+VY ++F  + +++SE +   +   +K+
Sbjct  352  HQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSE-QDDKQKTAMKL  410

Query  418  ICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            IC    ++ VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  411  IC-IGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  466

>PHYCA_504517
Length=493

 Score = 239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 168/476 (35%), Positives = 261/476 (55%), Gaps = 19/476 (4%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +VIGGGSGG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  64   SSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            ++   E ++ +  ++  N A  E     F+W  +    DAYIK +N  Y+  L +  V +
Sbjct  64   TAAHVEHLNRNK-DYSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNANVDH  122

Query  123  ENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKK  182
               +   V    +++     G K  T + V++A GG P     PG E+ I SD  F +++
Sbjct  123  VQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFFKLEQ  177

Query  183  KEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  241
             +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  242  EFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKL  301
            +F+R      +   +NG+L    T    E     FDT+L A GR+P    LGL++ GVKL
Sbjct  236  KFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLEEVGVKL  295

Query  302  NEKSGRIWVK-NEQTSTSNIYALGDV-IDAPELTPVAIQAGRLLSRRLY-NNSTAQMDYE  358
            +E  G I V   E TS   +YA+GD  +   ELTPVAI AGR LS RL+     A ++Y 
Sbjct  296  SE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI  418
            ++ T +F+    G  G +E ++ E++GE+NV+VY + FV L  S+++     ++  +K++
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTA-MKLV  413

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
                ++  VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  414  TVGEKET-VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PYIW_25301
Length=512

 Score = 239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 167/492 (34%), Positives = 255/492 (52%), Gaps = 50/492 (10%)

Query  4    YDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            YD +VIG GSGG+A S+ AA +   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  63   QSSLIGEVMHHDSANFGW---NVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
             ++ +  ++H D+ ++G+   +    G    F+W +L    DAYI  +N  Y+  L +  
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYILRLNDIYERNLGNSK  150

Query  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            V        F     +E+       K+I  ++++IAVGG+P     PG E  I SD  F 
Sbjct  151  VDLLTGTAVFNAHGNVEM-----DGKEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFFE  205

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQ-------DMANKI  231
            +++  P K  VVGA Y+A+E AG L G+G    +  R   +LR FD+       D   K 
Sbjct  206  LEQL-PKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAMAKD  264

Query  232  GEYMEVQSGIEFIRKTVPQSITT-LENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVA  290
            G  +  QS +  + +T     T  L+NG            S    FDTV+ A GR P  +
Sbjct  265  GIVVRPQSNVARVEQTADGKKTLFLQNG------------SEHAGFDTVIYAAGRVPLTS  312

Query  291  KLGLDKAGVKLNEKSGRIWVKNEQ-TSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYN  349
            +L L  AG+   +K G I V   Q TS SN++A+GDV     LTPVAI AGR LS RL+ 
Sbjct  313  ELNLSAAGIA-TDKHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFG  371

Query  350  N-STAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRT  408
              + A++ Y+ + T VF+    G  GL+E +++E+ G+  ++ Y + FV + + L     
Sbjct  372  GMADAKISYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVD  431

Query  409  SAESC------YVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  462
            +  +        +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V 
Sbjct  432  ADGAAKPKPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVA  490

Query  463  IHPTTAESFTTL  474
            IHPT  E   T+
Sbjct  491  IHPTAGEELVTM  502

>PPTG_09787
Length=493

 Score = 238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 262/476 (55%), Gaps = 19/476 (4%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +VIGGGSGG+A ++ AA+FG KV V++  +   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  64   SSLIGEVMHHDSANFGWNVASEG-SAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            ++   E ++ +  ++  N AS+      F+W  + +  DAYIK +N  Y+  L +  V +
Sbjct  64   TAAHVEHLNRNK-DYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  123  ENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKK  182
               +   V    +E+       +  T + V++A GG P     PG EH I SD  F +++
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFFKLEQ  177

Query  183  KEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  241
             +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  242  EFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKL  301
            +F+R +    +   ENG+L    T    E     FDT++ A GR+P    LGL++ GVKL
Sbjct  236  KFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLGLEEIGVKL  295

Query  302  NEKSGRIWVK-NEQTSTSNIYALGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQMDYE  358
            +E  G I V   E TS   +YA+GD  +   ELTPVAI AGR LS RL+     A ++Y 
Sbjct  296  SE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI  418
            ++ T +F+    G  G +E ++  ++GE+N++VY + FV L  S+++     ++  +K++
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTA-MKLV  413

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
                ++  VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  414  TVGEKET-VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>H310_14447
Length=501

 Score = 237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 161/476 (34%), Positives = 257/476 (54%), Gaps = 19/476 (4%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +V+GGGSGG++ +  A  +G KV V++  + +      G+GGTCVNVGC+PKK+M+ 
Sbjct  9    YDYIVVGGGSGGVSSASRAVEYGAKVLVIERGRVN---GGAGMGGTCVNVGCVPKKIMYN  65

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            + +  E++ H + ++ +         +F+W  + +  DAY+  ++  Y+  L  + + + 
Sbjct  66   AGVHAEIL-HSAKDYSFKDVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEENIDHV  124

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
                 FVD HT+E+   R      T   ++IAVGG P+  + PG EHA+SSD  F +   
Sbjct  125  IGAAVFVDDHTVEVNGQR-----YTAPHILIAVGGMPQMPNIPGIEHAVSSDGFFDL-PT  178

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + + + M  ++G+ 
Sbjct  179  QPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEM-AKAGVA  237

Query  243  FIRKTVPQSITTLENGQLLVKWTNEDGESCEE--AFDTVLNATGRDPDVAKLGLDKAGVK  300
            F+     +SI    +G L V    + GE+  E   FD +++A GR P    +GLDK  V+
Sbjct  238  FVTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDKTHVE  295

Query  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQMDYE  358
            L++    +    E T+   +YA+GDV     ELTPVAI AGR L+ RL+   T A + Y 
Sbjct  296  LSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNACIHYH  355

Query  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI  418
            ++ T VF+    G  GL+E D+  ++G DNV VY + F  + ++L+          +K++
Sbjct  356  QIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTAMKLV  415

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            C    +  V+G H  G  A E+ Q  G+A+KLG       + V IHPT AE   T+
Sbjct  416  CIGVEET-VIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIHPTAAEEMVTM  470

>PITG_14083
Length=493

 Score = 236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 167/477 (35%), Positives = 260/477 (55%), Gaps = 21/477 (4%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +VIGGGSGG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  64   SSLIGEVMHHDSANFGWNVASEG-SAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            ++   E ++ +  ++  N AS+      F+W  + +  DAYIK +N  Y+  L +  V +
Sbjct  64   AAAHVEHLNRNK-DYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  123  ENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKK  182
               +   V    +E+       +  T + V++A GG P     PG EH I SD  F +++
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFFKLEQ  177

Query  183  KEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  241
             +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  242  EFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKL  301
             F+R +    +   +NG+L    T +  E     FD+++ A GR P    LGL++ GVKL
Sbjct  236  NFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVGVKL  295

Query  302  NEKSGRIWV-KNEQTSTSNIYALGDV-IDAPELTPVAIQAGRLLSRRLY-NNSTAQMDYE  358
             E  G I V   E TS + +YA+GD  +   ELTPVAI AGR LS RL+     A ++Y 
Sbjct  296  AE-GGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSET-RTSAESCYVKV  417
            ++ T +F+    G  G +E ++  ++GE+NV+VY + FV L  S+++  R    +  +  
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAMKLVT  414

Query  418  ICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            + DK   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  VGDK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>CCA23647
Length=496

 Score = 235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 155/464 (33%), Positives = 241/464 (52%), Gaps = 19/464 (4%)

Query  20   KEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFG  79
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++   E +        
Sbjct  22   RRAATYGAKVLLIERHR---EYEGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  80   WNVASEG------SAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPH  133
               AS+G      S   F+W ++    DAYI+ +N  Y   L +  +     +   +   
Sbjct  79   RPFASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIAKD  138

Query  134  TLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGA  193
             +++            + ++IAVGG P   S PG EHAI SD  F ++  +P K  VVGA
Sbjct  139  RVQV----NQDSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKLET-QPKKVAVVGA  193

Query  194  SYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSI  252
             Y+A+E AG    +  +  +  R   +LR FD  + + + E ME ++G+ F+RK+  + I
Sbjct  194  GYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLEKI  252

Query  253  TTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKN  312
               E+ +L +     D       FD ++ A GR P    LGL+  GV+LNE    I    
Sbjct  253  VKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNETGHIIVDAQ  312

Query  313  EQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQMDYEKVCTAVFTPIEY  370
            E TS   +YALGDV     ELTPVAI AGR L+ RL+NN   A + Y ++ T VF+    
Sbjct  313  ENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHPPL  372

Query  371  GCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGF  430
            G  G +E ++  ++GE+NV+ Y + FV L +S++E     +   +K++C  +++  VVG 
Sbjct  373  GTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTCMKLVCVGSKET-VVGL  431

Query  431  HYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            H  G  A E+ Q  G+AMK+G T     + V IHPT +E   T+
Sbjct  432  HVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>CCI11048
Length=496

 Score = 234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 154/464 (33%), Positives = 241/464 (52%), Gaps = 19/464 (4%)

Query  20   KEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFG  79
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++   E +   S    
Sbjct  22   RRAATYGAKVLLIERHR---EYDGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  80   WNVASEGSAP------TFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPH  133
                S+  A        F+W ++ +  DAYI+ +N  Y   L +  +     +   +   
Sbjct  79   RPFTSKECASHSFSFGDFDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGIAKLIAKD  138

Query  134  TLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGA  193
             +++            + ++IAVGG P   S PG EHAI SD  F ++  +P K  VVGA
Sbjct  139  RVQVNQ----DSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLET-QPKKVAVVGA  193

Query  194  SYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSI  252
             Y+A+E AG    +  +  V  R   +LR FD  + + + E ME + G+ F+RK+  + I
Sbjct  194  GYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEME-KDGVNFVRKSHLEKI  252

Query  253  TTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKN  312
            T  ++ +L +     +       FD ++ A GR P    LGL++ GV LNE    I    
Sbjct  253  TKAKDDKLAITARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALNETGHIIVDAQ  312

Query  313  EQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQMDYEKVCTAVFTPIEY  370
            E TS   +YALGDV     ELTPVAI AGR L+ RL+NN   A + Y ++ T VF+    
Sbjct  313  ENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHPPL  372

Query  371  GCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGF  430
            G  G +E ++  ++GE+NV+ Y + FV L +S++E     +   +K++C  +++  VVG 
Sbjct  373  GTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTAMKLVCVGSKET-VVGL  431

Query  431  HYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            H  G  A E+ Q  G+AMK+G T     + V IHPT +E   T+
Sbjct  432  HVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PHYRA_72037
Length=493

 Score = 234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 253/476 (53%), Gaps = 19/476 (4%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  64   SSLIGEVMHHDSANFGWNVASEGSA-PTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            ++   E +H +  ++    A+   A   F+W  +    DAYI  +N  Y+  L +  V +
Sbjct  64   AAAHVEHLHRNE-DYSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNAKVDH  122

Query  123  ENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKK  182
               + + V    +E+       K  T + V++A GG P     PG EH   SD  F +++
Sbjct  123  VQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFFRLEQ  177

Query  183  KEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  241
             +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + + ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-KAGV  235

Query  242  EFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKL  301
            +F+R T    +   ++G+L    T +  E     FD +L A GR+P    LGL+K GVKL
Sbjct  236  KFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKVGVKL  295

Query  302  NEKSGRIWVK-NEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLY-NNSTAQMDYE  358
             +  G I V   E TS   +YA+GD      ELTPVAI AGR LS RL+     A ++Y 
Sbjct  296  AD-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI  418
            ++ T +F+    G  G +E ++  +FGE+NV+VY + FV L  S+++     ++    V 
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTAMKLVT  414

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
              +   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  VGE--QETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PHYSO_550665
Length=491

 Score = 233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 253/476 (53%), Gaps = 19/476 (4%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFEGMGLGGTCVNFGCVPKKVMFN  63

Query  64   SSLIGEVMHHDSANFGWNVASEG-SAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            ++   E +  +  ++  N A++      F+W  + +  DAYIK +N  Y+  L +  V +
Sbjct  64   AAAHVEHLARNK-DYSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAQVDH  122

Query  123  ENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKK  182
               +   V    +E+       K  T + V++A GG P     PG EH I SD  F + +
Sbjct  123  VQGIAKLVAKDKVEV-----AGKVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDGFFKL-E  176

Query  183  KEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  241
            ++P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME ++G+
Sbjct  177  QQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  242  EFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKL  301
            +F+R      +    +G+L    T    E     FD +L A GR+P    LGL++ GVKL
Sbjct  236  KFVRNMRAARVEKQADGKLTFVVTINGEEHKFPDFDAILYAVGREPRTKDLGLEEVGVKL  295

Query  302  NEKSGRIWV-KNEQTSTSNIYALGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQMDYE  358
            +E  G I V   E TS   +YA+GD  I   ELTPVAI AGR LS RL+     A ++Y 
Sbjct  296  SE-GGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI  418
            ++ T +F+    G  G +E ++  ++GE+NV+ Y + FV L  S+++     ++    V 
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMADPERKGKTAMKLVT  414

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
              +   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  VGE--QETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>H257_17037
Length=498

 Score = 232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/459 (32%), Positives = 242/459 (53%), Gaps = 15/459 (3%)

Query  19   SKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANF  78
            +  A  +G KV V++  + +      G+GGTCVNVGC+PKK+M+ +    E++H  + ++
Sbjct  23   ASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKKIMYNAGFHAEILH-SAKDY  78

Query  79   GWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTLELW  138
             +         +F+W  + +  DAY+  +   Y+  L  + + +     +FVD HT+E+ 
Sbjct  79   SFKEVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVEVN  138

Query  139  HHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVAL  198
              R      T   ++IAVGG P+  + PG EHAISSD  F +   +P K  VVGA Y+A+
Sbjct  139  GLR-----FTAPHILIAVGGVPQLPTIPGIEHAISSDGFFDLPT-QPKKVAVVGAGYIAV  192

Query  199  ECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLEN  257
            E AG    +  +  V  R   +LR FD  + + + + M  +SG+ F+ ++  QSI    +
Sbjct  193  ELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEM-AKSGVTFVTQSHLQSIRKEAD  251

Query  258  GQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNEQTST  317
            G L +  T  D  +    F+ +++A GR P    +GLDK  V+L+     +    E T+ 
Sbjct  252  GTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQENTTV  311

Query  318  SNIYALGDV-IDAPELTPVAIQAGRLLSRRLYNN-STAQMDYEKVCTAVFTPIEYGCCGL  375
              +YA+GD  I   ELTPVAI AGR L+ RL+ + + A + Y ++ T +F+    G  GL
Sbjct  312  PGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGTIGL  371

Query  376  SEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGP  435
            +E ++  ++G+ NV  Y ++F  L +SL +         +K++C    +  VVG H  G 
Sbjct  372  TEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTAMKLVCIGVEET-VVGAHVAGL  430

Query  436  NAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
             A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  431  GADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEEMVTM  469

>PHYCA_7619
Length=462

 Score = 229 bits (585),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 163/476 (34%), Positives = 245/476 (51%), Gaps = 40/476 (8%)

Query  16   LACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHD  74
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   +HHD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHD  51

Query  75   SANFGW----NVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFV  130
              ++G+         G    F+W +L +  DAY+  +N  Y+  L +  V        F 
Sbjct  52   FLHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFN  111

Query  131  DPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLV  190
                +E+       K+I   +V+IAVGG+P     PG E  I SD  F ++   P K  V
Sbjct  112  QNGNVEV-----DGKEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFELETL-PKKVAV  165

Query  191  VGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFI-RKTV  248
            VGA Y+A+E AG L  +G E  +  R   +LR FD  +   + + ME + G+       V
Sbjct  166  VGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAME-KDGVHLCPHSNV  224

Query  249  PQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRI  308
             +     +N + LV     DG S    ++ V+ A GR P    L LDKAGV   +  G I
Sbjct  225  VRVEQAADNTRTLVL---ADG-SEHSGYEVVIYAAGRVPLTTSLQLDKAGVT-TDNHGFI  279

Query  309  WVKN-EQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYEKVCTAVFT  366
             V   +QTS SN++A+GD    P LTPVAI AGR LS RL+     A++ YE + T VF+
Sbjct  280  QVDEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFS  339

Query  367  PIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL--------SETRTSAESCYVKVI  418
                G  GL+E  ++ ++G+D ++VY + FV + + L         E +   ++  +K++
Sbjct  340  HPPIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTA-MKLV  398

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            C   +D+ VVG H +G  A E+ Q  G+A+K+G T     D + IHPT  E   TL
Sbjct  399  C-AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>H310_11259
Length=519

 Score = 229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 165/480 (34%), Positives = 263/480 (55%), Gaps = 23/480 (5%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +V+GGGSGG+A ++ AAS+G KV V++  +        GLGGTCVNVGC+PKK+M+ 
Sbjct  29   YDYIVLGGGSGGIASARRAASYGAKVLVVERGR---TLGGAGLGGTCVNVGCVPKKVMYN  85

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++ + E+M H +  + +         +F+W  + S  DAY+  ++  Y+  L    +   
Sbjct  86   AAFLAEIM-HSAKTYTFKGVQGVEFGSFDWPAMKSKRDAYVTRLHGIYERNLAKDGISLV  144

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
            + + +FVD HT+ +     G K  T   +++AVGG P+  S PG E AISSD  F + + 
Sbjct  145  SGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIPGIELAISSDGFFAL-ET  198

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + + M  ++G+ 
Sbjct  199  QPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVRDHVNKEMR-RAGVA  257

Query  243  FIRKTVPQSITTLENGQLLVKWT--NEDGESCEEAF---DTVLNATGRDPDVAKLGLDKA  297
            F+ ++   SI    NG L ++ T   E+G +  + F   D V+ A GR P     G D+ 
Sbjct  258  FVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDCGFDRT  317

Query  298  GVKLNEKSGRIWVK-NEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQ  354
             +  + K G I V   E T+   +YA+GD      ELTPVAI AGR L+ RL+     A 
Sbjct  318  DIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGGEPDAC  376

Query  355  MDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCY  414
            ++Y ++ T VF+    G  G +E D+  ++G  NV+VY ++FV L ++L   +    S  
Sbjct  377  INYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPK-DMPSTA  435

Query  415  VKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            +KV+C   +++ VVG H  G  A E+ Q  G+A+K+G     + + + IHPT +E   T+
Sbjct  436  MKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHPTASEELVTM  494

>PITG_13427
Length=463

 Score = 227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 160/476 (34%), Positives = 250/476 (53%), Gaps = 39/476 (8%)

Query  16   LACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHD  74
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   + HD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHD  51

Query  75   SANFGWNVASE----GSAPTFNWKQLVSNVDAYIKSINFKY-KVELRSKYVKYENFLGSF  129
              ++G+   +     G    F+W +L +  DAY+  +N  Y +  L +  V+    L +F
Sbjct  52   LLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATF  111

Query  130  VDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTL  189
             +   +E+     G K++  ++V+IAVGG+P     PG E  I SD  F ++   P K  
Sbjct  112  NEKGNVEV-----GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFELETL-PKKVA  165

Query  190  VVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFIRKTV  248
            VVGA Y+A+E AG L  +G +  +  R   +LR FD D+     E    + G+     + 
Sbjct  166  VVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFD-DIVRTTLEDAMAKEGVHLRPHSN  224

Query  249  PQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRI  308
               +    +G   +  T  DG S    +D V+ A GR P  + L LDKAG+  +E  G I
Sbjct  225  VARVELGADGTKTLVLT--DG-SKYSGYDVVIYAAGRVPLTSNLQLDKAGITTDEH-GFI  280

Query  309  WVKN-EQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYEKVCTAVFT  366
             V   ++TS S + A+GDV   P LTPVAI AGR LS RL+   + A++ YE + T VF+
Sbjct  281  PVNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFS  340

Query  367  PIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL--------SETRTSAESCYVKVI  418
                G  GL+EE ++ ++G+D ++VY + FV + + L         E +   ++  +K++
Sbjct  341  HPPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTA-MKLV  399

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            C    +K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT  E   TL
Sbjct  400  CAGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTL  454

>PHALS_09136
Length=493

 Score = 226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 160/475 (34%), Positives = 250/475 (53%), Gaps = 17/475 (4%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +VIGGGSGG+A ++ AA+ G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            +++  E ++ +        A +     F+W  + +  DAYI+ +N  Y+  L +  V   
Sbjct  64   TAVHVEHLNRNKDYSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIYERNLSNAQVDVI  123

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
              +   V    +++  H       T + V++A GG P     PG EH I SD  F +++ 
Sbjct  124  QGIAKIVAKDKIQVAGH-----IYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFFKLEQ-  177

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME ++G+E
Sbjct  178  QPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-KAGVE  236

Query  243  FIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLN  302
            F+R      I    + +L    T    E     FDT+L A GR P    LGL++ GVKL 
Sbjct  237  FVRNMSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEIGVKLA  296

Query  303  EKSGRIWVK-NEQTSTSNIYALGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQMDYEK  359
            +  G I V   E T+   +YA+GDV +   ELTPVAI AGR L+ RL+     A ++Y +
Sbjct  297  D-GGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQ  355

Query  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVIC  419
            + T +F+    G  G +E ++  RFG++N+++Y + FV L  ++++     ++    V  
Sbjct  356  IPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMADPERKGKTAMKLVTV  415

Query  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
             +  ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHPT +E   T+
Sbjct  416  GE--EETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  468

>HYAP_08763
Length=473

 Score = 225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 151/463 (33%), Positives = 242/463 (52%), Gaps = 19/463 (4%)

Query  16   LACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHDS  75
            +A ++ AA++G KV V++  +   Q    GLGGTCVN GC+PKK+M  ++    V H + 
Sbjct  1    MASARRAATYGAKVLVIERGR---QYDGMGLGGTCVNFGCVPKKIMFNTA--AHVEHLNR  55

Query  76   ANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTL  135
            A       +E +   F+W ++ +  DAYI  +   Y+  L +  V +   +  FV  + +
Sbjct  56   AKDYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNKV  115

Query  136  ELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASY  195
            ++       +  T + V+IA GG P +   PG  H I SDD F +++ +P K  VVGA Y
Sbjct  116  QV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQ-QPQKVAVVGAGY  169

Query  196  VALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITT  254
            +A+E AG    +  +  +  R   +LR F+  + + + E ME ++G+ F+R      +  
Sbjct  170  IAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGVEK  228

Query  255  LENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNE  313
              +G+L +     + E     FDT+L A GR P    LGL+  GVKL E  G I V   E
Sbjct  229  QLDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKLAE-GGFIQVDAQE  287

Query  314  QTSTSNIYALGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQMDYEKVCTAVFTPIEYG  371
             TS   +YA+GD  +   ELTPVAI AGR L+ RL+     A ++Y ++ + +F+    G
Sbjct  288  NTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPPIG  347

Query  372  CCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFH  431
              G +E ++  ++GE+NV+VY + FV L  S+++     ++    V   +   + VVG H
Sbjct  348  TIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLVTVGE--QETVVGVH  405

Query  432  YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
              G  A E+ Q  G+A+K+  T     + V IHPT +E   T+
Sbjct  406  VAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>PHYKE_6836
Length=493

 Score = 221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 161/476 (34%), Positives = 257/476 (54%), Gaps = 19/476 (4%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD VVIGGGSGG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGR---KYDGMGLGGTCVNYGCVPKKVMFN  63

Query  64   SSLIGEVMHHDSANFGWNVASEG-SAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            +++  E +  +  ++  N A        F+W  + +  DAYI  +N  Y+  L+++ V +
Sbjct  64   TAMHVEHLARNR-DYSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNLQNQQVDH  122

Query  123  ENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKK  182
               +   V    +++       +  T +++++A GG P     PG EH I SD  F +++
Sbjct  123  VQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFFKLEQ  177

Query  183  KEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  241
             +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  242  EFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKL  301
            +F+R +    +    +G+L    T +  E     FDT+L A GR P    LGL++  VKL
Sbjct  236  KFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPDFDTILYAVGRTPRTKDLGLEEINVKL  295

Query  302  NEKSGRIWVK-NEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYN-NSTAQMDYE  358
            ++  G I V   E TS   +YA+GD      ELTPVAI AGR LS RL+     A ++Y 
Sbjct  296  SQ-DGFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI  418
            ++ T +F+    G CG +E ++ E+FG++N++ Y + FV L  S+++     ++     +
Sbjct  355  QIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKTAM--KL  412

Query  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
                 ++ VVG H  G  A E+ Q  G+AMK+  T     + V IHPT AE   T+
Sbjct  413  VCVGEEEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAAEELVTM  468

>PYVX_21517
Length=482

 Score = 207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 151/500 (30%), Positives = 248/500 (50%), Gaps = 78/500 (16%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  59
            + ++DL+VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK
Sbjct  25   AREFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPKK  75

Query  60   LMHQSSLIGEVMHHDSANFGWNVASE-----GSAPTFNWKQLVSNVDAYIKSINFKYKVE  114
            +M+  + +   +H D+ ++G+  A+      G+   F+W++L    DAY+  +N  Y+  
Sbjct  76   IMYTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYERN  135

Query  115  LRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCP----GGEH  170
            L +  V+       F     +E+        ++  + V++AVGG+P     P    G E 
Sbjct  136  LANSKVELLTGTARFNVDGKIEV-----DGVEVRAKKVLLAVGGKPLIPDIPVAATGKEL  190

Query  171  AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMAN  229
             I SD  F +++  P K  VVGA Y+A+E AG L  +G +  +  R   +LR FD   + 
Sbjct  191  CIDSDGFFELEQL-PRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWNS-  248

Query  230  KIGEYMEVQSGIEFIRKTVPQSI----------TTLENGQLLVKWTN----EDGESCEEA  275
               +++   S  E +R T+  ++          + +E  +L    T      DG S    
Sbjct  249  ---QFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLVLADG-STHTG  304

Query  276  FDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKN-EQTSTSNIYALGDVIDAPELTP  334
            F++V+ A GR P    LGLD AGV  +E+ G I V   +QT+  +I A+GD      LTP
Sbjct  305  FESVIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTIALTP  363

Query  335  VAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHT  394
            ++                    YE V T VF+    G  GL+E+ ++ +FG++ +++Y +
Sbjct  364  IS--------------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYKS  403

Query  395  NFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTY  454
             FV + + +            +++C    +K +VG H +G  A E+ Q  G+A+K+G T 
Sbjct  404  TFVNMYYGVVN----------ELVCAGPDEK-IVGLHVIGMGADEMLQGFGVAVKMGATK  452

Query  455  DQMVDTVGIHPTTAESFTTL  474
              +   V IHPT AE   T+
Sbjct  453  ADLDSCVAIHPTGAEELVTM  472

>HYAP_04843
Length=430

 Score = 203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 139/418 (33%), Positives = 216/418 (52%), Gaps = 26/418 (6%)

Query  71   MHHDSANFGWNV----ASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFL  126
            + HD  ++G+       S G+   F+W +L +  DAY++ +N  Y+  L S  V++    
Sbjct  5    LQHDVVHYGFEKEGTGGSLGAQMHFDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGS  64

Query  127  GSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPG  186
              F     +E+       K++  ++V+IAVGG+P     PG E  I SD  F +    P 
Sbjct  65   ARFNKQGNVEV-----DGKEVLAKNVMIAVGGKPMIPDIPGKELCIDSDGFFELDTL-PK  118

Query  187  KTLVVGASYVALECAGFLKGMGYEVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFIR  245
            K  V+GA Y+A+E AG L  +G E  +  R   +LR FD  +   + + M +  G+    
Sbjct  119  KVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVRTTLEDAMAID-GLHLRP  177

Query  246  KTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKS  305
             +    +    +G   +  T  DG S    FD V+ A GR P   KL LD AGV  N K 
Sbjct  178  NSNVARVEQAADGTNTLVLT--DG-SAHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KH  233

Query  306  GRIWVKN-EQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYEKVCTA  363
            G I V   ++TS S ++A+GDV   P LTPVA+ AGR LS RL+ N   A++ YE + T 
Sbjct  234  GYIVVNEFQETSNSKVFAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTV  293

Query  364  VFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSA-------ESCYVK  416
            VF+    G  GL+E+ ++ ++G+D+++VY ++FV + + L      A           +K
Sbjct  294  VFSHPPIGTIGLTEKQAQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIK  353

Query  417  VICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            ++C   ++K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT +E   TL
Sbjct  354  LVCAGKKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYIR_23431
Length=468

 Score = 194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 142/461 (31%), Positives = 224/461 (49%), Gaps = 46/461 (10%)

Query  20   KEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFG  79
            + AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  +S   E   H + N  
Sbjct  23   RRAATYGAKVLVVERGR---KYDGMGLGGTCVNYGCVPKKVMFNASAHVE---HLNRNAD  76

Query  80   WNVASEGSAP----TFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTL  135
            +++ + GS       F+W  + +  DAYI  +N  Y+  L +  V     +   V  + +
Sbjct  77   YSITTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQI  136

Query  136  ELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASY  195
            E+          T + +++AVGG+P   + PG EH I SD  F ++  +P K  VVGA Y
Sbjct  137  EV-----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEA-QPKKVAVVGAGY  190

Query  196  VALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITT  254
            +A+E AG    +  +  +  R   +LR FD  + + I E  E ++GI F+R +  + I  
Sbjct  191  IAIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDK  249

Query  255  LENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNEQ  314
              +G L +    +  E     FDT+L A GR+P    LGL++ GVKL +    +    E 
Sbjct  250  QADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQEN  309

Query  315  TSTSNIYALGDV-IDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCC  373
            TS   IYA+GD  I   ELTP+                          T VF+    G  
Sbjct  310  TSVPGIYAIGDATITGWELTPIP-------------------------TVVFSHPPLGTI  344

Query  374  GLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYL  433
            G +E  + E+FG +NV+VY + FV L +++++     ++  +K++     +  V   H  
Sbjct  345  GYTEPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTA-MKLVTVGEDEVVVG-VHVA  402

Query  434  GPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  403  GEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>PYAR_17714
Length=444

 Score = 192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 147/474 (31%), Positives = 235/474 (50%), Gaps = 58/474 (12%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +VIGGGSGG+A ++ AA  G KV +++  + +      GLGGTCVN GC+PKK+M  
Sbjct  7    YDYIVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPKKVMWN  63

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++   E +  + A++     +E     F+W  + +  DAYI  +N  Y+  + +  +   
Sbjct  64   AASHVEHLARN-ADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIGNAKIDLI  122

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
              + S      + +      T     + +++AVGG P     PG EHAI SDD F +K  
Sbjct  123  EGIASLTAKDAVTV---DGKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDSDDFFKLKT-  178

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIE  242
            +P K  VVGA Y+A+E AG    +  E  +  R   +LR FD  + + +   M+ + G+ 
Sbjct  179  QPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMD-KHGVH  237

Query  243  FIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLN  302
            F+R++   +I    +G+L V+ T +  ++    FD VL A GR+P    LGL+  GVKL+
Sbjct  238  FVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLESVGVKLS  297

Query  303  EKSGRIWV-KNEQTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360
            + +G I V K E TS   +YA+GD      ELTP                          
Sbjct  298  D-AGFIEVDKFENTSVDGVYAIGDATTTGYELTP--------------------------  330

Query  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420
                              ++ E+FG D+V+VY + FV L +++++    +++  +K++C 
Sbjct  331  -----------------PEAVEKFGADHVKVYTSTFVNLLYAMADPDHKSKTA-MKLVCV  372

Query  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
               ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  373  GENEQ-VVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEELVTM  425

>PYVX_16175
Length=446

 Score = 177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 141/462 (31%), Positives = 223/462 (48%), Gaps = 66/462 (14%)

Query  20   KEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFG  79
            + AAS G KV +++  + +      GLGGTCVN GC+PKK+M  ++    V H + A   
Sbjct  23   RRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPKKVMFNAA--AHVEHLNRAG-D  76

Query  80   WNVASEGSAP----TFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTL  135
            ++V + G        F+W  + +  DAYI  +N  Y+  L +  +     +   V  + L
Sbjct  77   YSVTTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKIDVVQGVARVVARNQL  136

Query  136  ELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASY  195
            E+       K  T +++++A GG P     PG EHAI SD  F +++ +P K  VVGA Y
Sbjct  137  EV-----DGKVYTGKNLLLAPGGVPTLPPIPGIEHAIDSDGFFKLEQ-QPRKVAVVGAGY  190

Query  196  VALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITT  254
            +A+E AG    +  E  +  R   +LR FD  + + +   ME ++G++F+R++    I  
Sbjct  191  IAVEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME-KNGVQFVRRSHITRIDK  249

Query  255  LENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNE  313
            LE+G+L +    +        FDTVL A GR+P  A LGL+  GV L++K G I V   E
Sbjct  250  LEDGKLQITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEAIGVDLDDK-GFIKVDAQE  308

Query  314  QTSTSNIYALGDVIDAP-ELTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGC  372
             TS + +YA+GD      ELTP                                      
Sbjct  309  NTSAAGVYAIGDATTTGWELTP--------------------------------------  330

Query  373  CGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHY  432
                  D+  ++G +NV+VY + FV L  ++++     ++  +K++    ++  VVG H 
Sbjct  331  -----PDAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKTA-MKLVTVGAQET-VVGVHV  383

Query  433  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
             G  A E+ Q  G+A+KLG T     + V IHPT +E   T+
Sbjct  384  AGEGADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELVTM  425

>PYIR_20273
Length=505

 Score = 159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 140/486 (29%), Positives = 219/486 (45%), Gaps = 40/486 (8%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  31   STEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKA  82

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            +  S+ +     HD A +G  V    S  + N+ +++ + +  +K++    +   +   V
Sbjct  83   LLHSTHLYHSAQHDFAKYGIEV----SEVSMNFGKMMKSKEKAVKTLTGGIEQLFKKNKV  138

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGR-----PKELSCPGGEHAISSD  175
             Y    G  V  + + +  +  G + +T ++++IA G       P  +    G+   S+ 
Sbjct  139  TYIKGHGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVPVDNAAGKIVDSTG  198

Query  176  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLR---GFDQDMANKIG  232
             +    KK P   +VVGA  + LE     K +G   KV V   L R   G D ++  +  
Sbjct  199  ALEL--KKVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELGKEFT  254

Query  233  EYMEVQS-GIEFIRKTVPQSIT----TLENGQLLVKWTNEDGESCEEAFDTVLNATGRDP  287
            + ++ Q  G EF  K     +     TL             G +     D VL ATGR P
Sbjct  255  KLLKKQGLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIECDAVLVATGRRP  314

Query  288  DVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRR  346
                LGL+  G++  +K GRI V +  +T   NI+A+GDVI  P L   A + G   +  
Sbjct  315  YTNGLGLENMGIQ-TDKFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACAET  373

Query  347  LYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSET  406
            +       ++Y  +   ++T  E    G +EE  KE         Y+    P+  + S  
Sbjct  374  IAGKH-GHVNYNAIPGVIYTFPEVASVGKTEEQLKEEG-----VTYNVGKFPM-LANSRA  426

Query  407  RTSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  465
            R   E+   VKVI DK  DK ++G H +  NAGE+     L M+ G + + +  T   HP
Sbjct  427  RAVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSEDIARTCHAHP  485

Query  466  TTAESF  471
            T +E+F
Sbjct  486  TLSEAF  491

>CCA22989
Length=494

 Score = 155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 142/483 (29%), Positives = 224/483 (46%), Gaps = 38/483 (8%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  59
            S +YDL+VIGGG GG   + +AA  G K VC+        +GT   LGGTC+NVGCIP K
Sbjct  24   STEYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPSK  74

Query  60   LMHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
             +  SS +     HD    G     E S    N+ +++   +  +K +    +   +   
Sbjct  75   ALLHSSHMFHTAQHDFKAIGI----EASDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNK  130

Query  120  VKYENFLGSFV--DPHTLELWHHRKGTKQITTRDVVIAVGGRPKEL-SCP--GGEHAISS  174
            V Y    G+ V  D  ++      KG + I  ++++IA G     L  CP    +  I  
Sbjct  131  VAYIKGHGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRIVD  190

Query  175  DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VRSILLRGFDQDMANKIGE  233
                 + K  P + +VVGA  + LE     + +G  V V+   + +  G D ++  +  +
Sbjct  191  STGALVLKSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREFAK  250

Query  234  YMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEA---FDTVLNATGRDPDVA  290
             ++ Q G +F   T    +T+ +  +  V  T ED +   E     D VL ATGR P   
Sbjct  251  TLQKQ-GFKFKFAT---KVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPFTQ  306

Query  291  KLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYN  349
             LGL+  G++  +K GRI V N  +T   NIYA+GDVI  P L   A + G + +  +  
Sbjct  307  NLGLENLGIQ-TDKLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEIML  364

Query  350  NSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTS  409
                 ++Y  +   ++T  E  C G +EE  KE     NV  +     P+  + S  R  
Sbjct  365  GKQGHVNYNAIPGVIYTFPEVACVGRTEEQLKEEGVSYNVGKF-----PM-IANSRARAV  418

Query  410  AES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  468
             E+  +VKV+  K  D+ ++G H +  NAGE+     L ++ G + + +  T   HPT +
Sbjct  419  GETDGFVKVLAQKDNDR-ILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTLS  477

Query  469  ESF  471
            E+ 
Sbjct  478  EAL  480

>CCI10477
Length=494

 Score = 154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 140/482 (29%), Positives = 224/482 (46%), Gaps = 36/482 (7%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  24   SSEYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKA  75

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            +  SS +     HD  + G  V    S    N+ +++   +  +K +    +   +   V
Sbjct  76   LLHSSHLFHTAQHDFKSIGIEV----SDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKV  131

Query  121  KYENFLGSFVDPH--TLELWHHRKGTKQITTRDVVIAVGGRPKEL-SCP--GGEHAISSD  175
             Y    G  V  +  ++ L    KG + IT ++++IA G     L  CP    +  I   
Sbjct  132  AYIKGHGKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKIVDS  191

Query  176  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VRSILLRGFDQDMANKIGEY  234
                + K  P + +VVGA  + LE     + +G  V V+   + +  G D ++  +  + 
Sbjct  192  TGALVLKSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAKT  251

Query  235  MEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAF---DTVLNATGRDPDVAK  291
            ++ Q G++F  K   +  +T  NG   V  T ED +   E     D VL ATGR P    
Sbjct  252  LQKQ-GLKF--KFATRVTSTKVNGD-NVTITMEDAKGGNETSMECDVVLVATGRRPFTNG  307

Query  292  LGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN  350
            LGL+  G++  +K GRI V +  +T+  +IYA+GDVI  P L   A + G + +  +   
Sbjct  308  LGLESMGIQ-TDKMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLG  365

Query  351  STAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSA  410
                ++Y  +   ++T  E  C G +EE  KE     NV  +     P+  + S  R   
Sbjct  366  KHGHVNYNAIPGVIYTHPEVACVGKTEEQLKEEGISYNVGKF-----PM-IANSRARAVG  419

Query  411  ES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  469
            E+  +VKV+  K  D+ ++G H +  NAGE+     L ++ G   + +  T   HPT +E
Sbjct  420  ETDGFVKVLAQKDNDR-ILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTLSE  478

Query  470  SF  471
            + 
Sbjct  479  AL  480

>PYAP_22645
Length=1565

 Score = 157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 141/480 (29%), Positives = 227/480 (47%), Gaps = 34/480 (7%)

Query  1     SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
             S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  1097  SSEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKA  1148

Query  61    MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
             +  ++ +     HD + +G  V    S    N+  ++ + +  +K++    +   +   V
Sbjct  1149  LLHATHMYHAAQHDFSKYGIEV----SDVKMNFDGMMKSKEKAVKTLTGGIEGLFKKNKV  1204

Query  121   KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGR-----PKELSCPGGEHAISSD  175
              Y    G  V  + + +  +  G + +  ++++IA G       P  +    G+   S+ 
Sbjct  1205  TYVKGFGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDNAAGKIVDSTG  1264

Query  176   DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VRSILLRGFDQDMANKIGEY  234
              +    KK P   +V+G   + LE     K +G +V V+     +  G DQ++  +  + 
Sbjct  1265  ALEL--KKVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKEFTKL  1322

Query  235   MEVQSGIEFIRKT-VPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLG  293
             ++ Q G++F   T V  S    +   L V+       S  EA DTVL ATGR P    LG
Sbjct  1323  LKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVATGRRPFTKGLG  1380

Query  294   LDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNST  352
             L++ G++  +K GRI V N  +T   NI+A+GDVI  P L   A + G      +     
Sbjct  1381  LEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVENIAGLH-  1438

Query  353   AQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAES  412
               ++Y+ +   ++T  E    G +EE  K    E+ V  Y+    P+  + S  R  AES
Sbjct  1439  GHVNYDAIPGVIYTYPEVASVGKTEEQLK----EEGV-AYNVGKFPM-MANSRARAVAES  1492

Query  413   -CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
               +VKVI DKT D+ ++G H +  NAGE+     L M+ G   + +  T   HPT +E+F
Sbjct  1493  DGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHPTLSEAF  1551

>HYAP_12621
Length=501

 Score = 144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 135/483 (28%), Positives = 220/483 (46%), Gaps = 43/483 (9%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  63   QSSLIGEVMHHDSANFGWNVASEGSAP--TFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
             S+ +     H+  ++G +      AP  T N+ Q++   +  ++++    +       V
Sbjct  86   HSTHLLHTAQHEFKSYGID------APNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKV  139

Query  121  KYENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGR-----PKELSCPGGEHAISS  174
             Y   +G       + +    R+G   +T +++++A G       P  +    G+   S+
Sbjct  140  TYIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDST  199

Query  175  DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VRSILLRGFDQDMANKIGE  233
              +   +   P   +VVGA  + LE     K +G +V V+        G D+    +  +
Sbjct  200  GALALTRV--PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLK  257

Query  234  YMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNED---GESCEEAFDTVLNATGRDPDVA  290
             ++ Q G+EF   T    +T  E    +V  T E    G+      DTVL ATGR    A
Sbjct  258  LLKKQ-GLEFQFGT---KVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTA  313

Query  291  KLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYN  349
             LGL++ G++  +K GRI V +  QT    ++A+GDVI    L   A + G      +  
Sbjct  314  GLGLEQMGIQ-TDKQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAG  372

Query  350  NSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTS  409
                 ++Y  +   ++T  E+   G +EE+ K    E NV  +     P+  + S  RT 
Sbjct  373  KH-GHVNYGAIPNVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PM-MANSRARTV  425

Query  410  AES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  468
            AE+   VKV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +
Sbjct  426  AEADGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLS  484

Query  469  ESF  471
            E+F
Sbjct  485  EAF  487

>SPRG_19943
Length=343

 Score = 135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 135/257 (53%), Gaps = 17/257 (7%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD +V+G GSGG++ +  A ++G KV V++           GLGGTCVNVGC+PKK+M  
Sbjct  21   YDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTCVNVGCVPKKIMFN  77

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            ++L  E++H   A + +    +     F+W  + +  DAY+K +N  Y   +    V   
Sbjct  78   AALHAEMLHSARA-YAFKGVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDLV  136

Query  124  NFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKK  183
                 FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD  F + + 
Sbjct  137  MGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-ET  190

Query  184  EPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFDQDMANKIGEYME------  236
            +P K  VVGA Y+A+E AG    +  +  +  R + +LR FD  + + +   ME      
Sbjct  191  QPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEMEHAGKEK  250

Query  237  VQSGIEFIRKTVPQSIT  253
            VQ+ ++ +   V +++ 
Sbjct  251  VQTAMKLVCIGVEETVV  267

 Score = 40.4 bits (93),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (2%)

Query  415  VKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  255  MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  313

>PYU1_G014259
Length=244

 Score = 130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 121/218 (56%), Gaps = 19/218 (9%)

Query  3    DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  34   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGGTCVNVGCVPKKIM  84

Query  62   HQSSLIGEVMHHDSANFGWNVASE---GSAPTFNWKQLVSNVDAYIKSINFKYKVELRSK  118
            + ++ +  ++H D+ ++G+        G   +F+W +L    DAY+  +N  Y+  L + 
Sbjct  85   YLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAYVLRLNGIYERNLANS  144

Query  119  YVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIF  178
             V       +F     +E+       K++  ++++IAVGG+P     PG EH I SD  F
Sbjct  145  KVDLLQGTAAFNAQGNVEV-----DGKEVKAKNILIAVGGKPLIPDIPGKEHCIDSDGFF  199

Query  179  WMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR  216
             ++   P K  VVGA Y+A+E AG L G+G +  +  R
Sbjct  200  ELEVL-PKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>PYVX_21248
Length=502

 Score = 132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 129/441 (29%), Positives = 207/441 (47%), Gaps = 37/441 (8%)

Query  46   LGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFGWNVASEGSAPTFNW-----KQLVSNV  100
            LGGTC+NVGCIP K +  S+ +     HD A +G  V  EG            ++ V+ +
Sbjct  70   LGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEV--EGVKANLGGMMKAKEKAVTTL  127

Query  101  DAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGR  159
               I+S+  K KV     Y+K     G  V  + + +  +  KG + +T ++++IA G  
Sbjct  128  TGGIESLFKKNKV----TYIKGH---GKIVGKNEVAVALNDDKGNQTVTAKNIMIATGSE  180

Query  160  PKEL---SCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR  216
            P  L        +  I          K P   +VVGA  + LE     K +G   KV V 
Sbjct  181  PAPLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KVTVV  238

Query  217  SILLR---GFDQDMANKIGEYMEVQSGIEFIRKT-VPQSITTLENGQLLVKWTNEDGESC  272
              L R   G D +++ +  + ++ Q G+EF   T V  S    +N  L V+ +   G + 
Sbjct  239  EFLDRACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVEPS-AGGSAA  296

Query  273  EEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPE  331
                DTVL ATGR P    LGL++ G++  +K GR+ V +  +T   NIYA GDVI    
Sbjct  297  SIECDTVLVATGRRPFTEGLGLEQMGIQ-TDKQGRVEVDSHFRTQIPNIYAFGDVIKGAM  355

Query  332  LTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEV  391
            L   A + G +    + +     ++Y+ +   ++T  E    G +EE+ K     +    
Sbjct  356  LAHKAEEEG-VACAEIISGKHGHVNYDAIPGVIYTTPEVASVGKTEEELK-----NEGVT  409

Query  392  YHTNFVPLEWSLSETRTSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKL  450
            Y+    P+  + S  RT AE+  +VK++ DK  D+ ++G H +  NAGE+     L ++ 
Sbjct  410  YNVGKFPM-MANSRARTIAEADGFVKILADKATDR-ILGVHIIAGNAGEMVAEGVLGLEY  467

Query  451  GFTYDQMVDTVGIHPTTAESF  471
            G + + +  T   HPT +E+F
Sbjct  468  GASSEDIARTCHAHPTLSEAF  488

>PHALS_09942
Length=496

 Score = 128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 125/440 (28%), Positives = 200/440 (45%), Gaps = 35/440 (8%)

Query  46   LGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFGWNVASEGSAP--TFNWKQLVSNVDAY  103
            LGGTC+NVGCIP K +  S+ +     H+  N+G +      AP  T N+ Q++   D  
Sbjct  64   LGGTCLNVGCIPSKALLHSTHLLHTAQHEFKNYGID------APEVTANFPQMMKAKDKA  117

Query  104  IKSINFKYKVELRSKYVKYENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGR---  159
            +K++    +   +   V Y    G       + +  H  KG + +  ++++IA G     
Sbjct  118  VKTLTSGIESLFKKNKVTYIKGSGKISAQGEVSVALHDHKGNETVKAKNIIIATGSEVTP  177

Query  160  --PKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VR  216
              P  +    G+   S+  +    K+ P   +VVGA  + LE     K +G +V V+   
Sbjct  178  LPPVPVDNAAGKIVDSTGALEL--KRIPDHLVVVGAGVIGLELGSVYKRLGAKVTVVEYL  235

Query  217  SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAF  276
                 G D+       + ++ Q G+EF   T    +T  E    +VK T E  +  + A 
Sbjct  236  DDACTGMDKGSVKDFIKLLKKQ-GLEFKFGT---KVTASEINGDVVKLTTEPSQGGDAAS  291

Query  277  ---DTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPEL  332
               DTVL ATGR    A LGL++ G++  +K GRI V    +T    I+A+GDVI    L
Sbjct  292  IECDTVLVATGRRAFTAGLGLEQMGIQ-TDKFGRIEVDEAFRTQVPGIFAIGDVIKGAML  350

Query  333  TPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVY  392
               A + G +    +       ++Y  +   ++T  E+   G +EE+ K    E NV  +
Sbjct  351  AHKAEEEG-IACAEIIAGKHGHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF  409

Query  393  HTNFVPLEWSLSETRTSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  451
                 P+  + S  RT  ES   VKV+ DK  DK  +G H +  NAGE+     + ++ G
Sbjct  410  -----PM-MANSRARTVGESDGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYG  462

Query  452  FTYDQMVDTVGIHPTTAESF  471
               + +  T   HPT +E+F
Sbjct  463  AASEDVARTSHAHPTLSEAF  482

>PHYSO_556052
Length=500

 Score = 128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 141/480 (29%), Positives = 224/480 (47%), Gaps = 37/480 (8%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  33   DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  84

Query  63   QSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
             S+ +     HD  ++G + A E  A   N+ Q++   +  +K++    +   +   V Y
Sbjct  85   HSTHLLHTAQHDFKSYGID-APEVKA---NFPQMMKAKEKAVKTLTGGIESLFKKNKVTY  140

Query  123  ENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGRPKEL-SCPGGEHA---ISSDDI  177
                G       + +  +  KG + +  ++++IA G     L   P    A   I S   
Sbjct  141  IKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKIIDSTGA  200

Query  178  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VRSILLRGFDQDMANKIGEYME  236
              +K+  P   +VVGA  + LE     K +G +V V+  +     G D++   +  + ++
Sbjct  201  LSLKRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKLLK  259

Query  237  VQSGIEFIRKTVPQSITTLENGQLLVKWTNED---GESCEEAFDTVLNATGRDPDVAKLG  293
             Q G+EF   T    +T  E    +VK T E    G++     DTVL ATGR    A LG
Sbjct  260  KQ-GLEFQFGT---KVTASEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLG  315

Query  294  LDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNST  352
            L++ G++  +K GRI V +  +T    I+A+GDVI    L   A + G      +     
Sbjct  316  LEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENIAGKH-  373

Query  353  AQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAES  412
              ++Y  +   ++T  E+   G +EE+ K    E NV  +     P+  + S  RT AES
Sbjct  374  GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PM-MANSRARTVAES  427

Query  413  -CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
               VKV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  428  DGLVKVLADKKTDKL-LGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  486

>SPRG_09825
Length=492

 Score = 127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 141/489 (29%), Positives = 225/489 (46%), Gaps = 55/489 (11%)

Query  3    DYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            DYDLVV+GGG GG   + +AA  G K  CV        +GT   LGGTC+NVGCIP K +
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACV------ESRGT---LGGTCLNVGCIPSKAL  75

Query  62   HQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121
              ++       HD  N G  V         ++ +L+++ D  +K +    +   +   V 
Sbjct  76   LSATHKYHAAQHDFKNVGIEV----DGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKVD  131

Query  122  YENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKEL-SCPGGEHA---ISSDDI  177
            Y    G  V  + + +  +  G K ++T++++IA G     L   P    A   I S   
Sbjct  132  YIKGFGKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTGA  191

Query  178  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEV  237
              +K+  P   +V+G   + LE       +G ++ V+           + A+KI   M+ 
Sbjct  192  LSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDF  239

Query  238  QSGIEFIRKTVPQSITTLENGQLL---------VKWTNE---DGESCEEAFDTVLNATGR  285
            ++G EF +K + +     + GQ +         V  T E    GE+     DTVL ATGR
Sbjct  240  ETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGR  298

Query  286  DPDVAKLGLDKAGVKLNEKSGRIWV--KNEQTSTSNIYALGDVIDAPELTPVAIQAGRLL  343
             P    LGL++ G++  +K GRI V   N +T+  NI+A+GD I+   L   A + G   
Sbjct  299  RPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISC  357

Query  344  SRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL  403
               +       ++Y  +   V+T  E    G +EE+ K      NV  Y+    P+  + 
Sbjct  358  VESIAGGH-GHVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGKFPM-MAN  410

Query  404  SETRTSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  462
            S  RT  E+  +VK++  K  DK ++G H +  NAGE+     L ++ G + + +  T  
Sbjct  411  SRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCH  469

Query  463  IHPTTAESF  471
             HPT +E+F
Sbjct  470  AHPTLSEAF  478

>PHYKE_9680
Length=498

 Score = 126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 121/440 (28%), Positives = 206/440 (47%), Gaps = 35/440 (8%)

Query  46   LGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFGWNVASEGSAPTF--NWKQLVSNVDAY  103
            LGGTC+NVGCIP K +  S+ +     HD  ++G +      AP    N+ Q++   +  
Sbjct  66   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGID------APGVKANFPQMMKAKEKA  119

Query  104  IKSINFKYKVELRSKYVKYENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGR---  159
            +K++    ++  +   V Y    G       + +     KG + +  ++++IA G     
Sbjct  120  VKTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTP  179

Query  160  --PKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VR  216
              P  +    G+   S+  +    K+ P   +VVGA  + LE     K +G +V V+  +
Sbjct  180  LPPVPVDNEAGKIIDSTGALVL--KRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQ  237

Query  217  SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAF  276
                 G D++   +  + ++ Q G++F   T    +T  E    +VK T E  +  +EA 
Sbjct  238  DAACPGMDKECVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEAS  293

Query  277  ---DTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPEL  332
               DTVL ATGR    A LGL++ G++  +K GR+ V +  +T    I+A+GDVI    L
Sbjct  294  IECDTVLVATGRRAYTAGLGLEQMGIQ-TDKLGRVEVDDAFRTQVPGIFAIGDVIKGAML  352

Query  333  TPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVY  392
               A + G      +       ++Y  +   ++T  E+   G +EE+ K    E NV  +
Sbjct  353  AHKAEEEGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF  411

Query  393  HTNFVPLEWSLSETRTSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  451
                 P+  + S  RT AE+   VKV+ DK  DK ++G H +  NAGE+     +A++ G
Sbjct  412  -----PM-MANSRARTVAEADGLVKVLSDKKTDK-MLGVHIIASNAGEMIAEGVIALEYG  464

Query  452  FTYDQMVDTVGIHPTTAESF  471
             + + +  T   HPT +E+ 
Sbjct  465  ASSEDIARTCHAHPTLSEAL  484

>PHYRA_72215
Length=499

 Score = 124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 141/485 (29%), Positives = 226/485 (47%), Gaps = 43/485 (9%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  59
            S DYD+VVIGGG GG   + +AA  G K  CV    K         LGGTC+NVGCIP K
Sbjct  30   SSDYDVVVIGGGPGGYVAAIKAAQLGFKTACVESRGK---------LGGTCLNVGCIPSK  80

Query  60   LMHQSSLIGEVMHHDSANFGWNVASEGSAP--TFNWKQLVSNVDAYIKSINFKYKVELRS  117
             +  S+ +     HD  ++G +      AP  T N+ Q++   +  + ++    +   + 
Sbjct  81   ALLHSTHLLHTAQHDFKSYGID------APGVTANFPQMMKAKEKAVTTLTGGIESLFKK  134

Query  118  KYVKYENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHA----I  172
              V Y    G       + +  +  KG + +  ++++IA G     L     ++A    I
Sbjct  135  NKVTYIKGYGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKII  194

Query  173  SSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VRSILLRGFDQDMANKI  231
             S     + +  P   +VVGA  + LE     K +G +V V+  +     G D++   + 
Sbjct  195  DSTGALALTRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKEAVKEF  253

Query  232  GEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAF---DTVLNATGRDPD  288
             + ++ Q G++F   T    +T  E    +VK T E  +    A    DTVL ATGR   
Sbjct  254  TKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGNAATIECDTVLVATGRRAF  309

Query  289  VAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRL  347
             A LGL++ G++  +K GRI V +  +T    I+A+GDVI    L   A + G      +
Sbjct  310  TAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENI  368

Query  348  YNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETR  407
                   ++Y  +   ++T  E+   G +EE+ K    E NV  +     P+  + S  R
Sbjct  369  AGKH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PM-MANSRAR  421

Query  408  TSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPT  466
            T AE+   VKV+ DK  DK ++G H +  NAGE+     +A++ G + + +  T   HPT
Sbjct  422  TVAEADGLVKVLADKKTDK-MLGVHIIASNAGEMISEGVIALEYGASSEDIARTCHAHPT  480

Query  467  TAESF  471
             +E+F
Sbjct  481  LSEAF  485

>SDRG_06945
Length=492

 Score = 124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 138/489 (28%), Positives = 223/489 (46%), Gaps = 55/489 (11%)

Query  3    DYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            DYDLVV+GGG GG   + +AA  G K  CV        +GT   LGGTC+NVGCIP K +
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACV------ESRGT---LGGTCLNVGCIPSKAL  75

Query  62   HQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121
              ++       HD  N G  V         ++ +L+++ D  +K +    +   +   + 
Sbjct  76   LSATHKYHAAQHDFKNVGIEV----DGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKID  131

Query  122  YENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKEL-SCPGGEHA---ISSDDI  177
            Y    G  V  + + +  +  G K ++T++++IA G     L   P    A   I S   
Sbjct  132  YIKGFGKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTGA  191

Query  178  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEV  237
              +K+  P   +V+G   + LE       +G ++ V+           + A+KI   M+ 
Sbjct  192  LSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDF  239

Query  238  QSGIEFIRKTVPQSITTLENGQLL---------VKWTNE---DGESCEEAFDTVLNATGR  285
            ++G EF +K + +     + GQ +         V  T E    GE+     DTVL ATGR
Sbjct  240  ETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGR  298

Query  286  DPDVAKLGLDKAGVKLNEKSGRIWV--KNEQTSTSNIYALGDVIDAPELTPVAIQAGRLL  343
             P    LGL++ G++  +K GRI V   N +T+  NI+A+GD I+   L   A + G   
Sbjct  299  RPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISC  357

Query  344  SRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL  403
               +       ++Y  +   V+T  E    G +EE+ K          Y+    P+  + 
Sbjct  358  VESIAGGH-GHVNYNAIPGVVYTFPEVASVGKTEEELKAAG-----VAYNVGKFPM-MAN  410

Query  404  SETRTSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  462
            S  RT  E+  +VK++  K  DK ++G H +  NAGE+     L ++ G + + +  T  
Sbjct  411  SRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCH  469

Query  463  IHPTTAESF  471
             HPT +E+F
Sbjct  470  AHPTLSEAF  478

>PITG_15359
Length=496

 Score = 124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 138/482 (29%), Positives = 226/482 (47%), Gaps = 37/482 (8%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  27   SSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKA  78

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            +  S+ +     HD  ++G + A E  A   N+ Q++ + +  +K++    +   +   V
Sbjct  79   LLHSTHLLHTAQHDFKSYGID-APEVKA---NFPQMMKSKEKAVKTLTGGIESLFKKNKV  134

Query  121  KYENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHA----ISSD  175
             Y    G       + +  +  KG + +  ++++IA G     L     ++A    I S 
Sbjct  135  TYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDST  194

Query  176  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VRSILLRGFDQDMANKIGEY  234
                +K+  P   +VVGA  + LE     K +G +V V+        G D++   +  + 
Sbjct  195  GALELKRV-PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEFTKL  253

Query  235  MEVQSGIEFIRKTVPQSITTLENGQLLVKWTNED---GESCEEAFDTVLNATGRDPDVAK  291
            ++ Q G++F   T    +T  E    +VK T E    G++     DTVL ATGR    + 
Sbjct  254  LKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTSG  309

Query  292  LGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN  350
            LGL++ G++  +K GRI V +  +T    I+A+GDVI    L   A + G      +   
Sbjct  310  LGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGK  368

Query  351  STAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSA  410
                ++Y  +   ++T  E+   G +EE+ K    E NV  +     P+  + S  RT A
Sbjct  369  H-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PM-MANSRARTIA  421

Query  411  ES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  469
            E+   VKV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +E
Sbjct  422  EADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSE  480

Query  470  SF  471
            +F
Sbjct  481  AF  482

>PHYCA_123621
Length=495

 Score = 120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 136/480 (28%), Positives = 221/480 (46%), Gaps = 37/480 (8%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  28   DYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALL  79

Query  63   QSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
             S+ +     HD  ++G + A E  A   N+ Q++   +  + ++    +   +   V Y
Sbjct  80   HSTHLLHTAQHDFKSYGID-APEVKA---NFPQMMKAKEKAVTTLTGGIESLFKKNKVTY  135

Query  123  ENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHA----ISSDDI  177
                G       + +  +  KG + +  ++++IA G     L     ++A    I S   
Sbjct  136  IKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGA  195

Query  178  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM-VRSILLRGFDQDMANKIGEYME  236
              + +  P   +VVGA  + LE     K +G +V V+        G D+    +  + ++
Sbjct  196  LSLTRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEFTKLLK  254

Query  237  VQSGIEFIRKTVPQSITTLENGQLLVKWTNED---GESCEEAFDTVLNATGRDPDVAKLG  293
             Q G++F   T    +T  E    +VK T E    G++     DTVL ATGR    A LG
Sbjct  255  KQ-GLDFKFST---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTAGLG  310

Query  294  LDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNST  352
            L++ G++  +K GRI V +  +T    I+A+GDVI    L   A + G      +     
Sbjct  311  LEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-  368

Query  353  AQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAES  412
              ++Y  +   ++T  E+   G +EE+ K    E NV  +     P+  + S  RT AE+
Sbjct  369  GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PM-MANSRARTVAEA  422

Query  413  -CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
               VKV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  423  DGLVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  481

>PYAR_20075
Length=469

 Score = 117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 128/482 (27%), Positives = 207/482 (43%), Gaps = 69/482 (14%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            +YDLVV+GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  30   EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  81

Query  63   QSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
             S+ +     HD   +G  V    S    ++  ++ + +  +K++    +   +   V Y
Sbjct  82   HSTHLFHTAQHDFKKYGIEV----SDVQMDFGGMMKSKEKAVKTLTAGIESLFKKNKVTY  137

Query  123  ENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKK  182
                G                 K +   +V +A+          G E  + S     +KK
Sbjct  138  IKGFG-----------------KIVAANEVAVALNDN------NGNETIVDSTGALALKK  174

Query  183  KEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSGIE  242
              P   +V+G   + LE     K +G +V V+           + A+++   ++++ G E
Sbjct  175  A-PEHLVVIGGGVIGLELGSVYKRLGSKVTVV-----------EYADRVCPGLDLELGKE  222

Query  243  FIRKTVPQSITTLENGQLLVKWTNED-----------GESCEEAFDTVLNATGRDPDVAK  291
            F +    Q +      ++     N D           GE+     DTVL ATGR P    
Sbjct  223  FAKLLKKQGLDLQFKTKVTASQVNGDKVTLTVEPAAGGEATTIEADTVLVATGRRPFTNG  282

Query  292  LGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN  350
            LGL++ G++  +K GRI V    +T   +IYA+GDVI  P L   A + G      +   
Sbjct  283  LGLEQMGIQ-TDKMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIA-G  340

Query  351  STAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSA  410
                ++Y  +   ++T  E    G +EE  KE     NV  +     P+  + S  R   
Sbjct  341  LHGHVNYNAIPGVIYTHPEVASVGKTEEQLKEEGIAYNVGKF-----PM-MANSRARAVG  394

Query  411  ES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  469
            E   +VKV+ DKT DK ++G H +  NAGE+     L ++ G   + +  T   HPT +E
Sbjct  395  EGDGFVKVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHPTLSE  453

Query  470  SF  471
            +F
Sbjct  454  AF  455

>H310_02523
Length=494

 Score = 110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 116/445 (26%), Positives = 198/445 (44%), Gaps = 45/445 (10%)

Query  46   LGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIK  105
            LGGTC+NVGCIP K +   + +     HD  + G  V +     + ++ QL+ + +  +K
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHAAQHDFKSVGIKVDN----VSIDFNQLMKSKEKTVK  117

Query  106  SINFKYKVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGR-----P  160
             +    +   +   V Y    G  V    L +  +  G + + T++++IA G       P
Sbjct  118  ILTGGIEGLFKKNKVDYVKGFGKIVAKGQLSVALNGGGNQTLHTKNILIATGSEVTPLPP  177

Query  161  KELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILL  220
              +   GG+   S+  +    K+ P   +VVG   + LE       +G ++ V+      
Sbjct  178  VPVDNEGGKIVDSTGALSL--KRIPNHLVVVGGGVIGLEMGSVYGRLGSKITVV------  229

Query  221  RGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNED-----------G  269
                 + A+KI   M+ +   EF +    Q +T     ++     + D           G
Sbjct  230  -----EYADKICPTMDHELTKEFQKLLTKQGMTFKLGQKVTASKVDGDTVTLTVEPAAGG  284

Query  270  ESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVK--NEQTSTSNIYALGDVI  327
            ++     D VL ATGR P  A LGL+  G++  ++ GRI V   N QT+   IYA+GDVI
Sbjct  285  DATTIEADCVLVATGRRPYTAGLGLEDMGIQ-TDRFGRIKVNLSNFQTNVDGIYAIGDVI  343

Query  328  DAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGED  387
            +   L   A + G  +   +       ++Y+ +   ++T  E    G +EE+ K      
Sbjct  344  EGAMLAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEEELKAA----  398

Query  388  NVEVYHTNFVPLEWSLSETRTSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGL  446
            NV  Y+    P+  + S  R   E+  +VKV+  K  DK ++G H +  NAGE+     L
Sbjct  399  NV-AYNVGKFPM-MANSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEGVL  455

Query  447  AMKLGFTYDQMVDTVGIHPTTAESF  471
             ++ G + + +  T   HPT +E+F
Sbjct  456  GIEYGASAEDIGRTCHAHPTLSEAF  480

>CCA16670
Length=520

 Score = 109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 121/487 (25%), Positives = 209/487 (43%), Gaps = 45/487 (9%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDL+VIG G     C+ +AA  GK V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKS-INFKYKVELRSKYVKY  122
            +     V+H              S        ++  V+  I+S ++F  + + +S  + Y
Sbjct  82   A-----VLHLSGYRHHGFYGKSYSMKHVTIDDILYRVNRVIQSEVDF-LRTQFKSARIDY  135

Query  123  ENFLGSFVDPHTLELWH-----HRKGTKQITTRDVVIAVGGRPKE-LSCP-GGEHAISSD  175
             +    F D H + +       H K TK++     ++A G RP    + P  G+    SD
Sbjct  136  ISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSD  195

Query  176  DIF-WMKKKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILLRGFDQDMANKIG  232
             I  W  ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + + 
Sbjct  196  QILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLT  255

Query  233  EYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKL  292
              M    G  F+   + +S+     G   V    + G+      D +L   GR  +   L
Sbjct  256  HEMR-NHGARFLLGEIIESVEKSSRG---VSVGLKSGKKVHG--DALLYVVGRQANTDGL  309

Query  293  GLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNS  351
             L+ AG+  N + G + V  + QT   +I+A+GD I AP L   +++ GRL S  ++N +
Sbjct  310  NLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNEN  368

Query  352  TA-------QMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLS  404
             A       Q+        ++T  E    G +E++      + N E+    +   E +  
Sbjct  369  EANDDSIPSQLTTGNFPYGIYTIPEISMVGKTEKELTSL--KMNYEIGVAKYS--ELAKG  424

Query  405  ETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  464
            +   ++    +K++ D    K   G H +G  A E+     +A+ +G T     D V  +
Sbjct  425  QMSGASADGMLKILFDPISLKL-YGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNY  483

Query  465  PTTAESF  471
            PT AE++
Sbjct  484  PTLAEAY  490

>H257_01186
Length=496

 Score = 108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 122/482 (25%), Positives = 206/482 (43%), Gaps = 41/482 (9%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            +YDL+VIG G  GL C+ E+A  GK V ++D         S  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  63   QSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            ++     V+H    N         S        ++  V+  + S     + +L++ +V+ 
Sbjct  80   EA-----VLHLSGFNHHGFYGKSYSRERITLSDILHRVNVVVSSEMDVIRAQLKAAHVQI  134

Query  123  ENFLGSFVDPHTLELWH---HRKGTKQITTRDVVIAVGGRPKE--LSCPGGEHAISSDDI  177
                  F + + + + +   HR+       +  +IA G  P    +    GE  + SD I
Sbjct  135  IPGKARFENANEVSVENGTVHREAMI-YRGKKFLIACGTYPAHSPVVPVDGEVILDSDGI  193

Query  178  FWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVM-VRSILLRGFDQDMANKIGEY  234
                K E P   +VVGA  + +E A  L  + G  V V+  R  +L   D ++ + +   
Sbjct  194  LEASKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSALKME  253

Query  235  MEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAF-DTVLNATGRDPDVAKLG  293
            M    G  F+     QS+T +  G         D  S + +F + +L   GR  +   L 
Sbjct  254  MR-HKGARFLLGETIQSVTRVAKG------VRVDFASGKSSFAEALLYCVGRQANTDALN  306

Query  294  LDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNS--  351
            L+  G+  N++      K  QTS  +IYA GD I AP L   +++ GRL +  ++++   
Sbjct  307  LEGVGLAKNKRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHHEDQ  366

Query  352  -TAQMDYEKVCTAVFTPIEYGCCGLSEED-SKERFGEDNVEVYHTNFVPLEWSLSETRTS  409
             T+Q+D       ++T  E    G +E+  +KE     N  V    +  L   +      
Sbjct  367  PTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKE---GRNYAVGMAKYSELAKGM---MAG  420

Query  410  AESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  469
             +   +K++ D    + V+G H +G  A E+     +AM +        D V  +PT AE
Sbjct  421  GQKGALKILFDPD-TQSVLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFNYPTLAE  479

Query  470  SF  471
            ++
Sbjct  480  AY  481

>H257_16541
Length=494

 Score = 108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 121/446 (27%), Positives = 201/446 (45%), Gaps = 47/446 (11%)

Query  46   LGGTCVNVGCIPKK-LMHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYI  104
            LGGTC+NVGCIP K L+H + L     H    NF  +V  +    + ++ QL+ + D  +
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHSAQH----NF-KSVGIKVDNVSIDFDQLMKSKDKTV  116

Query  105  KSINFKYKVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGR-----  159
            K +    +   +   V Y    G  V    + +  +  G + + T++++IA G       
Sbjct  117  KILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVALNAGGNQTVNTKNILIATGSEVTPLP  176

Query  160  PKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSIL  219
            P  +   GG+  I S     +K+  P   +VVG   + LE       +G ++ V+     
Sbjct  177  PVPVDNEGGK-IIDSTGALALKRV-PKHLVVVGGGVIGLEMGSVYGRLGSKITVV-----  229

Query  220  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNED-----------  268
                  + A+KI   M+ +   EF +    Q +T     ++     + D           
Sbjct  230  ------EYADKICPTMDHEVTKEFQKLLTKQGMTFKLGQKVTASKVDGDVVTLTVEPAAG  283

Query  269  GESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVK--NEQTSTSNIYALGDV  326
            GE+     D VL ATGR P  A LGL++ G++  +K GRI V   N QT+   I+A+GDV
Sbjct  284  GEATTIEADCVLVATGRRPFTAGLGLEEMGIQ-TDKFGRIKVNLSNFQTNVDGIFAIGDV  342

Query  327  IDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGE  386
            I+   L   A + G  +   +       ++Y+ +   ++T  E    G +EE+ K     
Sbjct  343  IEGAMLAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEEELKTA---  398

Query  387  DNVEVYHTNFVPLEWSLSETRTSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMG  445
             NV  Y+    P+  + S  R   E+  +VKV+  K  DK ++G H +  NAGE+     
Sbjct  399  -NV-AYNVGKFPM-MANSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEGV  454

Query  446  LAMKLGFTYDQMVDTVGIHPTTAESF  471
            L ++ G + + +  T   HPT +E+F
Sbjct  455  LGIEYGASAEDIGRTCHAHPTLSEAF  480

>CCI50816
Length=807

 Score = 110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 121/487 (25%), Positives = 208/487 (43%), Gaps = 45/487 (9%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDL+VIG G     C+ +AA  GK V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  64   SSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            + L +    HH      +      S        ++  V+  I+S     +V+ +S  V Y
Sbjct  82   AVLHLSGYRHHGFYGKSY------SMKNVTIDDILYRVNRVIQSEVDLLRVQFKSARVDY  135

Query  123  ENFLGSFVDPHTLELWH-----HRKGTKQITTRDVVIAVGGRPKE-LSCP-GGEHAISSD  175
             +    F D H + +       H K TK++     ++A G RP    + P  G+    SD
Sbjct  136  ISGHARFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSD  195

Query  176  DIF-WMKKKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILLRGFDQDMANKIG  232
             I  W  ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + + 
Sbjct  196  QILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLT  255

Query  233  EYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKL  292
              M    G  F+     +S+     G L+   + +         D +L   GR  +   L
Sbjct  256  HEMR-NHGARFLLGETIESVDKSSRGVLVGLKSGKKVHG-----DALLYVVGRQANTDGL  309

Query  293  GLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNS  351
             L+ AG+  N + G + V  + QT   +I+A+GD I AP L   +++ GRL S  ++N  
Sbjct  310  NLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNED  368

Query  352  -------TAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLS  404
                    +Q+        ++T  E    G +E+    +  + N E+    +   E +  
Sbjct  369  ESNDDSIPSQLKTGNFPYGIYTIPEISMVGHTEKQLTSQ--QINYEIGVAKYS--ELAKG  424

Query  405  ETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  464
            +   ++    +K++ D    K + G H +G  A E+     +A+ +G T     D V  +
Sbjct  425  QMSGASADGMLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNY  483

Query  465  PTTAESF  471
            PT AE++
Sbjct  484  PTLAEAY  490

>PYIW_25190
Length=206

 Score = 103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 98/185 (53%), Gaps = 4/185 (2%)

Query  292  LGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDV-IDAPELTPVAIQAGRLLSRRLYNN  350
            LGL+  GVKLN+    +    E TS S IYA+GD  I   ELTPVAI AGR L+ RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  351  ST-AQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTS  409
               A + Y ++ T VF+    G  G +E  + E+FG  NV+ Y + FV L  ++++    
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMADPDHK  121

Query  410  AESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  469
             ++  +K++     +  V   H  G  A E+ Q  G+AMK+  T     + V IHPT +E
Sbjct  122  GKTA-MKLVTVGEDEVVVG-VHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTASE  179

Query  470  SFTTL  474
               T+
Sbjct  180  ELVTM  184

>PYAP_19280
Length=512

 Score = 106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 124/489 (25%), Positives = 213/489 (44%), Gaps = 46/489 (9%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVVIG G     C+ E+A  GK+V V+D      +G+S  +GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE  81

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            +     V+H              S  T     ++  V   + S     K +L++  V Y 
Sbjct  82   A-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARVDYI  136

Query  124  NFLGSFVDPHTLELWHHRKGT-------KQITTR----DVVIAVGGRPKE--LSCPGGEH  170
                 F + H + +      T        ++ TR      +IA G RP    L    G+ 
Sbjct  137  PGFARFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPIDGKV  196

Query  171  AISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILLRGFDQDM  227
               SD I     +E P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++
Sbjct  197  VFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCDNEV  256

Query  228  ANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDP  287
             + +   M V+ G  F+   + +SI  +E     VK     G+    + D +L   GR  
Sbjct  257  VSMLQHEMRVK-GARFL---LGESIQKVEKTAKGVKVLLNSGKVT--SADALLYTVGRQA  310

Query  288  DVAKLGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRL  347
            +   L ++  G+  N++      K+ QT  ++IYA+GD I AP L   +++ GRL +  +
Sbjct  311  NTDGLNIEAVGLSRNQRGLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAACHM  370

Query  348  YNN----STAQMDYEKVCTAVFTPIEYGCCGLSEED-SKERFGEDNVEVYHTNFVPLEWS  402
            ++     +T+Q++       ++T  E    G +E+  + E+    N E+    +   E +
Sbjct  371  WDGNCDIATSQLENGNYPYGIYTIPEISMVGKTEQQLTAEKV---NYEIGIAKYS--ELA  425

Query  403  LSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  462
              +    + +  +K++ D    K   G H +G  A E+     +A+ +G +     D V 
Sbjct  426  KGQMGGGSHNGILKILFDPDTLKL-HGVHAIGEGATEIIHIGQVAIAMGCSLTYFRDAVF  484

Query  463  IHPTTAESF  471
             +PT AE++
Sbjct  485  NYPTLAEAY  493

>PYVX_20512
Length=528

 Score = 104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 123/498 (25%), Positives = 209/498 (42%), Gaps = 56/498 (11%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            DYDLVVIG G     C+ E+A  GK+V ++D            +GG CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  88

Query  63   QSSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121
            ++ L +    HH      +      S        ++  V   + S     K +L++  V 
Sbjct  89   EAVLHLSGYRHHGFYGKSY------SMKNITIDDILYRVQRVVASEVDVIKAQLKAARVD  142

Query  122  YENFLGSFVDPHTLELWHHRKGT----------------KQITTRDVVIAVGGRPKE--L  163
            Y     SF  PH L +      +                 ++     +IA G RP    L
Sbjct  143  YIAGTASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNPL  202

Query  164  SCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILL  220
                G+    SD I   +  + P   +VVGA  + +E A  +  + G+ V V+  R  +L
Sbjct  203  VPVDGKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDIL  262

Query  221  RGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVL  280
               D ++ + +   M  + G  F+   + ++I ++E  +  VK     G+      D +L
Sbjct  263  SFCDTEIISNLMYEMRSK-GARFL---LGETIKSIEKSERGVKVFFNSGKVATA--DALL  316

Query  281  NATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAG  340
               GR      L L+  G+  N +      KN QT  ++IYA GD I AP L   +++ G
Sbjct  317  YTVGRQASTDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQG  376

Query  341  RLLSRRLYNN-----STAQMDYEKVCTAVFTPIEYGCCGLSEED-SKERFGEDNVEVYHT  394
            RL +  ++++     ST+Q+D       ++T  E    G +E+  +KE     N EV   
Sbjct  377  RLAACHMWDDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQQLTKEGV---NYEVGIA  433

Query  395  NFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  453
             +   E +  +   +     +K++ C  + + F  G H +G  A E+     +A+ +G +
Sbjct  434  KYS--ELAKGQMTGAIAGGMLKILFCPDSLELF--GVHAIGEGATEIIHIGQVAIAMGCS  489

Query  454  YDQMVDTVGIHPTTAESF  471
                 + V  +PT AE++
Sbjct  490  LTYFRNAVFNYPTLAEAY  507

>H310_00561
Length=497

 Score = 104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 121/482 (25%), Positives = 205/482 (43%), Gaps = 41/482 (9%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            +YDL+VIG G  GL C+ E+A  GK V ++D         S  +GG CV+ G IP K   
Sbjct  29   EYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSKTFR  80

Query  63   QSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            ++     V+H    N         S      + ++  V+  + S     + +L++ +V+ 
Sbjct  81   EA-----VLHLSGFNHHGFYGKSYSRERITLRDILHRVNVVVSSEMDVIRAQLKAAHVQI  135

Query  123  ENFLGSFVDPHTLELWHHRKGTKQITTR--DVVIAVGGRPKE--LSCPGGEHAISSDDIF  178
                  F + + + +     G++    R    +IA G  P    +    GE  + SD I 
Sbjct  136  IPGKARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSDGIL  195

Query  179  WMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVM-VRSILLRGFDQDMANKIGEYM  235
               K E P   +VVGA  + +E A  L  + G  V V+  R  +L   D ++ + +   M
Sbjct  196  DASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDDEIVSALKMEM  255

Query  236  EVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAF-DTVLNATGRDPDVAKLGL  294
                G  F+     QS+  +  G         D  S + +F + +L   GR  +   L L
Sbjct  256  R-HKGARFLLGETIQSVKRVRKG------VRVDFASGKSSFAEALLYCVGRQANTDTLNL  308

Query  295  DKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLY---NN  350
            +  G+  N K G + V  + QT+  +I+A GD I AP L   +++ GRL +  ++   + 
Sbjct  309  EGVGLSKN-KRGLLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRHEDQ  367

Query  351  STAQMDYEKVCTAVFTPIEYGCCGLSEED-SKERFGEDNVEVYHTNFVPLEWSLSETRTS  409
             T+Q+D       ++T  E    G +E+  +KE     N  V    +  L   +      
Sbjct  368  PTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKE---GRNYAVGVAKYSELAKGM---MAG  421

Query  410  AESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  469
             +   +K++ D      V+G H +G  A E+     +AM +        D V  +PT AE
Sbjct  422  GQKGALKLLFDPDSHS-VLGVHAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTLAE  480

Query  470  SF  471
            ++
Sbjct  481  AY  482

>PHYRA_47253
Length=481

 Score = 103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 126/496 (25%), Positives = 209/496 (42%), Gaps = 56/496 (11%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  64   SSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            + L +    HH      +      S  T   + ++  V   + S     + +L++  V  
Sbjct  53   AVLHLSGYRHHGFYGKSY------SMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDV  106

Query  123  ENFLGSFVDPHTLELWH-----HRKGTKQITTRD---------VVIAVGGRPKE--LSCP  166
                  F   H + +        +KG    +T D          +IA G RP    L   
Sbjct  107  VPGFARFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVPI  166

Query  167  GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILLRGF  223
             G+  I SD I      + P   +VVGA  + +E A  +  + G+ V V+  R  +L   
Sbjct  167  DGQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFC  226

Query  224  DQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNAT  283
            D+++ + +   M+  +G  F+   + ++I  +E     VK   + G+    + D +L   
Sbjct  227  DREIISNLTYEMQ-SNGARFL---LGETIKKVETADNRVKVFFDSGKVL--SADALLYTV  280

Query  284  GRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSNIYALGDVIDAPELTPVAIQAGRL  342
            GR      L L+  G+  N + G I V KN QT   +IYA GD I AP L   +++ GRL
Sbjct  281  GRQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRL  339

Query  343  LSRRLYNNS-----TAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGED--NVEVYHTN  395
             S  ++        T+Q++       ++T  E    G +E    ++  +D  N E+    
Sbjct  340  ASCHMWKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTE----QQLTKDCVNYEIGVAK  395

Query  396  FVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  455
            +   E +  +   +     +K++ D    K V G H +G  A E+     +AM +  +  
Sbjct  396  YS--ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLT  452

Query  456  QMVDTVGIHPTTAESF  471
               D V  +PT AE++
Sbjct  453  YFRDAVFNYPTLAEAY  468

>PHYRA_73883
Length=551

 Score = 103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 127/516 (25%), Positives = 219/516 (42%), Gaps = 71/516 (14%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G +P K 
Sbjct  43   SEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKT  94

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              +++L      H +   G      G +  F  + ++  V     +     + +L    V
Sbjct  95   FREAALHLTGYRHKAFYNG----QAGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGV  150

Query  121  KYENFLGSFVDPH-------TLELWHHRKGTKQITTRDV----------VIAVGGRP-KE  162
            +  N    F+  +       + E +      K+ T+ D+          ++ VG RP + 
Sbjct  151  QLINGTARFLPGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKFLVCVGTRPARH  210

Query  163  LSCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSI  218
               P  GE    SD + W K K  P + +VVGA  V +E A  +  + G +V V+  R  
Sbjct  211  PDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDGRKE  270

Query  219  LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDT  278
            +L   D++++  +  Y   Q+G  F+ +   +S+   +NG++ V    E G++     D 
Sbjct  271  ILNMADKEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIFVHL--ESGKTV--VGDG  325

Query  279  VLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAI  337
            +L   GR  +V  L L+  G+   +K GRI V N  QT+  +IYA GD+I  P L   ++
Sbjct  326  LLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAAPHIYAAGDIIGFPGLASTSM  384

Query  338  QAGRL----------LSRRLYNNSTAQMDYEKVCT----------AVFTPIEYGCCGLSE  377
            + GRL          L+ ++ ++     D ++V T           ++T  E    G +E
Sbjct  385  EQGRLASVHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNE  444

Query  378  ED-SKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGFHYLGP  435
            +  +KE+        Y       E             ++K+I C  T    ++G H +G 
Sbjct  445  QQLTKEQ------TPYEVGMARYEELARGQMLGGVPGFLKIIFCPDTLK--ILGVHAIGE  496

Query  436  NAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
             A E+     + M  G   +   + V  +PT AE++
Sbjct  497  GATEIIHIGQVVMSTGGNLEYFRNAVFNYPTLAEAY  532

>PITG_18935
Length=480

 Score = 103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 135/481 (28%), Positives = 221/481 (46%), Gaps = 51/481 (11%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  27   SSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKA  78

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            +  S+ +     HD  ++G + A E  A   N+ Q++ + +  +K++    ++  +   V
Sbjct  79   LLHSTHLLHTAQHDFKSYGID-APEVKA---NFPQMMKSKEKAVKTLTGGIELLFKKNKV  134

Query  121  KYENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHA----ISSD  175
             Y    G       + +  +  KG + +  ++++IA G     L     ++A    I S 
Sbjct  135  TYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDST  194

Query  176  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYM  235
                +K+  P   +VVGA    +E   FL                 G D++   +  + +
Sbjct  195  GALELKRV-PEHLVVVGAGVTVVE---FLDAA------------CPGSDKEAVKEFTKLL  238

Query  236  EVQSGIEFIRKTVPQSITTLENGQLLVKWTNED---GESCEEAFDTVLNATGRDPDVAKL  292
            + Q G++F   T    +T  E    +VK T E    G++     DTVL ATGR    + L
Sbjct  239  KKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTSGL  294

Query  293  GLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNS  351
            GL++ G++  +K GRI V +  +T    I+A+GDVI    L   A + G      +    
Sbjct  295  GLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH  353

Query  352  TAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAE  411
               ++Y  +   ++T  E+   G +EE+ K    E NV  +     P+  + S  RT AE
Sbjct  354  -GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PM-MANSRARTIAE  406

Query  412  S-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAES  470
            +   VKV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +E+
Sbjct  407  ADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEA  465

Query  471  F  471
            F
Sbjct  466  F  466

>PYIW_19795
Length=519

 Score = 101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 120/489 (25%), Positives = 200/489 (41%), Gaps = 46/489 (9%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVVIG G     C+ E+A  GK+V V+D            +GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFRE  88

Query  64   SSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            + L +    HH      +      S  T     ++  V   + S     K +L++  V+Y
Sbjct  89   AVLHLSGYRHHGFYGKSY------SMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEY  142

Query  123  ENFLGSFVDPHTLELWHHRKGTK-----------QITTRDVVIAVGGRPKE--LSCPGGE  169
               L  F   H + +       +           ++     +IA G RP    L    G+
Sbjct  143  IPGLARFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDGK  202

Query  170  HAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILLRGFDQD  226
                SD I     +E P   +VVGA  + +E A  L  + G+ V V+  R  +L   D +
Sbjct  203  VIFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDNE  262

Query  227  MANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRD  286
            + + +   M    G  F+     + +   E+G   V      G++     D +L   GR 
Sbjct  263  IISNLTYEMR-SKGARFLLGETIKQVEKTEDG---VTVHFNSGKTATA--DALLYTVGRQ  316

Query  287  PDVAKLGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRR  346
                 L L+   +  N +       + QT+ S+IYA GD I AP L   +++ GRL +  
Sbjct  317  ASTDGLNLEAVNLARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAACH  376

Query  347  LYNNS----TAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWS  402
            +++      T+Q++       ++T  E    G +E+   +     N E+    +   E +
Sbjct  377  MWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYEIGIAKYS--ELA  432

Query  403  LSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  462
              +   S     +K++ D T  K  +G H +G  A E+     +AM +G +     D V 
Sbjct  433  KGQMSGSTAGGMLKILFDPTTLKL-LGVHAIGEGATEIIHIGQVAMAMGCSVTYFRDAVF  491

Query  463  IHPTTAESF  471
             +PT AE++
Sbjct  492  NYPTLAEAY  500

>PYAR_16840
Length=536

 Score = 101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 121/506 (24%), Positives = 207/506 (41%), Gaps = 63/506 (12%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVVIG G     C+ E+A  GK+V V+D        T  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  64   SSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYE  123
            +     V+H              S  T     ++  V   + S     K +L++  + Y 
Sbjct  89   A-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARIDYL  143

Query  124  NFLGSFVDPHTLELW-------HHRKGTKQITTRDVVIAVGGRPKE--LSCPGGEHAISS  174
              L  F + H + +               ++     +IA G RP    L    G+  + S
Sbjct  144  PGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVILDS  203

Query  175  DDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVM-----VRSILLRGFDQDM  227
            D I     +E P   +VVGA  + +E A  L  + G+ V V+     VR++L     +DM
Sbjct  204  DQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---SRDM  260

Query  228  A------------------NKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDG  269
            +                  ++I   ++ +  ++  R  + ++I  +E     VK     G
Sbjct  261  SLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFLTSG  320

Query  270  ESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDA  329
            +    + D +L   GR      L L+  G+  N++      K  QT   +IYA+GD I A
Sbjct  321  KVT--SGDALLYTVGRQASTDGLNLEAVGLGRNKRGLLTVNKAYQTEKPHIYAVGDCIGA  378

Query  330  PELTPVAIQAGRLLSRRLYNNS---TAQMDYEKVCTAVFTPIEYGCCGLSEED-SKERFG  385
            P L   +++ GRL +  ++      T+Q++       ++T  E    G +E+  + E+  
Sbjct  379  PSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSEKV-  437

Query  386  EDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMG  445
              N E+    +  L        +      +K++ D    + V G H +G  A E+     
Sbjct  438  --NYEIGLAKYSELAKG---QMSGGAFGMLKILFDPDTLR-VHGVHAIGEGATEIIHIGQ  491

Query  446  LAMKLGFTYDQMVDTVGIHPTTAESF  471
            +A+ +G +     D V  +PT AE++
Sbjct  492  VAIAMGCSLTYFRDAVFNYPTLAEAY  517

>PYU1_G011605
Length=524

 Score = 100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 123/486 (25%), Positives = 212/486 (44%), Gaps = 37/486 (8%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            DYDLVVIG G     C+ E+A  GK+V ++D      + TS  +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD------KKTS--VGGVCVHTGTIPSKTFR  91

Query  63   QSSL-IGEVMHHDSANFGWNVASEG-SAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
            ++ L +    HH      +++ +       +  K++V++    IK+     +VE    + 
Sbjct  92   EAVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYIPGFA  151

Query  121  KYEN--FLGSFVDPHTLELWHHRKGTKQIT---TRDVVIAVGGRPKE-LSCP-GGEHAIS  173
            ++EN   +    DP T E     + T  ++       +IA G RP    + P  G+    
Sbjct  152  RFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPIDGKVIFD  211

Query  174  SDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVM-VRSILLRGFDQDMANK  230
            SD I     ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + 
Sbjct  212  SDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFCDNEIISN  271

Query  231  IGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVA  290
            +   M    G  F+       +    NG  +  + N    +   + D +L   GR     
Sbjct  272  LTYEMR-SKGARFLLGETINRVEKTGNG--VTVYLNSGKVT---SADAMLYTVGRQASTD  325

Query  291  KLGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN  350
             L L+   +  N +      K+ QT   +IYA+GD I AP L   +++ GRL +  +++ 
Sbjct  326  GLNLEAVNLSRNPRGLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLAACHMWDQ  385

Query  351  S----TAQMDYEKVCTAVFTPIEYGCCGLSEED-SKERFGEDNVEVYHTNFVPLEWSLSE  405
                 T+Q++       ++T  E    G +E+  +KE     N E+    +   E +  +
Sbjct  386  EEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGV---NFEIGIAKYS--ELAKGQ  440

Query  406  TRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  465
               S     +K++ D T  K   G H +G  A E+     +A+ +G +     D V  +P
Sbjct  441  MSGSTAGGMLKILFDPTTLKL-FGVHAIGEGATEIIHIGQVAIAMGCSVTYFRDAVFNYP  499

Query  466  TTAESF  471
            T AE++
Sbjct  500  TLAEAY  505

>PPTG_00938
Length=550

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 129/519 (25%), Positives = 219/519 (42%), Gaps = 77/519 (15%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G +P K 
Sbjct  45   SEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKT  96

Query  61   MHQSSLIGEVMHHDSANFGWNVASE--GSAPTFNWKQLVSNVDAYI-KSINFKYKVELRS  117
              +++L      H +   G    S+  G        + V N +  I +    +  V+L +
Sbjct  97   FREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVENAETDITRHQLLRNGVQLIN  156

Query  118  KYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDV----------VIAVGGRP-KELSCP  166
               ++     + V   + E +      K+ ++ D+          ++ VG RP +    P
Sbjct  157  GTARFLPGSKNMVAVLSNESYETATDAKRHSSADICKRVLTADKFLVCVGTRPARRPDIP  216

Query  167  -GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILLRG  222
              GE    SD++ W K K  P + ++VGA  V +E A  +  + G +V V+  R  +L  
Sbjct  217  FDGETIFDSDELLWGKVKSVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNM  276

Query  223  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNA  282
             D+ ++  +  Y   Q+G  F+     +S+     G++ V    E G++     D +L  
Sbjct  277  ADKQVSEALC-YSMTQTGTRFLTGETIKSVEKSPKGEVFVHL--ESGKTV--VGDGLLYT  331

Query  283  TGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGR  341
             GR  +V  L L+  G+   +K GRI V N  QT+  +IYA GD+I  P L   +++ GR
Sbjct  332  VGRQGNVEGLNLEAVGLS-PDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGR  390

Query  342  LLSRRL----------YNNSTAQMDYEKVCT----------AVFTPIEYGCCGLSEED-S  380
            L S  +           ++     D ++V T           ++T  E    G +E+  +
Sbjct  391  LASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLT  450

Query  381  KERFGEDNVEVYHTNFVPLEWSLSETRTSAE-------SCYVKVI-CDKTRDKFVVGFHY  432
            KE+             VP E  ++     A          ++K+I C  T   F  G H 
Sbjct  451  KEQ-------------VPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTLKIF--GVHA  495

Query  433  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  496  IGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  534

>PYIW_24688
Length=259

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 137/282 (49%), Gaps = 38/282 (13%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YD + IGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCV+ GC+PKK+M  
Sbjct  7    YDYISIGGGSGGMASARRAATFGAKVLV---VERGRKYGGAGLGGTCVHYGCVPKKIMFN  63

Query  64   SSLIGEVMHHDSANFGWNVASEGSAP----TFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
            ++    V H + A   +++ + G+       F+W  + +  DAYI  +N  Y+  L +  
Sbjct  64   AAT--HVEHLNRAA-DYSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYERNLGNAQ  120

Query  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179
            V     +   V  + +E+          T + +++AVGG+P               D F+
Sbjct  121  VDLVEGVAKLVAKNQVEV-----DGVVYTGKHILVAVGGKP---------------DGFF  160

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVR-SILLRGFD---QDMANKIGEYM  235
              + +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD   +D+ N+ GE  
Sbjct  161  KLEAQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE--  218

Query  236  EVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFD  277
              ++GI F+R +  + I    +G L +       E     FD
Sbjct  219  --KAGINFVRNSRIERIEKQADGSLTITAKVNGEEQVLAGFD  258

>PPTG_09121
Length=520

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 123/499 (25%), Positives = 206/499 (41%), Gaps = 59/499 (12%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  32   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  83

Query  64   SSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            + L +    HH      +      S  T   + ++  V   + S     + +L++  V  
Sbjct  84   AVLHLSGYRHHGFYGKSY------SMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDV  137

Query  123  ENFLGSFVDPHTLELWHHRKGTK-----------------QITTRDVVIAVGGRPKE--L  163
                  F + H + +       K                 +I     +IA G RP    L
Sbjct  138  VPGFARFENEHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNPL  197

Query  164  SCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILL  220
                G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+  R  +L
Sbjct  198  IPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDIL  257

Query  221  RGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVL  280
               D ++ + +   M+  +G  F+   + +++  +E     VK     G+      D +L
Sbjct  258  SFCDSEIISNLTYEMQ-SNGARFL---LGETVKKVETTDKRVKVFFNSGKVLSA--DALL  311

Query  281  NATGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSNIYALGDVIDAPELTPVAIQA  339
               GR      L L+  G+  N + G I V KN QT   +IYA GD I AP L   +++ 
Sbjct  312  YTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQ  370

Query  340  GRLLSRRLYN-----NSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGED--NVEVY  392
            GRL S  ++N      +T+Q++       ++T  E    G +E    ++  +D  N E+ 
Sbjct  371  GRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQTE----QQLTKDCVNYEIG  426

Query  393  HTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  452
               +   E +  +   +     +K++ D    K V G H +G  A E+     +AM +  
Sbjct  427  IAKYS--ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDC  483

Query  453  TYDQMVDTVGIHPTTAESF  471
            +     D V  +PT AE++
Sbjct  484  SLTYFRDAVFNYPTLAEAY  502

>PPTG_13000
Length=387

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 100/344 (29%), Positives = 161/344 (47%), Gaps = 24/344 (7%)

Query  138  WHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHA----ISSDDIFWMKKKEPGKTLVVGA  193
             +  KG + +  ++++IA G     L     ++A    I S     +K+  P   +VVGA
Sbjct  44   LNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALELKRV-PEHLVVVGA  102

Query  194  SYVALECAGFLKGMGYEVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSI  252
              + LE     K +G +V V+        G D++   +  + ++ Q G++F   T    +
Sbjct  103  GVIGLELGSVYKRLGAKVTVVEFLDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KV  158

Query  253  TTLENGQLLVKWTNED---GESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIW  309
            T+ E    +VK T E    G++     DTVL ATGR    A LGL++ G++  +K GRI 
Sbjct  159  TSSEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIE  217

Query  310  VKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPI  368
            V +  +T    I+A+GDVI    L   A + G      +       ++Y  V   ++T  
Sbjct  218  VDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAVPGVIYTFP  276

Query  369  EYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAES-CYVKVICDKTRDKFV  427
            E+   G +EE+ K    E NV  +     P+  + S  RT AES   VKV+ DK  DK +
Sbjct  277  EFASVGKTEEELKAEGIEYNVGKF-----PM-MANSRARTVAESDGLVKVLADKKTDKLL  330

Query  428  VGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
             G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  331  -GVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  373

>PHYCA_504445
Length=548

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 126/516 (24%), Positives = 216/516 (42%), Gaps = 71/516 (14%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ ++A  GK V ++D            +GG CV+ G +P K 
Sbjct  43   SEHFDLIVIGSGPAGQKCAIDSAKSGKSVAIID--------KRDMMGGVCVHTGTVPSKT  94

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              +++L      H +   G      G +  F  + ++  V     +     + +L    V
Sbjct  95   FREAALHLTGYRHKAFYNGHG----GPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGV  150

Query  121  KYENFLGSFV--DPHTLELW------------HHRKGT--KQITTRD-VVIAVGGRP-KE  162
            +  N    F+  + H + +              H      K++ T D  ++ VG RP + 
Sbjct  151  QLINGTARFLPGNNHMVAVLSNESYETATDAQRHSSADICKRVLTADKFLVCVGTRPARR  210

Query  163  LSCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSI  218
               P  GE    SD + W K K  P + ++VGA  V +E A  +  + G +V V+  R  
Sbjct  211  PDIPFDGETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQE  270

Query  219  LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDT  278
            +L   D++++  +  Y   Q+G  F+     +S+     G++ V    E G++     D 
Sbjct  271  ILNMADKEVSEALC-YSMAQTGTRFLTGETIKSVEKTAKGEVFVHL--ESGKTV--VGDG  325

Query  279  VLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAI  337
            +L   GR  +V  L L+  G++  +K GRI V N  QT+  +IYA GD+I  P L   ++
Sbjct  326  LLYTVGRQGNVEGLNLEAVGLE-PDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSM  384

Query  338  QAGRLLSRRLYNNSTAQM----------DYEKVCT----------AVFTPIEYGCCGLSE  377
            + GRL S  +  + T             D ++V T           ++T  E    G +E
Sbjct  385  EQGRLASVHMRTSKTLNTKELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNE  444

Query  378  ED-SKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGFHYLGP  435
            +  +KE+        Y       E             ++K+I C +T    ++G H +G 
Sbjct  445  QQLTKEQV------PYEVGKARYEELARGQMLGGVPGFLKIIFCPETLK--ILGVHAIGE  496

Query  436  NAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
             A E+     + M  G   +   + V  +PT AE++
Sbjct  497  GATEIIHIGQVVMSTGGDLEYFRNAVFNYPTLAEAY  532

>SDRG_14446
Length=495

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 120/480 (25%), Positives = 207/480 (43%), Gaps = 39/480 (8%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            +YDLVVIG G   + C+ E+   GK V V+D           G+GG CV+ G IP K   
Sbjct  28   EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  79

Query  63   QSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            +S L      H    +G + A +          ++  V+  +       + +L++  V  
Sbjct  80   ESVLHLSGFRHQGF-YGKSYARD----NITLNDILGRVNTVVSKEMDVIQAQLKAARVDL  134

Query  123  ENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKE--LSCPGGEHAISSDDIF-W  179
               L  F + + + +        ++  +  ++A G RP    L    G+  + SD I   
Sbjct  135  VPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGKVILDSDQILNH  194

Query  180  MKKKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILLRGFDQDMANKIGEYMEV  237
               K P   +VVGA  + +E A  L  + G  V V+  R+ +L   D ++ + +   M  
Sbjct  195  GTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLKMEMR-  253

Query  238  QSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  297
              G  F+     +S+   +NG   VK     G++     + +L   GR  +   L L+  
Sbjct  254  HKGARFLLGESIKSVEHFKNG---VKVEFNSGKAMFA--EALLYCVGRQANTDGLNLEAV  308

Query  298  GVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNN---STA  353
            G+  N + G I V  + QTS  +IYA GD I AP L   +++ GRL +  ++++   +T+
Sbjct  309  GLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTTS  367

Query  354  QMDYEKVCTAVFTPIEYGCCGLSEED-SKERFGEDNVEVYHTNFVPLEWSLSETRTSAE-  411
            Q++       ++T  E    G +E+  +KE     N  V    F      L++ + S + 
Sbjct  368  QLESGNYPYGIYTIPEISMVGKTEQQLTKE---GANYAVGLAKF----SELAKGQMSGDI  420

Query  412  SCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
               +K++ D    +  +G H +G  A E+     +AM +        D V  +PT AE +
Sbjct  421  EGILKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTLAEGY  479

>SDRG_05060
Length=559

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 129/525 (25%), Positives = 215/525 (41%), Gaps = 87/525 (17%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DLVVIG G  G  C+ ++A  GKKV ++D             GG CV+ G IP K 
Sbjct  47   SEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKT  98

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              ++ L   +  H    F  N  S  S    + + ++  V     +     + +L    +
Sbjct  99   FREAVL--HLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGI  156

Query  121  KYENFLGSFV---DPHTLELWHHRKGT--------------KQITTRD-VVIAVGGRPKE  162
               N    F+   D  T+ +  +   T              K++ T D  +I+VG RP  
Sbjct  157  YLINGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPAR  216

Query  163  LSCPG----GEHAISSDDIFW-MKKKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-  215
               P     GE    SD + W      P + +VVGA  + +E A  +  + G +V V+  
Sbjct  217  --HPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDG  274

Query  216  RSILLRGFDQDMANKI-------GEYMEVQSGIEFIRKTVPQS--ITTLENGQLLVKWTN  266
            R  +L   D+++++ +       G     +  I+F+ K + +   +  L++G+++V    
Sbjct  275  RKEILEMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG---  331

Query  267  EDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGD  325
                      D +L   GR  +V  L L+  G++ N + G + V N  QTS  +IYA GD
Sbjct  332  ----------DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGD  380

Query  326  VIDAPELTPVAIQAGRLLSRRLY-----NNSTAQMD-YEK------------VCTAVFTP  367
             I  P L  V+++ GRL S  +      N +   +D YE                 ++T 
Sbjct  381  CIGYPALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTV  440

Query  368  IEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKF  426
             E    G SE    ++  ++NV  Y       E             ++K+I C  T    
Sbjct  441  PEISMVGKSE----QQLTKENVP-YEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK--  493

Query  427  VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            ++G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  494  LLGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  538

>SPRG_12054
Length=558

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 129/525 (25%), Positives = 215/525 (41%), Gaps = 87/525 (17%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DLVVIG G  G  C+ ++A  GKKV ++D             GG CV+ G IP K 
Sbjct  46   SEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKT  97

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              ++ L   +  H    F  N  S  S    + + ++  V     +     + +L    +
Sbjct  98   FREAVL--HLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGI  155

Query  121  KYENFLGSFV---DPHTLELWHHRKGT--------------KQITTRD-VVIAVGGRPKE  162
               N    F+   D  T+ +  +   T              K++ T D  +I+VG RP  
Sbjct  156  YLINGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPAR  215

Query  163  LSCPG----GEHAISSDDIFW-MKKKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-  215
               P     GE    SD + W      P + +VVGA  + +E A  +  + G +V V+  
Sbjct  216  --HPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDG  273

Query  216  RSILLRGFDQDMANKI-------GEYMEVQSGIEFIRKTVPQS--ITTLENGQLLVKWTN  266
            R  +L   D+++++ +       G     +  I+F+ K + +   +  L++G+++V    
Sbjct  274  RKEILEMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG---  330

Query  267  EDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGD  325
                      D +L   GR  +V  L L+  G++ N + G + V N  QTS  +IYA GD
Sbjct  331  ----------DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGD  379

Query  326  VIDAPELTPVAIQAGRLLSRRLY-----NNSTAQMD-YEK------------VCTAVFTP  367
             I  P L  V+++ GRL S  +      N +   +D YE                 ++T 
Sbjct  380  CIGYPALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTV  439

Query  368  IEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKF  426
             E    G SE    ++  ++NV  Y       E             ++K+I C  T    
Sbjct  440  PEISMVGKSE----QQLTKENVP-YEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK--  492

Query  427  VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            ++G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  493  LLGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  537

>PYIR_14132
Length=513

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 128/517 (25%), Positives = 214/517 (41%), Gaps = 73/517 (14%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ + A  GK V V+D            LGG C++ G +P K 
Sbjct  8    SEHFDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTVPSKT  59

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPT--FNWKQLVSNVDAYIKSINFKYKVELRSK  118
              +++L      H S   G       S PT  F  + ++  V     +     + +L   
Sbjct  60   FREATLHLTAYRHRSFYDGQ------SNPTKRFGIEDILQRVKKVEHAETDITRHQLLRN  113

Query  119  YVKYENFLGSFV-------------DPHTLELWHHRKGT----KQITTRD-VVIAVGGRP  160
             ++  N    F+             D +T      R  +    K++ T D  +IAVG RP
Sbjct  114  NIELINGTARFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLIAVGTRP  173

Query  161  -KELSCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-  215
             +    P  G+    SD + W   K  P + +VVGA  + +E A  +  + G EV ++  
Sbjct  174  ARRPDIPFDGQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDG  233

Query  216  RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEA  275
            R  +L   D++++  +   M  Q+G  F  +   +S+   +NG+++V   +  G++    
Sbjct  234  RKEILDMADREVSEALCYSMR-QTGARFFVEETIKSVEKADNGEVIVHLNS--GKTL--V  288

Query  276  FDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTP  334
             D +L   GR  +   L L   G++ + K G I V ++ QT   +IYA GD I  P L  
Sbjct  289  GDGLLYTLGRQGNTEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIGFPALAS  347

Query  335  VAIQAGRLLSRRLYNNS---------TAQMDYEKVCT----------AVFTPIEYGCCGL  375
             +++ GRL S  +  +          T   D + + T           ++T  E    G 
Sbjct  348  TSMEQGRLASVHMRTSKPTNKKGESETESTDPQYMRTRMRSGEVFPFGIYTVPEISMVGK  407

Query  376  SEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGFHYLG  434
            +E    ++    N+  Y       E             ++K+I C KT    V+G H +G
Sbjct  408  NE----QQLTSQNIP-YEVGVARYEELAKGQMLGGVPGFLKIIFCPKTLQ--VLGVHAIG  460

Query  435  PNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
              A E+     + M  G T +   + V  +PT AE++
Sbjct  461  EGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  497

>H310_07641
Length=548

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 125/515 (24%), Positives = 213/515 (41%), Gaps = 67/515 (13%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DLVVIG G  G  C+ ++A  GKKV ++D             GG CV+ G IP K 
Sbjct  38   SEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKT  89

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              ++ ++    H     +G    +  +    + ++++  V    ++     + +L    +
Sbjct  90   FREA-VLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEEAETDLTRNQLTRNGI  148

Query  121  KYENFLGSFV---DPHTLELWHHRKGT--------------KQITTRD-VVIAVGGRPKE  162
               N    F+   D  T+ +  +   T              K++ T D V+IAVG RP  
Sbjct  149  ILINGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPAR  208

Query  163  LSCPG----GEHAISSDDIFWMKKK-EPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-  215
               P     G     SD + W      P + +VVGA  + +E A  +  + G +V V+  
Sbjct  209  --HPDLEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDG  266

Query  216  RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEA  275
            R  +L   D+++++ +  YM  Q G  F+ +     + T ++ +++V  T+  G+     
Sbjct  267  RKEILDMADKEVSDALCYYMR-QRGSRFLTEESILKVETKDDSEVVVHLTS--GKVI--M  321

Query  276  FDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTP  334
             D +L   GR  +VA L L+  G+  N K G + V N  QT+  +IYA GD I  P L  
Sbjct  322  GDALLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALAS  380

Query  335  VAIQAGRLLSRRLYNNS------------------TAQMDYEKVCTAVFTPIEYGCCGLS  376
             +++ GRL S  +  +                   T     E     ++T  E    G S
Sbjct  381  TSMEQGRLASVHMRTSEPTNKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMVGKS  440

Query  377  EEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPN  436
            E    ++  ++N+  Y       E             ++K+I   T  K  +G H +G  
Sbjct  441  E----QQLSKENIP-YEVGIARYEELAKGQMLGGMPGFLKLIFCPTTLKL-LGVHAIGEG  494

Query  437  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            A E+     + M  G T +   + V  +PT AE++
Sbjct  495  ATEIIHIGQVVMSTGGTMEYFRNAVFNYPTLAEAY  529

>PHALS_12028
Length=579

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 126/515 (24%), Positives = 213/515 (41%), Gaps = 69/515 (13%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G IP K 
Sbjct  33   SEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTIPSKT  84

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              +++L      H +   G      G +  F  + ++  V     +     + +L    V
Sbjct  85   FREAALHLTGYRHKAFYNGQG----GPSKRFGVEDILQRVKKVESAETDITRHQLLRNGV  140

Query  121  KYENFLGSFV--DPHTLELWHH----------RKGTKQITTR-----DVVIAVGGRP-KE  162
            +  N    F+    H + +  +          R  +  I  R       ++ VG RP + 
Sbjct  141  QLINGTARFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFLLCVGTRPARR  200

Query  163  LSCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVM-VRSI  218
               P  GE    SD + W K K  P + +VVGA  + +E A  +  + G +V V+  R  
Sbjct  201  ADIPFDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDARKE  260

Query  219  LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDT  278
            +L   D +++  +   M  Q+G  F+   V +S+     G++ V    E G++     D 
Sbjct  261  ILNMADNEVSEALCFSM-AQTGTRFLTGEVIKSVEKSAMGEVFVHL--ESGKTV--VGDG  315

Query  279  VLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAI  337
            +L   GR  +V  L L+  G+ + +K G+I V N  QT+  +IYA GD+I  P L   ++
Sbjct  316  LLYTVGRQGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLASTSM  374

Query  338  QAGRLLSRRL----------YNNSTAQMDYEKVCT----------AVFTPIEYGCCGLSE  377
            + GRL S  +           ++     D ++V T           ++T  E    G +E
Sbjct  375  EQGRLASVHMRTSQPLNDQKISDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNE  434

Query  378  EDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGFHYLGPN  436
                ++  ++ V  Y       E             ++K+I C  T    V+G H +G  
Sbjct  435  ----QQLTKEGVP-YEVGVARYEELAKGQMLGGVPGFLKIIFCPDTLK--VLGVHAIGEG  487

Query  437  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            A E+     + M    T +   + V  +PT AE++
Sbjct  488  ATEIIHIGQVLMSTDGTLEYFRNAVFNYPTLAEAY  522

>PHALS_10055
Length=516

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 121/494 (24%), Positives = 206/494 (42%), Gaps = 51/494 (10%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            +YDL+VIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  63   QSSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121
            ++ L +    HH      +      S  T   + ++  V   + S     + +L++  V 
Sbjct  83   EAVLHLSGYRHHGFYGKSY------SMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVD  136

Query  122  YENFLGSFVDPHTLELWHH--RKGTKQITTRDV-----------VIAVGGRPKE--LSCP  166
                   F + H + +      +  K+I+   V           +IA G RP    L   
Sbjct  137  VIPGFARFENEHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIPI  196

Query  167  GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVM-VRSILLRGF  223
             G+  I SD I        P   +V+GA  + +E A  +  + G+ V V+  R  +L   
Sbjct  197  DGKVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPFC  256

Query  224  DQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNAT  283
            D ++ + +   M+  +G  F+     + + T +N    VK     G+    + D +L   
Sbjct  257  DLEIISNLTYEMQ-SNGARFLLGETVKKVETTKNQ---VKVFFNSGKVL--SADALLYTV  310

Query  284  GRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSNIYALGDVIDAPELTPVAIQAGRL  342
            GR      L L+  G+  N + G I V KN QT   +IYA GD I AP L   +++ GRL
Sbjct  311  GRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGRL  369

Query  343  LSRRLYN-----NSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFV  397
             S  ++       +T+Q++       ++T  E    G +E+   +     N E+    + 
Sbjct  370  ASCHMWKPNEELAATSQLESGNYPYGIYTIPEISMVGQTEQQLTKNC--INYEIGIAKYS  427

Query  398  PLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  457
              E +  +   +     +K++ D      ++G H +G  A E      +AM +G +    
Sbjct  428  --ELAKGQMMGAMAGGTLKILFDP-ETLSLLGVHAIGEGATETIHIGQVAMAMGCSLTYF  484

Query  458  VDTVGIHPTTAESF  471
             D V  +PT AE++
Sbjct  485  RDAVFNYPTLAEAY  498

>PYU1_G005699
Length=550

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 131/517 (25%), Positives = 218/517 (42%), Gaps = 76/517 (15%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ ++A  GK V ++D             GG CV+ G +P K 
Sbjct  47   SEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDMH--------GGVCVHTGTVPSKT  98

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWK-----QLVSNVDAYIKSIN----FKY  111
              +++L      H S   G       S+PT  +      Q V  V+     I      + 
Sbjct  99   FREATLHLTAYRHRSFYDGQ------SSPTKRFGIEDILQRVKKVEHAETDITRHQLLRN  152

Query  112  KVELRSKYVKY-----ENFLGSFV-DPHTLELWHHRKGT----KQITTRD-VVIAVGGRP  160
             VEL +   ++     +N +     D +T      R  +    K++ T D  +IAVG RP
Sbjct  153  GVELINGTARFLPDANKNMIAVLSNDSYTTATDAKRHASADICKRVLTADKFLIAVGTRP  212

Query  161  -KELSCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-  215
             +    P  G+    SD + W   K  P + +VVGA  + +E A  +  + G EV ++  
Sbjct  213  ARRPDIPFDGQAVFDSDQLLWGGVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDG  272

Query  216  RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLE--NGQLLVKWTNEDGESCE  273
            R  +L   D++++  +   M  Q+G  F    V ++I ++E  NG+++V   +  G++  
Sbjct  273  RKEILDMADREVSEALCYSMR-QTGARFF---VEETIKSVEKVNGEVIVHLNS--GKTL-  325

Query  274  EAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSNIYALGDVIDAPEL  332
               D +L   GR  +   L L   G++  +K G I V +N QT+  +IYA GD I  P L
Sbjct  326  -VGDGLLYTLGRQGNTDGLNLPAVGLE-ADKRGLIQVDENFQTAVPHIYAAGDCIGFPAL  383

Query  333  TPVAIQAGRLLSRRLYNNSTAQMDYEKVCT-----------------AVFTPIEYGCCGL  375
               +++ GRL S  +          +   T                  ++T  E    G 
Sbjct  384  ASTSMEQGRLASVHMRTEKPTNKTGDSESTDPQFMRTRMRSGDVFPFGIYTVPEISMVGK  443

Query  376  SEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGFHYLG  434
            +E    ++  ++NV  Y       E             ++K+I C KT    ++G H +G
Sbjct  444  NE----QQLTKENVP-YEVGLARYEELAKGQMLGGVPGFLKIIFCPKTLQ--LLGVHAIG  496

Query  435  PNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
              A E+     + M  G T +   + V  +PT AE++
Sbjct  497  EGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  533

>PYIW_20257
Length=503

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 126/509 (25%), Positives = 207/509 (41%), Gaps = 106/509 (21%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ + A  GK V V+D            LGG C++ G +P K 
Sbjct  47   SEHFDLIVIGSGPAGQKCAIDHAKHGKTVAVID--------KRDMLGGVCIHTGTVPSKT  98

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              +++L      H S   G +      A  F  + ++  V    K ++ ++  +   +  
Sbjct  99   FREATLHLTAYRHRSFYEGQST----PAKRFGIEDILQRV----KKLHDRHGRQTPLERR  150

Query  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRP-KELSCP-GGEHAISSDDIF  178
              + FL                           IAVG RP +    P  GE    SD + 
Sbjct  151  HLQAFL---------------------------IAVGTRPARRPDIPFDGETIFDSDQLL  183

Query  179  WMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVM--VRSILLRGFDQDMANK-IGE  233
            W   K  P + +VVGA  + +E A  +  + G EV ++   R IL      DMA++ + E
Sbjct  184  WGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREIL------DMADREVSE  237

Query  234  ---YMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVA  290
               Y   Q+G  F  +   +S+   +NG+++V   +  G++     D +L   GR  +  
Sbjct  238  ALCYSMRQTGARFFVEETIKSVEKADNGEVIVHLNS--GKTL--VGDGLLYTLGRQGNTE  293

Query  291  KLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLS--RRL  347
             L L+  G+K  +K G I V ++ QT+  +IYA GD I  P L   +++ GRL S   R 
Sbjct  294  GLNLEAIGLK-ADKRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRT  352

Query  348  YNNSTAQMDYEKVCT-----------------AVFTPIEYGCCGLSEEDSKERFGEDNVE  390
               +  + D E   T                  ++T  E    G +E+            
Sbjct  353  AKPTNKKGDSETESTDPAFMRTRMRSGEVFPFGIYTVPEISMVGKNEQQ-----------  401

Query  391  VYHTNFVPLEWSLSETRTSAES-------CYVKVI-CDKTRDKFVVGFHYLGPNAGEVTQ  442
               +  +P E  ++     A+         ++K+I C  T    V+G H +G  A E+  
Sbjct  402  -LTSQCIPYEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLQ--VLGVHAIGEGATEIIH  458

Query  443  AMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
               + M  G T +   + V  +PT AE++
Sbjct  459  IGQVVMSTGGTIEYFRNAVFNYPTLAEAY  487

>PHYCA_555180
Length=521

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 120/500 (24%), Positives = 202/500 (40%), Gaps = 59/500 (12%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  31   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  82

Query  64   SSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            + L +    HH      +      S  T   + ++  V   + S     + +L++  V  
Sbjct  83   AVLHLSGYRHHGFYGKSY------SMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDV  136

Query  123  ENFLGSFVDPHTLELWHHRKGTK--------------------QITTRDVVIAVGGRPKE  162
                  F + H + +       K                    ++     +IA G RP  
Sbjct  137  IPGFARFENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADKFLIACGTRPAH  196

Query  163  --LSCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RS  217
              L    G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+  R 
Sbjct  197  NPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDGRP  256

Query  218  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFD  277
             +L   D+++ + +   M+  +G  F+     + +   +     VK   + G+      D
Sbjct  257  DILSFCDREIISNLTYEMQ-SNGARFLLGETVKKVEVTDR----VKVFFDSGKVLSA--D  309

Query  278  TVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSNIYALGDVIDAPELTPVA  336
             +L   GR      L L+  G+  N + G I V KN QT   +IYA GD I AP L   +
Sbjct  310  ALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTS  368

Query  337  IQAGRLLSRRLYNNS-----TAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEV  391
            ++ GRL S  ++N       T+Q++       ++T  E    G +E+   +     N E+
Sbjct  369  MEQGRLASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQLTKAC--INYEI  426

Query  392  YHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  451
                +   E +  +   +     +K++ D    K V G H +G  A E+     +AM + 
Sbjct  427  GVAKYS--ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMD  483

Query  452  FTYDQMVDTVGIHPTTAESF  471
             +     D V  +PT AE++
Sbjct  484  CSLTYFRDAVFNYPTLAEAY  503

>PYAP_19148
Length=535

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 121/526 (23%), Positives = 213/526 (40%), Gaps = 81/526 (15%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ + A  GK V ++D             GG CV+ G +P K 
Sbjct  8    SEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTVPSKT  59

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPT--FNWKQLVSNVDAYIKSINFKYKVELRSK  118
              ++ L      H +A+   +     S P   F  + ++  V     +     + +L   
Sbjct  60   FREAIL------HLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDITRHQLLRN  113

Query  119  YVKYENFLGSFV-DPH-------TLELWHHRKGTKQITTRDV------------------  152
             ++  N    F+ DP        + + +     TK+ T+ D+                  
Sbjct  114  GIELINGTARFLPDPSKKMVAVLSNDSYETATDTKRHTSADICKRTGADSSILLISVLTA  173

Query  153  ---VIAVGGRP-KELSCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKG  206
               ++AVG RP +    P  G+    SD I W      P + +VVGA  + +E A  +  
Sbjct  174  DKFLVAVGTRPARRADIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSI  233

Query  207  M-GYEVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKW  264
            + G EV V+  R  +L   D+++A  + +Y   Q+G  F       ++    NG+++VK 
Sbjct  234  IPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVIVKL  292

Query  265  TNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALG  324
             +  G++     D +L   GR  +   L L   G++ +++       N +TS  +IYA G
Sbjct  293  NS--GKTI--VGDGLLYTVGRQGNTDGLNLAAVGLEADKRGLLKVDDNFRTSVPHIYAAG  348

Query  325  DVIDAPELTPVAIQAGRLLS----------RRLYNNSTAQMDYEKVCT--------AVFT  366
            D I  P L   +++ GRL S          ++  +N  +   Y++            ++T
Sbjct  349  DCIGYPALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYT  408

Query  367  PIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDK  425
              E    G SE    ++   +N+  Y       E             ++K++ C K+   
Sbjct  409  VPEISMVGKSE----QQLTRENIP-YEVGVARYEELAKGQMLGGVPGFLKIVFCPKSLQ-  462

Query  426  FVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
             V+G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  463  -VLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  507

>PYVX_23499
Length=519

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 123/515 (24%), Positives = 205/515 (40%), Gaps = 67/515 (13%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+V+G G  G  C+ ++A  GK V ++D            LGG CV+ G +P K 
Sbjct  12   SEHFDLIVVGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKT  63

Query  61   MHQSSLIGEVMHHDSANFGWNVAS---------------EGSAPTFNWKQLVSNVDAYIK  105
              +++L      H +     +V+S               EG+       QL+ N    I 
Sbjct  64   FREATLHLTGYRHRAFYDSASVSSRRLEIDDILQRVHKVEGAETDITRHQLMRNNVELIH  123

Query  106  SINFKYKVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITTRD-VVIAVGGRP-KEL  163
                    E R+      N    +  P   +        K++ T D  +I VG RP +  
Sbjct  124  GTARFLPDEKRNMVAVLSN--AKYDTPTDAKRHTSADICKRVLTADKFLICVGTRPARRE  181

Query  164  SCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSIL  219
              P  G+    SD + W   K  P + +VVGA  + +E A  +  + G EV V+  R  +
Sbjct  182  DIPFDGKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIPGTEVTVIDGRKEI  241

Query  220  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTV  279
            L   D++++  +   M  Q+G  F  +   + +   ENG+++    +  G+      D +
Sbjct  242  LDMADKEVSESLCYSMR-QTGTRFYTEESIKKVEKRENGEVVAHLNS--GKVI--VGDGL  296

Query  280  LNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQ  338
            L   GR  +   L L   G++  +K G + V ++ QT   +IYA GD I  P L   +++
Sbjct  297  LYTLGRQGNTDGLNLQAVGLE-TDKRGFLNVNDDFQTEVPHIYAAGDCIGYPALASTSME  355

Query  339  AGRLLSRRLYNNSTAQMDYEKVCT---------------------AVFTPIEYGCCGLSE  377
             GRL S  +   S      E+                         ++T  E    G +E
Sbjct  356  QGRLASVHMRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFPFGIYTIPEISMVGKNE  415

Query  378  EDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGFHYLGPN  436
                ++  ++NV  Y       E             ++K+I C  T    V+G H +G  
Sbjct  416  ----QQLTKENVP-YEVGLARYEELAKGQMLGGVPGFLKIIFCPDTLK--VLGVHAIGEG  468

Query  437  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            A E+     + M  G T +   + V  +PT AE++
Sbjct  469  ATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  503

>PHYKE_9807
Length=557

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 125/519 (24%), Positives = 212/519 (41%), Gaps = 78/519 (15%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK-  59
            S  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G   ++ 
Sbjct  53   SEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIVD--------KRDMLGGVCVHTGTTFREA  104

Query  60   LMHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119
             MH +       ++        +  E      +  Q V  V+A    I    + +L+   
Sbjct  105  AMHLTGYRHRAFYNGHGGISKRIGVE------DILQRVKKVEAAETDIT---RHQLQRNG  155

Query  120  VKYENFLGSFV--DPHTL-----ELWHHRKGTKQITTRDV----------VIAVGGRP-K  161
            V+  +    F+  D H L     E +      K+ T  D+          ++ VG RP +
Sbjct  156  VQLISGTARFLAGDSHMLAVLSNEEYETATDAKRHTEADICKRVLTADKFLVCVGTRPAR  215

Query  162  ELSCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RS  217
                P  GE    SD + W K K  P + ++VG   V +E A  +  + G +V V+  R 
Sbjct  216  HPDIPFDGETIFDSDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMTIIPGTDVTVIDGRK  275

Query  218  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFD  277
             +L   D++++  +  Y   Q+G  F+     + +     G++LV+   + G++     D
Sbjct  276  EILNMADKEVSEALC-YSMAQTGTRFLVGETIKKVEKNSKGEVLVRL--DSGKTV--VGD  330

Query  278  TVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVA  336
             +L   GR  +V  L L+  G+   +K GRI V N  QT   +IYA GD+I  P L   +
Sbjct  331  GLLYTVGRQGNVEGLHLESVGIH-PDKRGRIKVDNNFQTEVPHIYAAGDIIGFPGLASTS  389

Query  337  IQAGRLLSRRLYNNSTAQM-------------DYEKVCT----------AVFTPIEYGCC  373
            ++ GRL S  +   S                 D +++ T           ++T  E    
Sbjct  390  MEQGRLASVHMRTASPVATKPSKELPDDKLMDDPDRMRTRMRSGEVFPFGIYTVPEISMV  449

Query  374  GLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGFHY  432
            G +E    ++  ++ V  Y       E             ++K+I C  T    ++G H 
Sbjct  450  GKNE----QQLTQEQVP-YEVGMARYEELARGQMLGGVPGFLKIIFCPNTLQ--ILGVHA  502

Query  433  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  503  IGEGATEIIHIGQVVMSTGGTLEYFRNAVMNYPTLAEAY  541

>H257_07450
Length=567

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 98/368 (27%), Positives = 162/368 (44%), Gaps = 39/368 (11%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DLVVIG G  G  C+ ++A  GKKV ++D             GG CV+ G IP K 
Sbjct  36   SEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKT  87

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              ++ ++    H     +G    +  +    + ++++  V     +     + +L    +
Sbjct  88   FREA-VLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEDAETDLTRNQLTRNGI  146

Query  121  KYENFLGSFV---DPHTLELWHHRKGT--------------KQITTRD-VVIAVGGRPKE  162
               N    F+   D  T+ +  +   T              K++ T D V+IAVG RP  
Sbjct  147  ILINGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPAR  206

Query  163  LSCPG--GEHAISSDDIFWMKKK-EPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RS  217
                   G     SD + W      P + +VVGA  + +E A  +  + G +V V+  R 
Sbjct  207  RPDLDYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRK  266

Query  218  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFD  277
             +L   D+++++ +  YM  + G  F+ +     + T +N ++LV  T+  G+      D
Sbjct  267  EILDMADKEVSDALCYYMR-KRGSRFLTEESIVKVETKDNSEVLVYLTS--GKVI--VGD  321

Query  278  TVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVA  336
             +L   GR  +VA L L+  G+  N K G + V N  QT   +IYA GD I  P L   +
Sbjct  322  ALLYTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDVPHIYAAGDCIGYPALASTS  380

Query  337  IQAGRLLS  344
            ++ GRL S
Sbjct  381  MEQGRLAS  388

>CCI39993
Length=550

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 123/514 (24%), Positives = 211/514 (41%), Gaps = 69/514 (13%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  YDL+VIG G  G  C+ ++A  GK V ++D         +   GG CV+ G +P K 
Sbjct  42   SEHYDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KNEMHGGVCVHTGTVPSKT  93

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              ++ L   +  H   NF   ++S      F  + +++ V     +     + +L    V
Sbjct  94   FREAIL--HLTAHRHRNFYTGLSS--PKKRFGIEDILTRVRKVENAETDITRHQLVRNNV  149

Query  121  KYENFLGSFV-DPHTLELWHHRKGTKQ-----------------ITTRDVVIAVGGRP--  160
            +  N    F+ DP    L++     KQ                 +T    +IAVG RP  
Sbjct  150  ELINGTARFLPDPSKKMLYYQIAHLKQQRMEIAIFELIFVNGKILTADKFLIAVGTRPAR  209

Query  161  KELSCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RS  217
            ++     G+    SD I W   K  P + +VVGA  + +E A  +  + G +V V+  R 
Sbjct  210  RDDIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRK  269

Query  218  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFD  277
             +L   D+++   +  Y   Q+G  F  +   + +      ++++   +  G++     D
Sbjct  270  EILEMADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNKDEVIIHLNS--GKTI--VGD  324

Query  278  TVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSNIYALGDVIDAPELTPVA  336
             +L   GR  +   L L   G++  +K G I V +N QTS  +IYA GD    P L   +
Sbjct  325  GLLYTVGRQGNTEGLDLSAIGLQ-TDKRGLIKVNENFQTSVPHIYAAGDCTGFPALASTS  383

Query  337  IQAGRLLSRRLY----NNSTAQ---MDYEKVCT----------AVFTPIEYGCCGLSE-E  378
            ++ GRL S  +      N++      D + + T           ++T  E    G +E +
Sbjct  384  MEQGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGDFFPFGIYTVPEISMVGKNEYQ  443

Query  379  DSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGFHYLGPNA  437
             +KE         Y       E             ++K+I C  T +  ++G H +G  A
Sbjct  444  LTKEGIA------YEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN--ILGVHAIGEGA  495

Query  438  GEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
             E+     + M  G T +   + V  +PT AE++
Sbjct  496  TEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  529

>PHYKE_2864
Length=486

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 119/497 (24%), Positives = 195/497 (39%), Gaps = 91/497 (18%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVVIG G     C+ E+A  GK+V ++D      + TS  LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD------KKTS--LGGVCVHTGTIPSKTFRE  85

Query  64   SSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            + L +    HH      +      S  T   + ++  V   + S     + +L++  V  
Sbjct  86   AVLHLSGYRHHGFYGKSY------SMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDV  139

Query  123  ENFLGSFVDPHTLELWHHRK---------------GTKQITTRDVVIAVGGRPKE--LSC  165
                  F + H + +                       ++     +IA G RP    L  
Sbjct  140  IPGFARFENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLVP  199

Query  166  PGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMVRSILLRGF  223
              G+  I SD I      + P   +VVGA  + +E A  +  + G+ V V          
Sbjct  200  IDGKVIIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTV----------  249

Query  224  DQDMANKIGEYMEVQSGIEFIRKTVPQSITTLEN-GQLLVKWTNEDGESCEEAFDTVLNA  282
                             ++    T  + +    N G++L             + D +L  
Sbjct  250  -----------------VDGRPDTTDKRVKVFFNSGKVL-------------SADALLYT  279

Query  283  TGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSNIYALGDVIDAPELTPVAIQAGR  341
             GR      L L+  G+  N + G I V KN QT   +IYA GD I AP L   +++ GR
Sbjct  280  VGRQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGR  338

Query  342  LLSRRLYN-----NSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGED--NVEVYHT  394
            L S  ++N      +T+Q++       ++T  E    G +E    ++  +D  N E+   
Sbjct  339  LASCHMWNPDEELAATSQLESGNYPYGIYTIPEISMVGQTE----QQLTKDCVNYEIGIA  394

Query  395  NFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTY  454
             +   E +  +   +     +K++ D    K V G H +G  A E+     +AM +G + 
Sbjct  395  KYS--ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMGCSL  451

Query  455  DQMVDTVGIHPTTAESF  471
                D V  +PT AE++
Sbjct  452  TYFRDAVFNYPTLAEAY  468

>HYAP_04149
Length=564

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 123/520 (24%), Positives = 214/520 (41%), Gaps = 70/520 (13%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ ++A  G  V ++D            LGG CV+ G +P K 
Sbjct  50   SEHFDLIVIGSGPAGQKCAIDSAKHGYSVAIVD--------KRDMLGGVCVHTGTVPSKT  101

Query  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120
              +++L      H +   G      G +     + ++  V+   K+     + +L    V
Sbjct  102  FREAALHLTGYRHRAFYNGQ----AGPSKRVGVEDILQRVNKVEKAETDITRHQLMRNGV  157

Query  121  KYENFLGSFV--DPHTLELWHH----------RKGTKQITTR-----DVVIAVGGRP-KE  162
            +       F+  + H + +  +          R  +  I  R     + ++ VG RP + 
Sbjct  158  QLITGTARFMPGNSHMIAVLSNESYETATDAKRHSSANICKRVLTADNFLVCVGTRPARR  217

Query  163  LSCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSI  218
               P  GE    SD + W K K  P + +VVGA  V +E A  +  + G +V V+  R  
Sbjct  218  ADIPFDGETIFDSDQLLWGKVKAVPRRLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKE  277

Query  219  LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDT  278
            +L   D++++  +  Y   Q+G  F+   V +S+     G++ V    E G++     D 
Sbjct  278  ILEMADKEVSEALC-YSMAQTGTRFLVDEVIKSVEKSAKGEVGVHL--ESGKTV--VGDG  332

Query  279  VLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYA---------LGDVID  328
            +L   GR  +V  L L+  G+   +K GRI V N  QT+  ++YA          GD+I 
Sbjct  333  LLYTVGRQGNVEGLNLEAVGLA-PDKRGRIIVDNNFQTAVPHMYAQSRLIADQNAGDIIG  391

Query  329  APELTPVAIQAGRLLSRRLYNNST---------AQMDYEKVCTAVFTPIEYGCCGLSEED  379
             P L   +++ GRL S  +  + +          +MD            E    G+    
Sbjct  392  FPALASTSMEQGRLASVHMRTSKSFYTKEISDDKKMDDPDRVRTRMRSGEVFPFGIYTVP  451

Query  380  SKERFGEDNVEVYHTNFVPLEWSLSETRTSAES-------CYVKVI-CDKTRDKFVVGFH  431
                 G++  ++     VP E  ++     A+         ++K+I C KT    ++G H
Sbjct  452  EISMVGKNEQQLTREQ-VPYEVGIARYEELAKGQMLGGVPGFLKIIFCPKTLK--LLGVH  508

Query  432  YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
             +G  A E+     + M    T +   + V  +PT AE++
Sbjct  509  AIGEGATEIIHIGQVVMSTDGTLEYFRNAVFNYPTLAEAY  548

>CCA14030
Length=560

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 130/521 (25%), Positives = 212/521 (41%), Gaps = 83/521 (16%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  YDL+V+G G  G  C+ ++A  GK V ++D  +          GG CV+ G +P K 
Sbjct  52   SEHYDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTVPSKT  103

Query  61   MHQSSLIGEVMHHDSANFGWNVASE----GSAPTFNWKQLVSNVDAYIKSINF-KYKVEL  115
              ++ L   +  H   NF   ++S     G        + V N +  I      +  VEL
Sbjct  104  FREAIL--HLTAHRHRNFYTGMSSPKKRFGIEDILTRVRKVENAETDITRHQLVRNNVEL  161

Query  116  RSKYVKY-----ENFLG----SFVDPHTLELWHHRKGTKQ--ITTRDVVIAVGGRP--KE  162
             +   ++     +N +     S  +  T    H R    Q  +T    +IAVG RP  ++
Sbjct  162  INGTARFLPDPSKNMVAVLSNSSYETATDGNRHFRANICQRILTADKFLIAVGTRPARRD  221

Query  163  LSCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSIL  219
                 G+    SD I W   K  P + +VVGA  + +E A  +  + G +V V+  R  +
Sbjct  222  DVVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEI  281

Query  220  LRGFDQDMANKIGEYMEVQSGIEF-IRKTVP--------QSITTLENGQLLVKWTNEDGE  270
            L   D+++   +  Y   Q+G  F + +T+         + IT L +G+ +V        
Sbjct  282  LEMADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNKDEVITHLNSGKTVVG-------  333

Query  271  SCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSNIYALGDVIDA  329
                  D +L   GR  +   L L   G++  +K G I V +N QTS  +IYA GD    
Sbjct  334  ------DGLLYTVGRQGNTEGLDLSAIGLE-TDKRGLIKVNENFQTSVPHIYAAGDCTGF  386

Query  330  PELTPVAIQAGRLLSRRLY----NNSTAQ---MDYEKVCT----------AVFTPIEYGC  372
            P L   +++ GRL S  +      N+T      D + + T           ++T  E   
Sbjct  387  PALASTSMEQGRLASVHMRTSMPTNTTGHAEPTDPQHMRTRMRSGDFFPFGIYTVPEISM  446

Query  373  CGLSEED-SKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI-CDKTRDKFVVGF  430
             G +E   +KE         Y       E             ++K+I C  T +  ++G 
Sbjct  447  VGKNEHQLTKEGIA------YEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN--ILGV  498

Query  431  HYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  499  HAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  539

>PHYSO_489418
Length=471

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 115/478 (24%), Positives = 202/478 (42%), Gaps = 77/478 (16%)

Query  46   LGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIK  105
            +GG CV+ G +P K   +++L      H +   G      G +  F  + ++  V     
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNG----QAGPSKRFGVEDILQRVKKVED  57

Query  106  SINFKYKVELRSKYVKYENFLGSFV--DPHTL-----ELWHHRKGTKQITTRDV------  152
            +     + +L    V+  N    F+  + H +     E +      K+ T+ D+      
Sbjct  58   AETDITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAKRHTSADICKRVLT  117

Query  153  ----VIAVGGRP-KELSCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLK  205
                ++ VG RP +    P  GE    SD + W K K  P + +VVGA  V +E A  + 
Sbjct  118  ADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMT  177

Query  206  GM-GYEVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVK  263
             + G +V V+  R  +L   D++++  +  Y   Q+G  F+     +S+     G++ V 
Sbjct  178  IIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLVGETIKSVEKTPKGEVFVH  236

Query  264  WTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYA  322
               E G++     D +L   GR  +V  L L+  G+ + +K GRI V N  QT+  +IYA
Sbjct  237  L--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGL-VPDKRGRIKVDNNFQTAVPHIYA  291

Query  323  LGDVIDAPELTPVAIQAGRL----------LSRRLYNNSTAQMDYEKVCT----------  362
             GD+I  P L   +++ GRL          L+ +  ++     D ++V T          
Sbjct  292  AGDIIGFPGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSGEVFPF  351

Query  363  AVFTPIEYGCCGLSEED-SKERFGEDNVEVYHTNFVPLEWSLSETRTSAES-------CY  414
             ++T  E    G +E+  +KE+             VP E  ++     A          +
Sbjct  352  GIYTVPEISMVGKNEQQLTKEQ-------------VPYEVGMARYEELARGQMLGGLPGF  398

Query  415  VKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            +K+I C +T    ++G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  399  LKIIFCPETLK--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>PYAR_16664
Length=577

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 102/390 (26%), Positives = 166/390 (43%), Gaps = 61/390 (16%)

Query  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60
            S  +DL+VIG G  G  C+ + A  GK V ++D            +GG C++ G +P K 
Sbjct  61   SEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIID--------KRDMVGGVCIHTGTVPSKT  112

Query  61   MHQSSLIGEVMHHDS---------ANFG-----WNVASEGSAPT--------FNWKQLVS  98
              ++ L      H S           FG       V    SA T         N  +L++
Sbjct  113  FREAILHLTAHRHRSFYDGESEPKKRFGIEDVLQRVRKVESAETDITRHQLLRNGIELIN  172

Query  99   NVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTLEL--------WHHRKGTKQITTR  150
                +      +  + LR+  ++  N    F+   ++++        +     TK+ T+ 
Sbjct  173  GTARFXXXXCDRALILLRNG-IELINGTARFLPDPSMKMVAVLSNDSYDTPTDTKRHTSA  231

Query  151  DV----------VIAVGGRP-KELSCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVA  197
            D+          +IAVG RP +    P  G+    SD I W      P + +VVGA  + 
Sbjct  232  DICKRVLTADKFLIAVGTRPARREDIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIG  291

Query  198  LECAGFLKGM-GYEVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTL  255
            +E A  +  + G EV V+  R  +L   D+++A  + +Y   QSG  F      +S+   
Sbjct  292  MEYASMMSIIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQSGTRFYTDETIKSVEKA  350

Query  256  ENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVK-NEQ  314
             NG+++VK  +  G++     D +L   GR      L L   G++  +K G + V  N +
Sbjct  351  ANGEVIVKLNS--GKTI--IGDGLLYTVGRQGSTDGLNLAAVGLE-TDKRGLLQVDDNFR  405

Query  315  TSTSNIYALGDVIDAPELTPVAIQAGRLLS  344
            TS  +IYA GD I  P L   +++ GRL S
Sbjct  406  TSVPHIYAAGDCIGYPALASTSMEQGRLAS  435

>HYAP_08069
Length=255

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/219 (27%), Positives = 99/219 (45%), Gaps = 22/219 (10%)

Query  3    DYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61
            DYDLVVIGGG GG   + +AA  G K  CV    K         LGGTC+NVGCIP K +
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVESRGK---------LGGTCLNVGCIPSKAL  84

Query  62   HQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121
              S+ +     H+  ++G +  +     T N+ Q++   +  ++++    +       V 
Sbjct  85   LHSTHLLHTAQHEFKSYGIDAPNV----TANFPQMMKAKEKAVRTLTAGIESLFSKNKVT  140

Query  122  YENFLGSFVDPHTLEL-WHHRKGTKQITTRDVVIAVGGR-----PKELSCPGGEHAISSD  175
            Y   +G       + +    R+G   +T +++++A G       P  +    G+   S+ 
Sbjct  141  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  200

Query  176  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVM  214
             +     + P   +VVGA  + LE     K +G +V V+
Sbjct  201  ALALT--RVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  237

>PYIR_21896
Length=518

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 119/499 (24%), Positives = 200/499 (40%), Gaps = 66/499 (13%)

Query  3    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  62
            +YDLVVIG G     C+ E+A  GK+V V+D            +GG CV+ G IP K   
Sbjct  37   NYDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFR  88

Query  63   QSSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121
            ++ L +    HH      +      S  T     ++  V   + S     +V++      
Sbjct  89   EAVLHLSGYRHHGFYGKSY------SMKTVTIDDILYRVKRVVNS-----EVDISIVRDT  137

Query  122  YENFLGSFVDPHTLELWHHRKGT-KQITTRDVVIAVGGRPKE--LSCPGGEHAISSDDIF  178
             +   G   D       H    T  ++     +IA G RP    L    G+    SD I 
Sbjct  138  PDAAGGDAGDSD-----HDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKVIFDSDQIL  192

Query  179  WMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILLRGFDQDMANKIGEYM  235
                +E P   +VVGA  + +E A  +  + G+ V V+  RS +L   D ++ + +   M
Sbjct  193  SGDIRELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIISNLTYEM  252

Query  236  EVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLD  295
              + G  F+     + +   E+G + V + +    S     D +L   GR      L L+
Sbjct  253  RSK-GARFLLGETIKHVEKTESG-VTVHFNSGKITSA----DALLYTVGRQAATDGLNLE  306

Query  296  KAGVKLNEKSGRIWVKNEQTSTSNI------------------YALGDVIDAPELTPVAI  337
               +  N +      K+ QT+  ++                  YA GD I AP L   ++
Sbjct  307  AVDLSRNPRGLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSLASTSM  366

Query  338  QAGRLLSRRLYNNS----TAQMDYEKVCTAVFTPIEYGCCGLSEED-SKERFGEDNVEVY  392
            + GRL +  +++      T+Q++       ++T  E    G +E+  +KE     N E+ 
Sbjct  367  EQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGL---NFEIG  423

Query  393  HTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  452
               +   E +  +   S     +K++ D T  K   G H +G  A E+     +AM +G 
Sbjct  424  IAKYS--ELAKGQMSGSTAGGMLKILFDPTTLKLF-GVHAIGEGATEIIHIGQVAMAMGC  480

Query  453  TYDQMVDTVGIHPTTAESF  471
            +     D V  +PT AE++
Sbjct  481  SITYFRDAVFNYPTLAEAY  499

>PITG_01778
Length=470

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 114/478 (24%), Positives = 196/478 (41%), Gaps = 77/478 (16%)

Query  46   LGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNV----D  101
            LGG CV+ G +P K   +++L      H +   G      G +  F  + ++  V    D
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNG----QAGPSRRFGVEDILQRVRKVED  57

Query  102  A---YIKSINFKYKVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDV------  152
            A     +    +  V+L +   ++     + V   + E +      K+ T+ D+      
Sbjct  58   AETDITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETATDAKRHTSADICKRVLT  117

Query  153  ----VIAVGGRP-KELSCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLK  205
                ++ VG RP +    P  GE    SD + W   K  P + ++VGA  V +E A  + 
Sbjct  118  ADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMMT  177

Query  206  GM-GYEVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVK  263
             + G +V V+  R  +L   D+ ++  +  Y   Q+G  F+     +S+     G++   
Sbjct  178  IIPGTDVTVIDGRQEILNMADKQVSEALC-YSMAQTGTRFLTGETIKSVEKSPKGEVFAH  236

Query  264  WTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYA  322
               E G++     D +L   GR  +V  L L+  G+   +K GRI V N  QT+  +IYA
Sbjct  237  L--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAVPHIYA  291

Query  323  LGDVIDAPELTPVAIQAGRLLSRRL----------YNNSTAQMDYEKVCT----------  362
             GD+I  P L   +++ GRL S  +           ++     D ++V T          
Sbjct  292  AGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPF  351

Query  363  AVFTPIEYGCCGLSEED-SKERFGEDNVEVYHTNFVPLEWSLSETRTSAES-------CY  414
             ++T  E    G +E+  +KE+             VP E  ++     A          +
Sbjct  352  GIYTVPEISMVGKNEQQLTKEQ-------------VPYEVGVARYEELARGQMLGGVPGF  398

Query  415  VKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            +K+I C  T   F  G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  399  LKIIFCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>PHYSO_562795
Length=415

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 89/332 (27%), Positives = 148/332 (45%), Gaps = 27/332 (8%)

Query  153  VIAVGGRPKE--LSCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-G  208
            +IA G RP    L    G+  I SD I      + P   +V+GA  + +E A  +  + G
Sbjct  80   LIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPG  139

Query  209  YEVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNE  267
            + V V+  R  +L   D+++ + +   M+  +G  F+     + + T EN    VK   +
Sbjct  140  HSVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFLLGETVKKVETTEN---RVKVFFD  195

Query  268  DGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSNIYALGDV  326
             G+    + D +L   GR      L L+  G+  N + G I V +N QT   +IYA GD 
Sbjct  196  SGKVL--SADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNQNYQTDQPHIYAAGDC  252

Query  327  IDAPELTPVAIQAGRLLSRRLYN-----NSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSK  381
            I AP L   +++ GRL S  ++N       T+Q+D       ++T  E    G +E    
Sbjct  253  IGAPALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYGIYTIPEISMVGQTE----  308

Query  382  ERFGED--NVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGE  439
            ++  +D  N EV    +   E +  +   +     +K++ D    K   G H +G  A E
Sbjct  309  QQLTKDCVNYEVGIAKYS--ELAKGQMMGAMAGGTLKILFDPDTLKL-FGVHAIGEGATE  365

Query  440  VTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            +     +AM +G +     D V  +PT AE++
Sbjct  366  IIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  397

>PITG_19065
Length=416

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 88/339 (26%), Positives = 153/339 (45%), Gaps = 27/339 (8%)

Query  146  QITTRDVVIAVGGRPKE--LSCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAG  202
            +I     +IA G RP    L    G+  I SD I      + P   +V+GA  + +E A 
Sbjct  74   RIKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYAS  133

Query  203  FLKGM-GYEVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQL  260
             +  + G+ V V+  R  +L   D+++ + +   M+  +G  F+   + +++  +E    
Sbjct  134  MVNVVPGHTVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVETTDK  189

Query  261  LVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWV-KNEQTSTSN  319
             VK     G++   + D +L   GR      L L+  G+  N + G I V KN QT   +
Sbjct  190  RVKVFFNSGKAL--SADALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPH  246

Query  320  IYALGDVIDAPELTPVAIQAGRLLSRRLYN-----NSTAQMDYEKVCTAVFTPIEYGCCG  374
            IYA GD I AP L   +++ GRL S  ++N      +T+Q++       ++T  E    G
Sbjct  247  IYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVG  306

Query  375  LSEEDSKERFGED--NVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHY  432
             +E    ++  +D  N E+    +   E +  +   +     +K++ D    K V G H 
Sbjct  307  QTE----QQLTKDCVNYEIGIAKYS--ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHA  359

Query  433  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            +G  A E+     +AM +G +     D V  +PT AE++
Sbjct  360  IGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  398

>SPRG_04114
Length=376

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 88/370 (24%), Positives = 160/370 (43%), Gaps = 24/370 (6%)

Query  112  KVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKE--LSCPGGE  169
            + +L++  V     L  F + + + +        ++  +  ++A G RP    L    G+
Sbjct  5    QAQLKAARVDLVPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGK  64

Query  170  HAISSDDIFWMKK-KEPGKTLVVGASYVALECAGFLKGM-GYEVKVMV-RSILLRGFDQD  226
              + SD I      K P   +VVGA  + +E A  L  + G  V V+  R+ +L   D +
Sbjct  65   IILDSDQILNHDTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDE  124

Query  227  MANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRD  286
            + + +   M    G  F+     +S+   +NG   VK     G++     + +L   GR 
Sbjct  125  IVSSLKMEMR-HKGARFLLGESIKSVEHFKNG---VKVEFNSGKAM--FAEALLYCVGRQ  178

Query  287  PDVAKLGLDKAGVKLNEKSGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSR  345
             +   L L+  G+  N + G I V  + QTS  +IYA GD I AP L   +++ GRL + 
Sbjct  179  ANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAAC  237

Query  346  RLYNN---STAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWS  402
             ++++   +T+Q++       ++T  E    G +E+   +     N  V    F      
Sbjct  238  DMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYAVGLAKF----SE  291

Query  403  LSETRTSAE-SCYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  461
            L++ + S +    +K++ D    +  +G H +G  A E+     +AM +        D V
Sbjct  292  LAKGQMSGDIEGILKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKITYFRDAV  350

Query  462  GIHPTTAESF  471
              +PT AE +
Sbjct  351  FNYPTLAEGY  360

>PPTG_24712
Length=67

 Score = 53.5 bits (127),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 3/62 (5%)

Query  4   YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
           YD +VIGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7   YDYMVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  64  SS  65
           ++
Sbjct  64  TA  65

>PITG_19802
Length=185

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 75/164 (46%), Gaps = 9/164 (5%)

Query  309  WVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPI  368
            W      S   I+A+GDVI    L   A + G      +       ++Y  +   ++T  
Sbjct  16   WPLERIKSVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAIPGVIYTFP  74

Query  369  EYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAES-CYVKVICDKTRDKFV  427
            E+   G +EE+ K    E NV  +     P+  + S  RT AE+   VKV+ DK  DK +
Sbjct  75   EFASVGKTEEELKAEGIEYNVGKF-----PM-MANSRARTIAEADGLVKVLADKKTDK-L  127

Query  428  VGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
            +G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  128  LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  171

>HYAP_13613
Length=423

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 91/231 (39%), Gaps = 34/231 (15%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            YDLVVIG G     C+ ++A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  33   YDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  84

Query  64   SSL-IGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKY  122
            + L +    HH      +      S  T   + ++  V   + S     + +L++  V  
Sbjct  85   AVLHLSGYRHHGFYGKSY------SMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDV  138

Query  123  ENFLGSFVDPHTLELW---------------HHRKGTKQITTRDVVIAVGGRPKE--LSC  165
                  F   H + +                ++     ++     ++A G RP    L  
Sbjct  139  IPGFARFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPAHNPLVP  198

Query  166  PGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYEVKVM  214
              G+  I SD I     ++ P   +VVGA  + +E A  +  + G+ V V+
Sbjct  199  IDGKIVIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMINVVPGHSVTVV  249

 Score = 37.0 bits (84),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 69/154 (45%), Gaps = 14/154 (9%)

Query  325  DVIDAPELTPVAIQAGRLLSRRLY-----NNSTAQMDYEKVCTAVFTPIEYGCCGLSEED  379
            D I AP L   +++ GRL S  ++     +  T+Q++       ++T  E    G +E+ 
Sbjct  259  DCIGAPALASTSMEQGRLASCHMWEVDEEHAGTSQLENGNYPYGIYTIPEISMVGQTEQ-  317

Query  380  SKERFGED--NVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGPNA  437
               +  +D  N E+    +   E +  +   +     +K++ D    K V+G H +G  A
Sbjct  318  ---QLTKDCVNYEIGIAKYS--ELAKGQMMGAMAGGTLKILFDPDTLK-VLGVHAIGEGA  371

Query  438  GEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
             E+     +AM +G +     D V  +PT AE++
Sbjct  372  TEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  405

>PYIW_27568
Length=128

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 8/120 (7%)

Query  353  AQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAES  412
              ++Y  +   ++T  E    G +EE  KE     NV  +     P+  + S  R   E+
Sbjct  2    GHVNYNAIPGVIYTFPEVASVGKTEEQLKEEGVAYNVGKF-----PM-MANSRARAVGEA  55

Query  413  -CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
               VKVI DK  DK ++G H +  NAGE+     L M+ G   + +  T   HPT +E+F
Sbjct  56   DGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHPTLSEAF  114

>SPRG_04231
Length=90

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (56%), Gaps = 0/52 (0%)

Query  423  RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  474
            +DK VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  60

>SPRG_17626
Length=148

 Score = 43.5 bits (101),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 8/120 (7%)

Query  353  AQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAES  412
              ++Y  +   V+T  E    G +EE+ K      NV  Y+    P+  + S  RT  E+
Sbjct  22   GHVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGKFPM-MANSRARTVGET  75

Query  413  -CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  471
              +VK++  K  DK ++G H +  NAGE+     L ++ G + + +  T   HPT +E+F
Sbjct  76   DGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEAF  134

>HYAP_08068
Length=100

 Score = 42.4 bits (98),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 2/69 (3%)

Query  404  SETRTSAES-CYVKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  462
            S  RT AE+   VKV+ DK  DK ++G H +  NAGE+     + ++ G   + +  T  
Sbjct  4    SRARTVAEADGMVKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCH  62

Query  463  IHPTTAESF  471
             HPT +E+F
Sbjct  63   AHPTLSEAF  71

>PHYSO_507629
Length=703

 Score = 41.6 bits (96),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 71/161 (44%), Gaps = 21/161 (13%)

Query  91   FNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITTR  150
            FN  + +   + + +++ + ++ +L+ K VK +  LG  V+   L      K        
Sbjct  413  FNMAKTIPGKEEFYETLRY-FEKQLKLKGVKVK--LGQRVESADLAAGGFDK--------  461

Query  151  DVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMG  208
             VVIA G  P+EL  PG +H      I  +K K P   K  V+GA  +  + A F+  +G
Sbjct  462  -VVIATGVLPRELKIPGADHPKVLSYIDVLKNKAPVGKKVAVIGAGGIGFDVAEFITHVG  520

Query  209  YEVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  249
                  V +   R +  DM N       V+ G+  I+ ++P
Sbjct  521  ESTSSSVDA-FAREWGIDMTN------SVRGGVAGIKPSIP  554

>PYU1_G014369
Length=703

 Score = 40.4 bits (93),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 78/164 (48%), Gaps = 18/164 (11%)

Query  152  VVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP-GKTL-VVGASYVALECAGFLKGMGY  209
            VVIA G  P++L  PGG+H+     I  +K K P GK + V+GA  +  + + FL  +G 
Sbjct  462  VVIATGVLPRDLKIPGGDHSKVLSYIDVLKHKAPVGKRVAVIGAGGIGFDVSEFLTHIGK  521

Query  210  EVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDG  269
               + V ++  + +  D +N       V+ G++ +++ VP     +    L+ + + + G
Sbjct  522  SASLDV-NLFAKEWGIDTSN------SVRGGVQGVKQEVPAPEREV---YLMQRKSTKHG  571

Query  270  ESCEEAFDTVLNATGRDPDVAKLG------LDKAGVKLNEKSGR  307
            +   +    +   + +  DV  +G      +D AG+   +K G+
Sbjct  572  KDLGKTTGWIHRLSLKHRDVKMIGGVNYDKVDDAGLHYTDKEGK  615

>SPRG_18643
Length=85

 Score = 37.0 bits (84),  Expect = 0.024, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  1   SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLD  33
           S  +DLVVIG G  G  C+ ++A  GKKV ++D
Sbjct  46  SEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIID  78

>CCI40989
Length=552

 Score = 40.0 bits (92),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 61/136 (45%), Gaps = 21/136 (15%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            +D V+IGGG  GL  +   A  GK+VCVL+            +GG  V     P  L  +
Sbjct  14   WDAVIIGGGHNGLVAAAYLAKAGKQVCVLE--------KRHVIGGAAVTEEIFPGFLFSR  65

Query  64   SSLIGEVMHHDSANF------GWNVASE--GS-APTFNWKQLV--SNVDAYIKSINFKYK  112
            +S +  +   D   +      G ++ S   GS  PT N K L+  S+++   +SI    K
Sbjct  66   ASYVFSLFRPDIIEYLELKRRGLHIYSRDPGSFTPTLNQKSLLLWSDMEKTQQSIGQFSK  125

Query  113  VE--LRSKYVKYENFL  126
             +  +  KY+K   FL
Sbjct  126  ADALMYPKYIKDLEFL  141

>PYU1_G000378
Length=1070

 Score = 38.9 bits (89),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 87/177 (49%), Gaps = 14/177 (8%)

Query  189  LVVGASYVALECAGFLKGMGYEVKVMVR--SILLRGFDQDMANKIGEYMEVQSGIEFIRK  246
            LV+G   + LE A  +  +   V+++ R   ++ R  D   A  +   +  + GIE +  
Sbjct  160  LVIGGGLLGLEAAKAIHDLQLSVRIVNRGSRLMSRQLDDAGAKVLHNEIVSKFGIEVLYH  219

Query  247  TVPQSI--TTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEK  304
               + I  TT+  G   V +T  DGES ++ F  V  ATG  P    LG D +G+ + ++
Sbjct  220  KTTKYIHGTTVVEG---VDFT--DGESYDDVFMIVF-ATGIKPR-DDLGRD-SGLDVAQR  271

Query  305  SGRIWVKNE-QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360
             G I V +  +TS  ++YA+G+ +   ++T   +  G  ++  L  N TA  D EKV
Sbjct  272  GGGILVNDLLETSHKDVYAIGECVSHRDVTYGLVAPGYEMADNLAKNFTANGD-EKV  327

>PHALS_10960
Length=702

 Score = 38.5 bits (88),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 49/226 (22%), Positives = 95/226 (42%), Gaps = 32/226 (14%)

Query  91   FNWKQLVSNVDAYIKSIN-FKYKVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITT  149
            FN  +++   + + +++  F+ +++L    VK+    G  VD   L      K       
Sbjct  413  FNMAKIIPGKEEFHETLRYFQKQLKLNGVNVKH----GRRVDAADLTAGDFDK-------  461

Query  150  RDVVIAVGGRPKELSCPGGEH--AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGM  207
              VV+A G  P+ L  PG +H   +S  D+   K K   +  ++GA  +  + A FL  +
Sbjct  462  --VVMASGVLPRPLKIPGADHPMVLSYMDVLKKKSKVGQRVAIIGAGGIGFDVAEFLTHV  519

Query  208  GYEVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNE  267
            G      V  +  R +  D  N       V+ G+  I+ +VP     +    L+ + + +
Sbjct  520  GESTSSSV-EVFAREWGIDTTN------SVRGGVAGIKSSVPPPAREI---YLMQRKSTK  569

Query  268  DGESCEEAFDTVLNATGRDPDVAKLG------LDKAGVKLNEKSGR  307
             G+   +    +   + +  +V  +G      +D AG+   +KSG+
Sbjct  570  HGKDLGKTTGWIHRLSLKHRNVKMIGGVSYDKVDDAGLHYTDKSGK  615

>PITG_00703
Length=703

 Score = 38.1 bits (87),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 71/168 (42%), Gaps = 21/168 (13%)

Query  84   SEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTLELWHHRKG  143
            +E     FN  + +   + + +++ + ++ +L+ K VK +  LG  V+   L      K 
Sbjct  406  AEAIGGQFNMAKTIPGKEEFYETLRY-FEKQLKLKGVKVK--LGQHVEAADLTTGAFDK-  461

Query  144  TKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECA  201
                    VVIA G  P+ L  PG +H      +  +K K P   K  ++GA  +  + A
Sbjct  462  --------VVIATGVLPRALKIPGADHPKVLSYLDVLKNKAPVGNKVAIIGAGGIGFDVA  513

Query  202  GFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  249
             FL  +G      V  +  R +  D  N       V+ G+  ++ ++P
Sbjct  514  EFLAHVGESTSSSV-DVFAREWGIDTTN------SVRGGVAGVKPSIP  554

>PPTG_08060
Length=725

 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 68/162 (42%), Gaps = 23/162 (14%)

Query  91   FNWKQLVSNVDAYIKSIN-FKYKVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITT  149
            FN  + +   + + +++  F+ +++L+   VK    LG  V+   L      K       
Sbjct  435  FNMAKTIPGKEEFYETLRYFEKQLKLKGVNVK----LGQHVEAADLTTGAFDK-------  483

Query  150  RDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGM  207
              VVIA G  P+ L  PG +H      I  +K K P   K  ++GA  +  + A FL  +
Sbjct  484  --VVIATGVLPRTLKIPGADHPKVLSYIDVLKHKAPVGKKVAIIGAGGIGFDVAEFLSHV  541

Query  208  GYEVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  249
            G      V  +  R +  D  N       V+ G+  I+ ++P
Sbjct  542  GESTSSSV-DVFAREWGIDTTN------SVRGGVAGIKPSIP  576

>PYAP_17256
Length=705

 Score = 37.4 bits (85),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 37/164 (23%), Positives = 75/164 (46%), Gaps = 18/164 (11%)

Query  152  VVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  209
            V++A G  P++L  PG +H      I  +K K P   K  V+GA  +  + + ++   G 
Sbjct  464  VIVATGVLPRDLKIPGADHPKVVSYIDVLKHKVPVGKKVAVIGAGGIGFDVSEYVTHHGK  523

Query  210  EVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDG  269
               + V ++  + +  D+ N       V+ GI  ++  +P+S   +    LL + + + G
Sbjct  524  SPSLDV-NLFAKEWGFDVTN------SVRGGIAGVKPEIPESPREV---YLLQRKSTKHG  573

Query  270  ESCEEAFDTVLNATGRDPDVAKLG------LDKAGVKLNEKSGR  307
            +   +    +  A+ +  DV  +G      +D AG+ + +K G+
Sbjct  574  KDLGKTTGWIHRASLKARDVKMIGGVKYDKVDDAGLHITDKKGQ  617

>PHYKE_6590
Length=1054

 Score = 37.4 bits (85),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 80/167 (48%), Gaps = 12/167 (7%)

Query  199  ECAGFLKGMGYEVKVMVR--SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSIT-TL  255
            E A  +  +   V+++ R   ++ R  D+D A  +   +  + GI+ + +   Q I  T 
Sbjct  183  EAAKAVHDLHVSVRIINRGTRLMSRQLDEDGAKVLHNEIVNKFGIDVLYEKSTQGILGTK  242

Query  256  ENGQLLVKWTNEDGESCEEAFDTVLNATGRDP--DVAKLGLDKAGVKLNEKSGRIWVKNE  313
            ENG   V++TN  GE+ ++    ++ ATG  P  ++A      +G++L ++ G +     
Sbjct  243  ENGVEGVEFTN--GETFDDVC-MIIFATGIKPRDELAH----SSGLELAKRGGILINDYL  295

Query  314  QTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360
            + STSN+YALG+ I     T   +  G  ++  L  N       ++V
Sbjct  296  ECSTSNVYALGECISHRNATYGLVAPGYEMADTLAKNLNCSSSTDRV  342

>PHYRA_72196
Length=691

 Score = 36.6 bits (83),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 70/164 (43%), Gaps = 18/164 (11%)

Query  152  VVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  209
            VVI+ G  P+ L  PG +H      I  +KKK P   K  ++GA  +  + A F+  +G 
Sbjct  462  VVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKVAIIGAGGIGFDVAEFITHVGE  521

Query  210  EVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDG  269
                 V +   R +  D  N       V+ G+  I+ ++P     +    L+ + + + G
Sbjct  522  STSSSVDA-FAREWGIDTTN------SVRGGVAGIKSSIPPPPREV---YLMQRKSTKHG  571

Query  270  ESCEEAFDTVLNATGRDPDVAKLG------LDKAGVKLNEKSGR  307
            +   +    +   + +  DV  +G      +D AG+   +K G+
Sbjct  572  KDLGKTTGWIHRLSLKHRDVKMIGGVSYDKVDGAGLHYTDKKGK  615

>PHYCA_524942
Length=1028

 Score = 36.6 bits (83),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 46/173 (27%), Positives = 79/173 (46%), Gaps = 23/173 (13%)

Query  192  GASYVALECAGFLKGMGYEVKVMVRSI------LLRGFDQDMANKIGEYMEVQSGIEFI-  244
            G     +E AG  K + +++ V VR I      + R  D D A  +   +  + GI+ + 
Sbjct  148  GEKQAKIEAAGAAKAV-HDLNVSVRIINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLY  206

Query  245  RKTVPQSITTLENGQLLVKWTNEDGESCEEAFD---TVLNATGRDP--DVAKLGLDKAGV  299
             K+  + I + ENG   V++TN       E FD    ++ ATG  P  ++A      +G+
Sbjct  207  EKSTQEIIGSQENGVEAVQFTNG------ERFDDICMIIFATGIKPRDELAH----SSGL  256

Query  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNST  352
            +L  + G +     + S  ++YALG+ I   +LT   +  G  ++  L  N T
Sbjct  257  ELGNRGGILINDFLECSVPDVYALGECISHRDLTYGLVAPGYEMADVLAKNFT  309

>PYAP_15943
Length=139

 Score = 34.7 bits (78),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  4   YDLVVIGGGSGGLACSKEAASFGKKVCVLD  33
           +D VV+GGG  GL  +   A  GK+VCVL+
Sbjct  14  WDAVVVGGGHNGLVAAAYLAKAGKRVCVLE  43

>PHYRA_87328
Length=486

 Score = 35.8 bits (81),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 70/164 (43%), Gaps = 18/164 (11%)

Query  152  VVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  209
            VVI+ G  P+ L  PG +H      I  +KKK P   K  ++GA  +  + A F+  +G 
Sbjct  245  VVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKVAIIGAGGIGFDVAEFITHVGE  304

Query  210  EVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDG  269
                 V +   R +  D  N       V+ G+  I+ ++P     +    L+ + + + G
Sbjct  305  STSSSVDA-FAREWGIDTTN------SVRGGVAGIKSSIPPPPREV---YLMQRKSTKHG  354

Query  270  ESCEEAFDTVLNATGRDPDVAKLG------LDKAGVKLNEKSGR  307
            +   +    +   + +  DV  +G      +D AG+   +K G+
Sbjct  355  KDLGKTTGWIHRLSLKHRDVKMIGGVSYDKVDGAGLHYTDKKGK  398

>CCI50227
Length=707

 Score = 35.4 bits (80),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query  164  SCPGGEHAISSDD-IFWMKKKEPGKTLVVGASYVALECAGF---LKGMGYEVKVMVRSIL  219
            S   GE   S DD I  M++ +PG   V G S  A+E + F   LK  GYEV  MV +I 
Sbjct  445  STKSGEEMTSLDDYISRMQENQPGIYYVTGESKKAVENSPFLEKLKKKGYEVIYMVEAI-  503

Query  220  LRGFDQDMANKIGEY  234
                D+    ++ EY
Sbjct  504  ----DEYAVQQLKEY  514

>PHALS_12308
Length=526

 Score = 35.0 bits (79),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 46/103 (45%), Gaps = 7/103 (7%)

Query  229  NKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPD  288
            N++ ++M  QS I    K  P  +  +   Q L+       E+CE+ F T  N  GR  D
Sbjct  71   NRLQDWMAEQSQIS---KGRPWVLRIIGRPQTLII---TSPEACEDVFKTQFNVFGRGDD  124

Query  289  VAKLGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPE  331
            +  L  D  G  +    G  W+K  + + S ++++  + D  E
Sbjct  125  LVDLQHDIFGEGVAGVDGEKWIKQRRIA-SRMFSMKMLRDVME  166

>HYAP_03065
Length=701

 Score = 34.3 bits (77),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 16/117 (14%)

Query  91   FNWKQLVSNVDAYIKSIN-FKYKVELRSKYVKYENFLGSFVDPHTLELWHHRKGTKQITT  149
            FN  ++V   + + +++  F+ +++LR   VK    LG  V+   L      K       
Sbjct  411  FNMAKIVPGKEEFYETLRYFEKQLKLRGVNVK----LGHRVEAAELMSGAFDK-------  459

Query  150  RDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFL  204
              VVIA G  P+ L+ PG +H      I  +K + P   K  ++GA  +  + A FL
Sbjct  460  --VVIATGVVPRSLTIPGADHPKVLSYIDVLKNEAPVGQKVAIIGAGGIGFDVAEFL  514

>PITG_02760
Length=165

 Score = 33.1 bits (74),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  4   YDLVVIGGGSGGLACSKEAASFGKKVCVLD  33
           +D +V+GGG  GL  +   A  GK VCVL+
Sbjct  12  WDAIVVGGGHNGLVAASYLAKAGKSVCVLE  41

>PYVX_18330
Length=558

 Score = 33.9 bits (76),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 55/138 (40%), Gaps = 20/138 (14%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            +D +V+GGG  GL  +   A  GK+VCVL+            +GG  V    IP     +
Sbjct  13   WDAIVVGGGHNGLVAASYLAKAGKQVCVLE--------KRHVVGGAAVTEEIIPGFKFSR  64

Query  64   SSLIGEVMHH------DSANFGWNVASEGSA---PTFNWKQLV--SNVDAYIKSINFKYK  112
            +S +  +         D    G  V     +   PT + + L+  S++ A  +SI  ++ 
Sbjct  65   ASYVFSLFRPQIIKDLDLYRHGLEVYPRNPSSFTPTLDGRSLILGSDMQASQRSIA-QFS  123

Query  113  VELRSKYVKYENFLGSFV  130
                  Y KY   L   V
Sbjct  124  AADAEAYPKYNAMLDDMV  141

>PYU1_G004385
Length=562

 Score = 33.9 bits (76),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  4   YDLVVIGGGSGGLACSKEAASFGKKVCVLD  33
           +D +V+GGG  GL  +   A  GK+VCVL+
Sbjct  13  WDAIVVGGGHNGLVAAAYLAKAGKQVCVLE  42

>PYAP_22849
Length=1089

 Score = 33.9 bits (76),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 82/169 (49%), Gaps = 9/169 (5%)

Query  189  LVVGASYVALECAGFLKGMGYEVKVMVR--SILLRGFDQDMANKIGEYMEVQSGIEFIRK  246
            L+VG   + LE A  +  +G  V+++ R   ++ R  D   A  +   +E + GIE +  
Sbjct  173  LIVGGGLLGLEAAKAIHDLGLGVRIINRGGRLMSRQLDDAGAKVLQLEIERKFGIEVLYN  232

Query  247  TVPQSITTLENGQLL-VKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKS  305
               QS+   +NG +  +++T  DG +  + F  V+ ATG  P   +LG    G+++  + 
Sbjct  233  KTTQSLID-DNGCVGGIEFT--DGTNMRDVF-LVVFATGIIPR-DELGA-SGGLRVARRR  286

Query  306  GRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQ  354
            G +     +T+   +YALG+ +   ++T   +  G  ++  L  N T+ 
Sbjct  287  GIVVNDQLETTVGGVYALGECVSHRDVTYGLVAPGYEMADILAKNLTSH  335

>SDRG_05159
Length=551

 Score = 33.5 bits (75),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 54/139 (39%), Gaps = 20/139 (14%)

Query  4    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
            +D V++GGG  GL  +   A  GK VCVL+            LGG  V    IP     +
Sbjct  15   WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPDFHFSR  66

Query  64   SSLIGEVMHH------DSANFGWNVASEGSA---PTFNWKQLV--SNVDAYIKSINFKYK  112
            +S +  +         D    G  +     +   P  N + L+  S++ A   SI    K
Sbjct  67   ASYVFSLFRPQIIRDLDLYRHGLEIYPRDPSSFTPLLNGQSLLLGSDMQANQASIAQFSK  126

Query  113  VELRSKYVKYENFLGSFVD  131
             +  +KY  Y   L   VD
Sbjct  127  AD-AAKYPAYNAMLDRLVD  144

>PHYKE_5677
Length=211

 Score = 32.7 bits (73),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  4   YDLVVIGGGSGGLACSKEAASFGKKVCVLD  33
           +D +V+GGG  GL  +   A  GK VCVL+
Sbjct  12  WDAIVVGGGHNGLVAAAYLAKAGKNVCVLE  41

>PYVX_21196
Length=604

 Score = 33.1 bits (74),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 9/100 (9%)

Query  152  VVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  209
            VV+A G  P+ L  PG +H+     I  +K K P   K  V+GA  +  + + FL   G 
Sbjct  461  VVMATGVLPRALKIPGSDHSKVLSYIDVLKNKAPVGEKVAVIGAGGIGFDVSEFLTHKGK  520

Query  210  EVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  249
               + +  +  R +  D  N       V+ G+  +  +VP
Sbjct  521  SASLDI-DLFAREWGIDTTN------SVRGGVAGVTPSVP  553

>PHYSO_317690
Length=1057

 Score = 33.1 bits (74),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 76/164 (46%), Gaps = 22/164 (13%)

Query  209  YEVKVMVRSI------LLRGFDQDMANKIGEYMEVQSGIEFI-RKTVPQSITTLENGQLL  261
            +++KV VR I      + R  D D A  +   +  + GI+ +  K+  + + + ENG   
Sbjct  192  HDLKVAVRVINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLYDKSTQEILGSEENGVEA  251

Query  262  VKWTNEDGESCEEAFDTV---LNATGRDP--DVAKLGLDKAGVKLNEKSGRIWVKNEQTS  316
            V++TN       E FD V   + ATG  P  ++A      +G++L ++ G +     + S
Sbjct  252  VQFTNG------ERFDDVCMIIFATGIKPRDELAH----SSGLELAKRGGILINDYLECS  301

Query  317  TSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360
              ++YALG+ I     T   +  G  ++  L  N T +   +++
Sbjct  302  APSVYALGECISHRNFTYGLVAPGYEMADTLAKNFTCRSPEDRI  345

>H310_07705
Length=546

 Score = 33.1 bits (74),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 8/64 (13%)

Query  4   YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
           +D +V+GGG  GL  +   A  GK VCVL+            LGG  V    +P     +
Sbjct  12  WDAIVVGGGHNGLVAATYLAKAGKAVCVLE--------KRHVLGGAAVTEEIVPNFRFSR  63

Query  64  SSLI  67
           +S +
Sbjct  64  ASYV  67

>SPRG_08354
Length=550

 Score = 32.7 bits (73),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 29/64 (45%), Gaps = 8/64 (13%)

Query  4   YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  63
           +D V++GGG  GL  +   A  GK VCVL+            LGG  V    IP     +
Sbjct  15  WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPNFHFSR  66

Query  64  SSLI  67
           +S +
Sbjct  67  ASYV  70

>PPTG_05518
Length=554

 Score = 32.7 bits (73),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  4   YDLVVIGGGSGGLACSKEAASFGKKVCVLD  33
           +D +V+GGG  GL  +   A  GK VCVL+
Sbjct  12  WDAIVVGGGHNGLVAAAYLAKAGKSVCVLE  41

>PYVX_22491
Length=1640

 Score = 32.7 bits (73),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 34/76 (45%), Gaps = 5/76 (7%)

Query  327  IDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDSKERFGE  386
            + AP   P ++ A +   R L + +  + + E VC AVF    +     S ED+ +R G 
Sbjct  774  LRAPPSEPPSMYALQTTPRDLPSQALLRKEVESVCAAVFASASHRAAVESAEDADDRDGS  833

Query  387  -----DNVEVYHTNFV  397
                 DN E+  T  V
Sbjct  834  HLLFLDNAEILLTFVV  849

>H257_04036
Length=1049

 Score = 32.7 bits (73),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (52%), Gaps = 5/62 (8%)

Query  5    DLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQS  64
            D+V+ GGG+G  +C  +    G     ++++   P GT+  + G  + VG  P+ L H  
Sbjct  442  DVVLFGGGAGAASCELQVPEPG----TVEFMVAMP-GTTCLINGLPLTVGAAPRPLAHGD  496

Query  65   SL  66
            +L
Sbjct  497  TL  498

>H310_06296
Length=590

 Score = 32.7 bits (73),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 0/31 (0%)

Query  3   DYDLVVIGGGSGGLACSKEAASFGKKVCVLD  33
           D D++VIG G GGL  +   A  GK+V VL+
Sbjct  62  DLDVIVIGSGMGGLTVAAALAKEGKRVLVLE  92

>PHYRA_73603
Length=1159

 Score = 32.7 bits (73),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (53%), Gaps = 1/59 (2%)

Query  377  EEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDKTRDKFVVGFHYLGP  435
            E D +E  G+ +V ++H+N     W   +T+TSA S YV+      RD  ++G  +  P
Sbjct  820  ERDGQEDNGQPSVPLHHSNLDSTRWKQLKTQTSA-SLYVERSSSVHRDDNILGGDWKNP  877

>PYAR_15823
Length=705

 Score = 32.3 bits (72),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query  152  VVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMG  208
            VV+A G  P+EL  PG +H      I  +K   P   K  VVGA  +  + + F+   G
Sbjct  475  VVVATGVEPRELKIPGADHPKVVSYIDVLKHNAPVGKKVAVVGAGGIGFDVSEFVTHHG  533

>PITG_01001
Length=848

 Score = 32.3 bits (72),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 60/126 (48%), Gaps = 16/126 (13%)

Query  229  NKIGEYMEVQSGIEFIRKTVPQSITTLENGQLLVKWTNE-DGESCEEAFDTVLNATGRDP  287
             K+G  ++V+     IR+TV +S TT++N  LL++  ++ D +  E   +T ++    DP
Sbjct  141  RKVGYLLQVEDVTRHIRRTVMRSATTVKNALLLLRLEHQIDRKETER--ETGISEI-EDP  197

Query  288  DVAKLGLDKAGVKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRL---LS  344
            D  +  +D   + +  +  R      +TS     A+  V+D    TP     GRL   L 
Sbjct  198  DTDE-SVDFQSLSVESREYRYEQIEHETS-----AVAHVLDQIASTP---SQGRLRWRLP  248

Query  345  RRLYNN  350
            +R Y N
Sbjct  249  QRCYQN  254

Lambda      K        H        a         alpha
   0.317    0.134    0.406    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 35875641609

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40