Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_8395147581420142065200.0
PPTG_171291475874575927810.0
PHYCA_5114151475874475627350.0
PITG_184581475874775927050.0
PHYRA_810981475874175425690.0
PHYSO_3489031475876677225480.0
HYAP_071041475872169622190.0
PHALS_064761475872675522140.0
PYIW_199691475873369816460.0
PYIR_134181475874770716420.0
PYU1_G0017331475873269116310.0
PYAP_177631475879453414700.0
PHYSO_4749291476048649814660.0
PITG_184611476048249613645e-174
PYAR_135711475866663713766e-173
PYVX_235901475868971012871e-159
PYU1_G0017311476052950210501e-127
CCI44111147585765449673e-115
CCA22843147585865419596e-114
PHYRA_81092147605662408663e-101
PPTG_17131147605772488271e-95
PHYCA_576136147605692418199e-95
PHALS_03627147606012578017e-92
PYAP_17767147605024517382e-84
SPRG_21393147604944697292e-83
PYIR_13420147605152516466e-72
PYIW_14659147605642226498e-72
SPRG_06355147587134616084e-65
PYVX_19188147606252325972e-64
PYAR_13572147605121615812e-63
SDRG_01763147587364665927e-63
SPRG_184151331253361745512e-61
SDRG_12684147605211685629e-61
H257_16579147605701585303e-56
H310_02547147605641585181e-54
CCI44114147603692554014e-41
PPTG_1713014759312983772e-38
PHYSO_29328614759318913753e-38
PITG_1845914759311983692e-37
PHYCA_556164147593011043672e-37
PHYRA_81097111994239983507e-36
PHALS_0647514759223913481e-35
PHYRA_8109314759298983541e-35
HYAP_0710514759271933493e-35
PYU1_G00173214759294903266e-32
PYVX_1919114759296883161e-30
CCA22847147603641213156e-30
PYAR_169921430612922282809e-24
PYIW_175311430614301462692e-22
PYU1_G0074201430613461422631e-21
PYIR_236861430614091462631e-21
PYAP_217451430612981422576e-21
CCA21326143069541522494e-20
SPRG_043681430611422702504e-20
PYAP_17768147591121002214e-20
PYVX_187121430613021422486e-20
CCI45586143069551552477e-20
H310_135971430611911692478e-20
PHYRA_735311430613471372381e-18
PPTG_045371430613282522381e-18
PHYSO_2580361430612713312362e-18
PITG_178821430612891462352e-18
SDRG_096431430611252702307e-18
HYAP_136681430612031352308e-18
PHALS_067751430611851892299e-18
H257_098611430611641342227e-17
CCA228451554824311912088e-16
H257_0049816033712022061e-15
PYIR_1342914759253671982e-15
SDRG_0430416033692022023e-15
SPRG_0734016033652021981e-14
PYVX_1605216032911641913e-14
PHYCA_41956381781401061813e-14
PHALS_0798716033652311925e-14
PHYRA_8652873075226471839e-14
CCI4003916033652441854e-13
PHYRA_7384616033592311829e-13
H310_0129916033782021802e-12
PPTG_0098016033832261802e-12
PHYSO_31344116033612261792e-12
PITG_0182116033722261792e-12
CCA1400216037822441805e-12
PYIR_2163716033542311721e-11
PYAP_2450650375971321732e-11
CCA168341528036131571733e-11
PHYCA_54193716032772521673e-11
SDRG_045751382110032191726e-11
PYVX_2324250375161741696e-11
SPRG_126211382110033171717e-11
PYU1_G00482950376371331698e-11
PHYKE_493516032931811584e-10
CCI422991528036141461635e-10
CCI42301955396011461625e-10
PYVX_215131382114463461637e-10
PYAP_14184221311841921628e-10
H310_082921382110073531611e-09
PYU1_G00566616033381301561e-09
PYAR_1364916033971581571e-09
PHYKE_941067864621601572e-09
PYIW_2457150373901321552e-09
PYAR_1996350375681321572e-09
PYIR_1629050375702451563e-09
PYAP_19866113656371541563e-09
H257_117731382110263551573e-09
PYAP_222301382111164201573e-09
CCA1461833636592221563e-09
PYU1_G00720333635192071545e-09
H257_0193413355510224451546e-09
PYIR_141071382111764161547e-09
PYIW_1716516033562121508e-09
PYAP_15111955397441441521e-08
PPTG_0652533637591871502e-08
PYAR_18942221312011941502e-08
H257_1063867865492231473e-08
PHYRA_7535233635631871473e-08
CCA1695949548581291474e-08
SPRG_04496167837801521466e-08
PYU1_G008908955395161311446e-08
PYIR_2215033637991371456e-08
PITG_0814167865871861448e-08
SPRG_165631315267451521448e-08
PYAR_14788138217953781448e-08
PYIW_1477733638131371441e-07
SDRG_0534967865341671421e-07
PYVX_14776221311431601431e-07
SDRG_079831335559912231431e-07
PYIR_19786221312822031431e-07
SDRG_11933167837721521422e-07
PPTG_1427867865841601412e-07
PYIW_14104221312572001412e-07
CCI4203633637771371412e-07
PYVX_15147955395391301402e-07
SDRG_1436550375521411393e-07
PYIW_23821955396661471393e-07
H310_1091767865491711383e-07
SPRG_1903013355510002231394e-07
H257_167681510711371091274e-07
PYIR_21788113656311791384e-07
PYAR_18160955396311381384e-07
PYAP_175171521910241571385e-07
HYAP_0477767865021601375e-07
CCI4750267866411741375e-07
SPRG_087921265492631141336e-07
SPRG_213941345945261291366e-07
SDRG_137161265492631141326e-07
PHALS_12045113656212091359e-07
SDRG_127021345945101291341e-06
PYU1_G004478221311981991361e-06
SPRG_155861307871631361251e-06
PHALS_0094033637561831342e-06
PHYSO_52936867865831601332e-06
SPRG_122241285241631051242e-06
HYAP_0508633637411371332e-06
PHYCA_57417467864251601312e-06
PHYCA_3795750372351651272e-06
PHYRA_9613650373962331293e-06
PHYSO_35433814554011511293e-06
PHALS_0964367865851571303e-06
CCI1161549544761371294e-06
PHYSO_5090003498401481304e-06
PHYRA_7865067865831861295e-06
SPRG_155851307861461261205e-06
H310_12135167838041481295e-06
PHALS_0980650375371101285e-06
H257_063251252072101411227e-06
PHYSO_349570221311331861288e-06
PHYCA_56993033631431321188e-06
HYAP_0068650375691191278e-06
H310_1109450376061501279e-06
H310_058231255945911861279e-06
PYIW_15966113656191681261e-05
H310_130871265492821091231e-05
H310_092461252072111101211e-05
PYIR_1397117174491431251e-05
PPTG_05282221311051971261e-05
SDRG_0187714554561811251e-05
PITG_0595450375161181251e-05
SDRG_122081307871631091171e-05
H310_142201307861661001171e-05
SDRG_157861285201501081162e-05
PYVX_13738678712831901262e-05
PHALS_08442221313491871252e-05
SDRG_157831307861461261162e-05
PYIR_1890367865971281242e-05
H310_006561345945531531242e-05
PITG_003853498401481242e-05
H310_135961508981471061152e-05
PPTG_107853498731481233e-05
SPRG_0402550375351411223e-05
SPRG_122201285201511081143e-05
PHYCA_12885152194091551213e-05
PYIW_201751521910621731233e-05
PYAR_15755113656061441223e-05
CCA1433767866061751224e-05
PYAR_1379933636261201214e-05
H257_08721961593821941204e-05
SPRG_132671292021511081134e-05
PYVX_180603499481441224e-05
PHYSO_51753750375251181214e-05
PYAR_1399817173431371186e-05
SPRG_12218102182731131176e-05
H310_0141314554381701187e-05
PPTG_0081614554101911187e-05
H257_167601460671391071107e-05
CCI41145678710481751208e-05
PPTG_19631110921221041099e-05
PYU1_G014719102181451061101e-04
H310_00199100942261541131e-04
H257_046221345945121461171e-04
H310_14230147335151971101e-04
SDRG_0560811092121831081e-04
PHYSO_4705331382110843531181e-04
PYVX_15906110921231041081e-04
SDRG_15788102182931081151e-04
SPRG_0250211092121831071e-04
SPRG_0623214553211811151e-04
HYAP_011513492501531131e-04
PYVX_2262333637791941172e-04
SPRG_10648412949241151172e-04
PYIW_157171382111214381172e-04
SDRG_157871285191331261072e-04
PYU1_G01285844073421931152e-04
PPTG_0113117174301401152e-04
H257_18862147335151981072e-04
H257_06670100942281071113e-04
PYIW_1523267865001281143e-04
PITG_02531221311001861153e-04
PYVX_1714114553041351123e-04
PHALS_0128817173861401123e-04
SDRG_157841285221601201064e-04
CCA1911811092125891044e-04
SDRG_1591133635671681134e-04
PYIR_2152354041521011054e-04
PYAP_169971612810181101135e-04
PHYCA_51050611092121831035e-04
PHYSO_28914611092122831035e-04
PHALS_0706211092122831035e-04
PYAR_212541521910351571125e-04
PITG_1366511092122831035e-04
PITG_172501382110463481125e-04
PHYKE_734711092122831035e-04
PYAR_239325404161991056e-04
PHYRA_86211494913031571096e-04
PYAP_150245404170951056e-04
PYIW_159433499351501126e-04
PYU1_G0040453493801491107e-04
H310_0109411092121831027e-04
SPRG_12221128521128981027e-04
SPRG_0180333635701681108e-04
CCI4345611092126891028e-04
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_8395

Length=1420
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_8395                                                            2516       0.0   
PPTG_17129                                                            1075       0.0   
PHYCA_511415                                                          1058       0.0   
PITG_18458                                                            1046       0.0   
PHYRA_81098                                                           994        0.0   
PHYSO_348903                                                          986        0.0   
HYAP_07104                                                            859        0.0   
PHALS_06476                                                           857        0.0   
PYIW_19969                                                            638        0.0   
PYIR_13418                                                            637        0.0   
PYU1_G001733                                                          632        0.0   
PYAP_17763                                                            570        0.0   
PHYSO_474929                                                          569        0.0   
PITG_18461                                                            530        5e-174
PYAR_13571                                                            534        6e-173
PYVX_23590                                                            500        1e-159
PYU1_G001731                                                          409        1e-127
CCI44111                                                              377        3e-115
CCA22843                                                              374        6e-114
PHYRA_81092                                                           338        3e-101
PPTG_17131                                                            323        1e-95 
PHYCA_576136                                                          320        9e-95 
PHALS_03627                                                           313        7e-92 
PYAP_17767                                                            288        2e-84 
SPRG_21393                                                            285        2e-83 
PYIR_13420                                                            253        6e-72 
PYIW_14659                                                            254        8e-72 
SPRG_06355                                                            238        4e-65 
PYVX_19188                                                            234        2e-64 
PYAR_13572                                                            228        2e-63 
SDRG_01763                                                            232        7e-63 
SPRG_18415                                                            216        2e-61 
SDRG_12684                                                            221        9e-61 
H257_16579                                                            208        3e-56 
H310_02547                                                            204        1e-54 
CCI44114                                                              159        4e-41 
PPTG_17130                                                            149        2e-38 
PHYSO_293286                                                          149        3e-38 
PITG_18459                                                            146        2e-37 
PHYCA_556164                                                          145        2e-37 
PHYRA_81097                                                           139        7e-36 
PHALS_06475                                                           138        1e-35 
PHYRA_81093                                                           140        1e-35 
HYAP_07105                                                            139        3e-35 
PYU1_G001732                                                          130        6e-32 
PYVX_19191                                                            126        1e-30 
CCA22847                                                              125        6e-30 
PYAR_16992                                                            112        9e-24 
PYIW_17531                                                            108        2e-22 
PYU1_G007420                                                          105        1e-21 
PYIR_23686                                                            105        1e-21 
PYAP_21745                                                            103        6e-21 
CCA21326                                                              100        4e-20 
SPRG_04368                                                            100        4e-20 
PYAP_17768                                                            89.7       4e-20 
PYVX_18712                                                            100        6e-20 
CCI45586                                                              99.8       7e-20 
H310_13597                                                            99.8       8e-20 
PHYRA_73531                                                           96.3       1e-18 
PPTG_04537                                                            96.3       1e-18 
PHYSO_258036                                                          95.5       2e-18 
PITG_17882                                                            95.1       2e-18 
SDRG_09643                                                            93.2       7e-18 
HYAP_13668                                                            93.2       8e-18 
PHALS_06775                                                           92.8       9e-18 
H257_09861                                                            90.1       7e-17 
CCA22845                                                              84.7       8e-16 
H257_00498                                                            84.0       1e-15 
PYIR_13429                                                            80.9       2e-15 
SDRG_04304                                                            82.4       3e-15 
SPRG_07340                                                            80.9       1e-14 
PYVX_16052                                                            78.2       3e-14 
PHYCA_41956                                                           74.3       3e-14 
PHALS_07987                                                           78.6       5e-14 
PHYRA_86528                                                           75.1       9e-14 
CCI40039                                                              75.9       4e-13 
PHYRA_73846                                                           74.7       9e-13 
H310_01299                                                            73.9       2e-12 
PPTG_00980                                                            73.9       2e-12 
PHYSO_313441                                                          73.6       2e-12 
PITG_01821                                                            73.6       2e-12 
CCA14002                                                              73.9       5e-12 
PYIR_21637                                                            70.9       1e-11 
PYAP_24506                                                            71.2       2e-11 
CCA16834                                                              71.2       3e-11 
PHYCA_541937                                                          68.9       3e-11 
SDRG_04575                                                            70.9       6e-11 
PYVX_23242                                                            69.7       6e-11 
SPRG_12621                                                            70.5       7e-11 
PYU1_G004829                                                          69.7       8e-11 
PHYKE_4935                                                            65.5       4e-10 
CCI42299                                                              67.4       5e-10 
CCI42301                                                              67.0       5e-10 
PYVX_21513                                                            67.4       7e-10 
PYAP_14184                                                            67.0       8e-10 
H310_08292                                                            66.6       1e-09 
PYU1_G005666                                                          64.7       1e-09 
PYAR_13649                                                            65.1       1e-09 
PHYKE_9410                                                            65.1       2e-09 
PYIW_24571                                                            64.3       2e-09 
PYAR_19963                                                            65.1       2e-09 
PYIR_16290                                                            64.7       3e-09 
PYAP_19866                                                            64.7       3e-09 
H257_11773                                                            65.1       3e-09 
PYAP_22230                                                            65.1       3e-09 
CCA14618                                                              64.7       3e-09 
PYU1_G007203                                                          63.9       5e-09 
H257_01934                                                            63.9       6e-09 
PYIR_14107                                                            63.9       7e-09 
PYIW_17165                                                            62.4       8e-09 
PYAP_15111                                                            63.2       1e-08 
PPTG_06525                                                            62.4       2e-08 
PYAR_18942                                                            62.4       2e-08 
H257_10638                                                            61.2       3e-08 
PHYRA_75352                                                           61.2       3e-08 
CCA16959                                                              61.2       4e-08 
SPRG_04496                                                            60.8       6e-08 
PYU1_G008908                                                          60.1       6e-08 
PYIR_22150                                                            60.5       6e-08 
PITG_08141                                                            60.1       8e-08 
SPRG_16563                                                            60.1       8e-08 
PYAR_14788                                                            60.1       8e-08 
PYIW_14777                                                            60.1       1e-07 
SDRG_05349                                                            59.3       1e-07 
PYVX_14776                                                            59.7       1e-07 
SDRG_07983                                                            59.7       1e-07 
PYIR_19786                                                            59.7       1e-07 
SDRG_11933                                                            59.3       2e-07 
PPTG_14278                                                            58.9       2e-07 
PYIW_14104                                                            58.9       2e-07 
CCI42036                                                              58.9       2e-07 
PYVX_15147                                                            58.5       2e-07 
SDRG_14365                                                            58.2       3e-07 
PYIW_23821                                                            58.2       3e-07 
H310_10917                                                            57.8       3e-07 
SPRG_19030                                                            58.2       4e-07 
H257_16768                                                            53.5       4e-07 
PYIR_21788                                                            57.8       4e-07 
PYAR_18160                                                            57.8       4e-07 
PYAP_17517                                                            57.8       5e-07 
HYAP_04777                                                            57.4       5e-07 
CCI47502                                                              57.4       5e-07 
SPRG_08792                                                            55.8       6e-07 
SPRG_21394                                                            57.0       6e-07 
SDRG_13716                                                            55.5       6e-07 
PHALS_12045                                                           56.6       9e-07 
SDRG_12702                                                            56.2       1e-06 
PYU1_G004478                                                          57.0       1e-06 
SPRG_15586                                                            52.8       1e-06 
PHALS_00940                                                           56.2       2e-06 
PHYSO_529368                                                          55.8       2e-06 
SPRG_12224                                                            52.4       2e-06 
HYAP_05086                                                            55.8       2e-06 
PHYCA_574174                                                          55.1       2e-06 
PHYCA_37957                                                           53.5       2e-06 
PHYRA_96136                                                           54.3       3e-06 
PHYSO_354338                                                          54.3       3e-06 
PHALS_09643                                                           54.7       3e-06 
CCI11615                                                              54.3       4e-06 
PHYSO_509000                                                          54.7       4e-06 
PHYRA_78650                                                           54.3       5e-06 
SPRG_15585                                                            50.8       5e-06 
H310_12135                                                            54.3       5e-06 
PHALS_09806                                                           53.9       5e-06 
H257_06325                                                            51.6       7e-06 
PHYSO_349570                                                          53.9       8e-06 
PHYCA_569930                                                          50.1       8e-06 
HYAP_00686                                                            53.5       8e-06 
H310_11094                                                            53.5       9e-06 
H310_05823                                                            53.5       9e-06 
PYIW_15966                                                            53.1       1e-05 
H310_13087                                                            52.0       1e-05 
H310_09246                                                            51.2       1e-05 
PYIR_13971                                                            52.8       1e-05 
PPTG_05282                                                            53.1       1e-05 
SDRG_01877                                                            52.8       1e-05 
PITG_05954                                                            52.8       1e-05 
SDRG_12208                                                            49.7       1e-05 
H310_14220                                                            49.7       1e-05 
SDRG_15786                                                            49.3       2e-05 
PYVX_13738                                                            53.1       2e-05 
PHALS_08442                                                           52.8       2e-05 
SDRG_15783                                                            49.3       2e-05 
PYIR_18903                                                            52.4       2e-05 
H310_00656                                                            52.4       2e-05 
PITG_00385                                                            52.4       2e-05 
H310_13596                                                            48.9       2e-05 
PPTG_10785                                                            52.0       3e-05 
SPRG_04025                                                            51.6       3e-05 
SPRG_12220                                                            48.5       3e-05 
PHYCA_12885                                                           51.2       3e-05 
PYIW_20175                                                            52.0       3e-05 
PYAR_15755                                                            51.6       3e-05 
CCA14337                                                              51.6       4e-05 
PYAR_13799                                                            51.2       4e-05 
H257_08721                                                            50.8       4e-05 
SPRG_13267                                                            48.1       4e-05 
PYVX_18060                                                            51.6       4e-05 
PHYSO_517537                                                          51.2       4e-05 
PYAR_13998                                                            50.1       6e-05 
SPRG_12218                                                            49.7       6e-05 
H310_01413                                                            50.1       7e-05 
PPTG_00816                                                            50.1       7e-05 
H257_16760                                                            47.0       7e-05 
CCI41145                                                              50.8       8e-05 
PPTG_19631                                                            46.6       9e-05 
PYU1_G014719                                                          47.0       1e-04 
H310_00199                                                            48.1       1e-04 
H257_04622                                                            49.7       1e-04 
H310_14230                                                            47.0       1e-04 
SDRG_05608                                                            46.2       1e-04 
PHYSO_470533                                                          50.1       1e-04 
PYVX_15906                                                            46.2       1e-04 
SDRG_15788                                                            48.9       1e-04 
SPRG_02502                                                            45.8       1e-04 
SPRG_06232                                                            48.9       1e-04 
HYAP_01151                                                            48.1       1e-04 
PYVX_22623                                                            49.7       2e-04 
SPRG_10648                                                            49.7       2e-04 
PYIW_15717                                                            49.7       2e-04 
SDRG_15787                                                            45.8       2e-04 
PYU1_G012858                                                          48.9       2e-04 
PPTG_01131                                                            48.9       2e-04 
H257_18862                                                            45.8       2e-04 
H257_06670                                                            47.4       3e-04 
PYIW_15232                                                            48.5       3e-04 
PITG_02531                                                            48.9       3e-04 
PYVX_17141                                                            47.8       3e-04 
PHALS_01288                                                           47.8       3e-04 
SDRG_15784                                                            45.4       4e-04 
CCA19118                                                              44.7       4e-04 
SDRG_15911                                                            48.1       4e-04 
PYIR_21523                                                            45.1       4e-04 
PYAP_16997                                                            48.1       5e-04 
PHYCA_510506                                                          44.3       5e-04 
PHYSO_289146                                                          44.3       5e-04 
PHALS_07062                                                           44.3       5e-04 
PYAR_21254                                                            47.8       5e-04 
PITG_13665                                                            44.3       5e-04 
PITG_17250                                                            47.8       5e-04 
PHYKE_7347                                                            44.3       5e-04 
PYAR_23932                                                            45.1       6e-04 
PHYRA_86211                                                           46.6       6e-04 
PYAP_15024                                                            45.1       6e-04 
PYIW_15943                                                            47.8       6e-04 
PYU1_G004045                                                          47.0       7e-04 
H310_01094                                                            43.9       7e-04 
SPRG_12221                                                            43.9       7e-04 
SPRG_01803                                                            47.0       8e-04 
CCI43456                                                              43.9       8e-04 
PHALS_09273                                                           47.4       8e-04 
PYIR_19933                                                            47.4       8e-04 
H257_00729                                                            43.5       8e-04 
SDRG_15785                                                            43.5       0.001 
PHYRA_85100                                                           43.5       0.001 
PHYRA_85097                                                           43.5       0.001 
CCA24423                                                              47.0       0.001 
PYU1_G011102                                                          46.6       0.001 
PYAP_23744                                                            43.5       0.001 
PYIR_13862                                                            47.0       0.001 
SPRG_06280                                                            44.7       0.001 
H257_08720                                                            46.6       0.001 
PYU1_G014159                                                          45.4       0.001 
HYAP_02360                                                            43.1       0.001 
PYAP_16391                                                            46.6       0.001 
PYVX_14287                                                            46.2       0.001 
H257_02475                                                            46.2       0.002 
SDRG_00432                                                            45.8       0.002 
H257_06044                                                            45.4       0.002 
SPRG_10273                                                            44.7       0.002 
SPRG_12223                                                            42.7       0.002 
PYIW_25138                                                            46.2       0.002 
SDRG_09034                                                            46.2       0.002 
H257_16771                                                            42.4       0.002 
PHYCA_527734                                                          45.4       0.002 
H310_14188                                                            42.7       0.002 
PITG_03652                                                            45.4       0.003 
PPTG_25017                                                            42.4       0.003 
PYAP_18883                                                            45.1       0.003 
PHALS_06798                                                           45.4       0.003 
SDRG_04257                                                            45.4       0.003 
SPRG_01740                                                            43.1       0.003 
SDRG_06173                                                            45.1       0.003 
H310_09961                                                            45.4       0.003 
PHYRA_79989                                                           45.1       0.003 
H310_05453                                                            45.1       0.004 
H310_08803                                                            45.1       0.004 
H257_00369                                                            44.7       0.004 
PYU1_G014717                                                          43.5       0.004 
PYIW_24959                                                            43.9       0.004 
SDRG_03120                                                            42.7       0.004 
PHYSO_310159                                                          44.3       0.005 
PHALS_13792                                                           44.7       0.005 
SPRG_07299                                                            44.7       0.005 
H257_08182                                                            44.7       0.005 
SDRG_02289                                                            44.7       0.006 
SPRG_05086                                                            44.7       0.006 
PYVX_20172                                                            42.0       0.006 
PHYCA_539981                                                          44.3       0.006 
PPTG_11162                                                            44.3       0.007 
H310_14202                                                            41.2       0.007 
PHYSO_479008                                                          43.9       0.007 
PHYSO_484386                                                          43.9       0.008 
PHYCA_40399                                                           41.6       0.008 
PYU1_G002110                                                          43.9       0.008 
PYIW_20712                                                            41.6       0.008 
SPRG_12222                                                            41.6       0.008 
H257_08611                                                            44.3       0.008 
PYIW_17381                                                            43.9       0.008 
SPRG_16689                                                            43.5       0.008 
CCA20519                                                              41.2       0.009 
PHYRA_84786                                                           43.5       0.010 
PYAP_13457                                                            43.9       0.010 
PHYSO_361747                                                          43.9       0.011 
PYU1_G005831                                                          42.4       0.011 
PHALS_03588                                                           43.1       0.011 
PHYSO_481860                                                          43.5       0.011 
HYAP_01912                                                            43.5       0.011 
HYAP_10499                                                            43.5       0.012 
H310_04007                                                            43.5       0.012 
PYU1_G008119                                                          40.4       0.012 
H310_14216                                                            42.4       0.012 
H257_04343                                                            43.1       0.013 
PHYSO_552247                                                          43.1       0.013 
PHYCA_11174                                                           40.8       0.014 
H310_03178                                                            40.8       0.014 
PYIR_15407                                                            40.0       0.014 
H310_13204                                                            43.1       0.014 
H310_00230                                                            43.1       0.014 
PYIW_26522                                                            40.0       0.014 
HYAP_12074                                                            43.1       0.014 
PYAR_23286                                                            43.1       0.015 
PITG_12526                                                            42.7       0.016 
PPTG_08142                                                            42.7       0.016 
PYU1_G013074                                                          40.4       0.017 
SPRG_12219                                                            40.0       0.018 
PYU1_G006347                                                          42.7       0.019 
PHYSO_506720                                                          42.7       0.019 
PYAP_13272                                                            42.7       0.019 
PPTG_11365                                                            42.7       0.020 
PITG_00626                                                            42.4       0.020 
PHALS_07427                                                           42.4       0.021 
PYAP_21067                                                            40.4       0.021 
H310_03858                                                            39.7       0.021 
PHYCA_550557                                                          42.4       0.022 
CCA15045                                                              42.4       0.022 
PHALS_03912                                                           42.4       0.023 
PYVX_20438                                                            42.7       0.023 
PITG_04634                                                            42.4       0.023 
PHYSO_467548                                                          42.4       0.023 
SDRG_12733                                                            41.2       0.024 
PHYKE_6760                                                            42.4       0.024 
H257_18595                                                            41.2       0.024 
SPRG_06956                                                            42.0       0.025 
PYIR_21589                                                            42.4       0.025 
PPTG_09044                                                            42.0       0.027 
SDRG_10555                                                            42.0       0.028 
PITG_21171                                                            39.3       0.031 
PHALS_06406                                                           42.0       0.031 
CCI44752                                                              42.0       0.032 
PYAR_15792                                                            38.9       0.033 
PHYCA_508783                                                          41.6       0.034 
PPTG_17972                                                            42.0       0.035 
PYAP_23559                                                            41.6       0.035 
PHYRA_86937                                                           39.3       0.036 
H257_06721                                                            42.0       0.036 
SPRG_06021                                                            42.0       0.036 
SPRG_13268                                                            39.3       0.039 
SPRG_02214                                                            39.7       0.040 
H257_01770                                                            42.0       0.040 
PYIW_20618                                                            41.2       0.041 
SPRG_10181                                                            41.2       0.044 
PITG_19213                                                            41.6       0.045 
PHYRA_73297                                                           38.5       0.046 
H257_05766                                                            41.2       0.046 
PPTG_19371                                                            41.6       0.047 
SPRG_11900                                                            41.2       0.047 
PYVX_14449                                                            41.2       0.048 
PYIR_19711                                                            41.2       0.049 
CCA18875                                                              41.6       0.050 
PYVX_17243                                                            40.8       0.051 
HYAP_08645                                                            41.6       0.053 
PHYCA_102676                                                          41.2       0.055 
PYIR_23837                                                            41.2       0.056 
H310_02282                                                            40.8       0.057 
PHYSO_562896                                                          40.8       0.057 
H257_16770                                                            38.9       0.059 
PYAR_25043                                                            40.8       0.060 
H257_16772                                                            38.5       0.064 
PYVX_20370                                                            40.8       0.066 
PYU1_G006985                                                          40.8       0.067 
PHYRA_84916                                                           41.2       0.067 
PPTG_18898                                                            41.2       0.067 
HYAP_13689                                                            40.4       0.068 
HYAP_01546                                                            40.8       0.073 
H310_05008                                                            40.8       0.076 
PHYRA_78586                                                           40.4       0.077 
SPRG_05449                                                            40.8       0.077 
PYIW_20221                                                            40.4       0.078 
PHYRA_73694                                                           40.8       0.079 
H310_00231                                                            40.8       0.079 
PITG_06906                                                            40.4       0.081 
PHYRA_84807                                                           40.4       0.082 
PYAR_13553                                                            40.4       0.083 
PHYKE_6913                                                            40.8       0.084 
H257_16773                                                            38.5       0.084 
SDRG_05567                                                            40.8       0.084 
HYAP_06777                                                            40.4       0.088 
PITG_20562                                                            40.4       0.093 
H310_14194                                                            38.1       0.095 
PHYCA_530345                                                          37.7       0.095 
PPTG_13492                                                            40.4       0.095 
H257_16356                                                            40.4       0.095 
PHYSO_532160                                                          37.7       0.098 
CCI47052                                                              40.0       0.10  
H257_12548                                                            40.4       0.10  
PYIR_23836                                                            40.0       0.11  
PYAR_25287                                                            40.0       0.11  
HYAP_05404                                                            40.0       0.11  
HYAP_10316                                                            40.4       0.12  
H257_01635                                                            37.7       0.12  
CCI49028                                                              37.7       0.12  
PPTG_16625                                                            40.0       0.12  
H257_03507                                                            40.0       0.12  
PYAR_22662                                                            39.7       0.12  
PYAP_21581                                                            40.0       0.13  
PYIR_22667                                                            40.0       0.13  
HYAP_11688                                                            40.0       0.14  
PYIW_16440                                                            40.0       0.14  
PYVX_13261                                                            40.0       0.14  
PYIW_18591                                                            40.0       0.15  
SDRG_01249                                                            39.7       0.16  
HYAP_07932                                                            39.7       0.16  
CCI50816                                                              39.7       0.17  
H257_10151                                                            39.7       0.17  
CCI50656                                                              39.7       0.17  
PHYRA_79888                                                           39.7       0.18  
PYIW_21868                                                            39.3       0.19  
PYAR_13510                                                            39.7       0.19  
PYAP_16205                                                            39.3       0.20  
CCA16671                                                              38.5       0.20  
PHALS_12153                                                           39.7       0.20  
CCI44112                                                              38.5       0.20  
HYAP_04114                                                            39.3       0.20  
H257_06722                                                            39.3       0.21  
CCA14533                                                              39.3       0.21  
SDRG_08800                                                            39.3       0.22  
PYVX_16385                                                            39.3       0.23  
PYIR_14494                                                            39.3       0.23  
PPTG_13469                                                            38.9       0.24  
PYAP_17786                                                            38.9       0.24  
CCI47111                                                              38.5       0.24  
H310_09245                                                            37.7       0.25  
PITG_03623                                                            38.9       0.25  
PYAP_17701                                                            38.9       0.25  
PYU1_G006059                                                          38.5       0.27  
PHYKE_2470                                                            38.5       0.27  
H257_13567                                                            38.9       0.28  
SDRG_08955                                                            38.9       0.29  
PHYCA_539465                                                          38.9       0.29  
CCI44448                                                              38.9       0.29  
PYIR_17576                                                            38.5       0.30  
PYU1_G003804                                                          38.9       0.30  
H310_03025                                                            38.9       0.30  
PYU1_G010616                                                          38.9       0.31  
H310_08567                                                            38.5       0.32  
PITG_10726                                                            38.9       0.32  
CCA19566                                                              38.9       0.33  
PHYSO_351007                                                          38.5       0.34  
CCI10928                                                              38.9       0.34  
PITG_01651                                                            37.4       0.34  
PPTG_13255                                                            37.0       0.36  
PYIW_16987                                                            38.5       0.36  
SDRG_10966                                                            36.6       0.37  
PYIR_19809                                                            38.1       0.37  
PYIR_15931                                                            38.5       0.38  
HYAP_11295                                                            38.5       0.38  
SPRG_01072                                                            38.1       0.38  
PYAP_17387                                                            38.5       0.39  
PYAR_17224                                                            38.5       0.40  
SPRG_19406                                                            38.5       0.40  
H310_06378                                                            38.5       0.40  
H257_01632                                                            36.2       0.40  
SDRG_06789                                                            38.5       0.41  
PHYCA_568901                                                          38.5       0.42  
PYAP_13297                                                            36.6       0.42  
SPRG_03714                                                            38.5       0.42  
PHYRA_72612                                                           38.5       0.43  
CCA20877                                                              38.1       0.44  
PYIW_14113                                                            35.8       0.46  
SPRG_05124                                                            38.1       0.47  
SDRG_11004                                                            38.1       0.47  
PITG_06425                                                            36.2       0.47  
SDRG_01407                                                            38.1       0.47  
PYAP_15260                                                            38.1       0.47  
PHYKE_4208                                                            36.6       0.47  
PHALS_12806                                                           38.5       0.48  
PHYSO_552615                                                          38.1       0.48  
PYIW_20181                                                            37.4       0.49  
PPTG_10911                                                            38.1       0.50  

>PHYKE_8395
Length=1420

 Score = 2516 bits (6520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1420/1420 (100%), Positives = 1420/1420 (100%), Gaps = 0/1420 (0%)

Query  1     MTIAPPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD  60
             MTIAPPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD
Sbjct  1     MTIAPPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD  60

Query  61    VQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPT  120
             VQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPT
Sbjct  61    VQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPT  120

Query  121   VFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVFT  180
             VFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVFT
Sbjct  121   VFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVFT  180

Query  181   LPSGGTRAEMPLLDALCFAGIPKELRGRVAEGSEVPLTTDINDRNRARRSSAVLPVQNML  240
             LPSGGTRAEMPLLDALCFAGIPKELRGRVAEGSEVPLTTDINDRNRARRSSAVLPVQNML
Sbjct  181   LPSGGTRAEMPLLDALCFAGIPKELRGRVAEGSEVPLTTDINDRNRARRSSAVLPVQNML  240

Query  241   KDAVGIAEMLVAHDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATR  300
             KDAVGIAEMLVAHDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATR
Sbjct  241   KDAVGIAEMLVAHDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATR  300

Query  301   TFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLALRLWDVYVLLGTPFFF  360
             TFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLALRLWDVYVLLGTPFFF
Sbjct  301   TFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLALRLWDVYVLLGTPFFF  360

Query  361   QASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQSVFA  420
             QASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQSVFA
Sbjct  361   QASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQSVFA  420

Query  421   AFNKLQVIAVESEGSDeerqlerkerqkakkksrnkkkHSDSVQLKDLAFvaapkpkktk  480
             AFNKLQVIAVESEGSDEERQLERKERQKAKKKSRNKKKHSDSVQLKDLAFVAAPKPKKTK
Sbjct  421   AFNKLQVIAVESEGSDEERQLERKERQKAKKKSRNKKKHSDSVQLKDLAFVAAPKPKKTK  480

Query  481   gkknktvnSSQSPAGSPAEETSVADAKREEKQSEVMEPKRALADVIKGpqkngvkvqqpv  540
             GKKNKTVNSSQSPAGSPAEETSVADAKREEKQSEVMEPKRALADVIKGPQKNGVKVQQPV
Sbjct  481   GKKNKTVNSSQSPAGSPAEETSVADAKREEKQSEVMEPKRALADVIKGPQKNGVKVQQPV  540

Query  541   vpqqqkkaasppkqqqsqqkpqqkpqqkqqqppptsvttppaatapqstsEAELGAVYSP  600
             VPQQQKKAASPPKQQQSQQKPQQKPQQKQQQPPPTSVTTPPAATAPQSTSEAELGAVYSP
Sbjct  541   VPQQQKKAASPPKQQQSQQKPQQKPQQKQQQPPPTSVTTPPAATAPQSTSEAELGAVYSP  600

Query  601   TYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLGDQLQRSAEIINGLQNEV  660
             TYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLGDQLQRSAEIINGLQNEV
Sbjct  601   TYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLGDQLQRSAEIINGLQNEV  660

Query  661   TMFRQMCLNLQAELKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVN  720
             TMFRQMCLNLQAELKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVN
Sbjct  661   TMFRQMCLNLQAELKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVN  720

Query  721   VSDDVEDMFYGRSTTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPsashlsns  780
             VSDDVEDMFYGRSTTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPSASHLSNS
Sbjct  721   VSDDVEDMFYGRSTTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPSASHLSNS  780

Query  781   fassyasTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRAELQEVKAEVQTI  840
             FASSYASTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRAELQEVKAEVQTI
Sbjct  781   FASSYASTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRAELQEVKAEVQTI  840

Query  841   RREVMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGsvspstssssdplsAEDRAALTRV  900
             RREVMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGSVSPSTSSSSDPLSAEDRAALTRV
Sbjct  841   RREVMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGSVSPSTSSSSDPLSAEDRAALTRV  900

Query  901   PSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPL  960
             PSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPL
Sbjct  901   PSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPL  960

Query  961   IDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVA  1020
             IDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVA
Sbjct  961   IDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVA  1020

Query  1021  QQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPF  1080
             QQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPF
Sbjct  1021  QQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPF  1080

Query  1081  LLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMI  1140
             LLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMI
Sbjct  1081  LLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMI  1140

Query  1141  SSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGG  1200
             SSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGG
Sbjct  1141  SSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGG  1200

Query  1201  NFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAK  1260
             NFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAK
Sbjct  1201  NFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAK  1260

Query  1261  AKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSAL  1320
             AKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSAL
Sbjct  1261  AKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSAL  1320

Query  1321  CSWLSDPARSEEQFYLSVDDALTALRKLrrsrssgsnsdhshsgssssdgsvpsttshtp  1380
             CSWLSDPARSEEQFYLSVDDALTALRKLRRSRSSGSNSDHSHSGSSSSDGSVPSTTSHTP
Sbjct  1321  CSWLSDPARSEEQFYLSVDDALTALRKLRRSRSSGSNSDHSHSGSSSSDGSVPSTTSHTP  1380

Query  1381  sratssraasskshqrahTRHEPRVNPEFKPMGILKRGKM  1420
             SRATSSRAASSKSHQRAHTRHEPRVNPEFKPMGILKRGKM
Sbjct  1381  SRATSSRAASSKSHQRAHTRHEPRVNPEFKPMGILKRGKM  1420

>PPTG_17129
Length=745

 Score = 1075 bits (2781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/759 (75%), Positives = 639/759 (84%), Gaps = 33/759 (4%)

Query  674   LKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDAD--RFDRNTAMTDTVNVSDDVEDMFYG  731
             +KNKLRSS+LHKKEGAWALDEDSLRL KQ QD D  RFDR+T + DTVNV+DDVE+MFYG
Sbjct  8     IKNKLRSSRLHKKEGAWALDEDSLRL-KQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYG  66

Query  732   RSTTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEE-------EAMTPsashlsnsfass  784
             RST+ +    +SD+P YRTTEQ+R  N TL+ALHE+          +  +   + + ++ 
Sbjct  67    RSTSNT----SSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPSNY  122

Query  785   yasTPGNYQNPPTFNGFNTTHST-GLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRRE  843
              ASTPGN+ +  T++GFNT HST G SR +S D     E+ RLR+E+ EVK EV+ IRRE
Sbjct  123   AASTPGNFSS--TYHGFNTVHSTTGTSRAVSGDF----ELERLRSEVLEVKEEVKAIRRE  176

Query  844   VMNELHMTRYDVLKELTLLKGAVAQLSAAQTTG--svspstssssdplsAEDRAALTRVP  901
             VMNELH+TRYDVLKEL LLKGA+AQL+A Q +   SVS + SSSSDPLSAE+RAALTR  
Sbjct  177   VMNELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSDPLSAEERAALTRQT  236

Query  902   SKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLI  961
             S  TS+ T+DRLA SR NIH  PPPAARASVRLTQLAPVADNALSTPL+PQQINEMFPLI
Sbjct  237   STKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLI  296

Query  962   DFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQ  1021
             DFTSELAAHARGL PGTRTWALTRVEEWLDARFNVGNDT+LAVVG+GGTGKSAFCGTVAQ
Sbjct  297   DFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQ  356

Query  1022  QFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFL  1081
             QFRGNLLAAHCCQFDRKSKS+PRNVLLS VHQLVDNLP FKNQLARLNLKYVLEE+DPFL
Sbjct  357   QFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFL  416

Query  1082  LAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMIS  1141
             LA KV VDPLNA+EEP+HATFMLV+G+DQC+AG NGRNELLEF +Q+IPQLPSWVGF+IS
Sbjct  417   LAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLIS  476

Query  1142  SKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGN  1201
             SKP SK AKRLPVSSVLDFSAKNGAFV+DVSS+VDDIARNFSD+D+AEAK+VLK+KSGGN
Sbjct  477   SKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGN  536

Query  1202  FAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKA  1261
             FAYLEFTKQALSHPGMA ASKEGAVPLEVL +LP++L+DIY EIFEDKFGQGRAR+W KA
Sbjct  537   FAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKA  596

Query  1262  KPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALC  1321
             KPLLQLIVGAAAGPYSP+TE QAKEHF FT EDLRMLRRSFVDLV VKHGAYR+ESSALC
Sbjct  597   KPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALC  656

Query  1322  SWLSDPARSEEQFYLSVDDALTALRKLrrsrssgsnsdhshsgssssdgsvpsttshtps  1381
             +WLSDPARSEEQFY S+DDAL ALRK+              S  SSS  S  S+      
Sbjct  657   AWLSDPARSEEQFYFSIDDALQALRKM----------RRVSSSGSSSGHSGSSSDGKATH  706

Query  1382  ratssraasskshqrahTRHEPRVNPEFKPMGILKRGKM  1420
             RA+S    SSK+HQRAHTRHEPR NP+FKP+GILKR K+
Sbjct  707   RASSRVKTSSKTHQRAHTRHEPRANPDFKPVGILKRNKL  745

>PHYCA_511415
Length=744

 Score = 1058 bits (2735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/756 (75%), Positives = 645/756 (85%), Gaps = 24/756 (3%)

Query  674   LKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVNVSDDVEDMFYGRS  733
             LKNKLRSS+LHKKEGAWALDEDSLRL +QQ DA RFDR+T + DTVNV+DDVE+MFYGR+
Sbjct  4     LKNKLRSSRLHKKEGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFYGRN  63

Query  734   TTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPsashlsnsfassyasTPGNYQ  793
             T +S  +  S++P YRTTEQ+RG N TL+ALHEE A+TPSAS++S+SF+   A+TP NY 
Sbjct  64    TNRS--TTASEMPQYRTTEQIRGNNLTLSALHEE-AVTPSASNVSSSFSQFSATTPSNYA  120

Query  794   -NPP------TFNGFNTTHST-GLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVM  845
              + P      T++GF++  +T G SR ISED     E+ RLR+E+ EVK EV+ IRREVM
Sbjct  121   ASTPGNVGNNTYHGFSSALNTAGTSRVISEDF----ELERLRSEVLEVKEEVKAIRREVM  176

Query  846   NELHMTRYDVLKELTLLKGAVAQLSAAQ-TTGsvspstssssdplsAEDRAALTRVPSKL  904
             NELH+TRYDVLKELTLLKGA+AQL+AAQ ++ SVS + SSSSDPLSAE+RAALTR  S  
Sbjct  177   NELHVTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDPLSAEERAALTRQTSTK  236

Query  905   TSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFT  964
             TS  T+DRLA SR+N+H  PPPAARASVRLTQLAPVADNALSTPL+ QQINEMFPLIDFT
Sbjct  237   TSAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFT  296

Query  965   SELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFR  1024
             S+LAAHARGL PG+RTWALTRVEEWLDARFNVG DT+LAVVG+GGTGKSAF GTVAQQFR
Sbjct  297   SDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFR  356

Query  1025  GNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAA  1084
             GNLLAAHCCQFDRKSKS+PRNVLLS VHQLVDNLP FKNQLARLNLKYVLEE+DP LLA 
Sbjct  357   GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAG  416

Query  1085  KVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKP  1144
             KV VDPLNA+EEP+HATFMLV+G+DQCSAGPNGRNELL+F +Q+IPQLPSW+GF++SSKP
Sbjct  417   KVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKP  476

Query  1145  FSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAY  1204
              SK AKRLPVSSVLDFSAKNGAFV+DVSSLVDDIARNFSD+D+AEAK+VLK KSGGNFAY
Sbjct  477   SSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAY  536

Query  1205  LEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPL  1264
             LEFTKQALSHPGM   SKEGAVPL VL +LP++L+DIY EIFEDKFGQGRAR+W KAKPL
Sbjct  537   LEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPL  596

Query  1265  LQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWL  1324
             LQL+VGAA+GPYSPVTE QAKEHF  T EDLRMLRRSFVDLV VKHG+YR+ESSALC+WL
Sbjct  597   LQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWL  656

Query  1325  SDPARSEEQFYLSVDDALTALRKLrrsrssgsnsdhshsgssssdgsvpsttshtpsrat  1384
             SDPARSEEQFY S+DDAL ALRK+         +  S   S S   S  S T HT SRA+
Sbjct  657   SDPARSEEQFYFSIDDALHALRKM-------RRNVSSSGHSHSGSSSDSSATHHTSSRAS  709

Query  1385  ssraasskshqrahTRHEPRVNPEFKPMGILKRGKM  1420
             S   ASSKS QR+HTRHEPR NP  KP+GILKRGK+
Sbjct  710   SRVTASSKSQQRSHTRHEPRTNPG-KPVGILKRGKL  744

>PITG_18458
Length=747

 Score = 1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/759 (73%), Positives = 634/759 (84%), Gaps = 27/759 (4%)

Query  674   LKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDAD--RFDRNTAMTDTVNVSDDVEDMFYG  731
             +KNKLRSS+LHKKEGAWALDEDSLRL KQ QD D  RFDR+T + DTVNV+DDVE+MFYG
Sbjct  4     IKNKLRSSRLHKKEGAWALDEDSLRL-KQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYG  62

Query  732   RSTTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEE-EAMTPsashlsnsfassyasTPG  790
             RST+ +    +SD+P YRTTEQ+RG N TL+ALHE+ EA     S++S+SF+   A+TP 
Sbjct  63    RSTSNT----SSDMPQYRTTEQLRGNNITLSALHEDVEASN--VSNVSSSFSQFSATTPS  116

Query  791   NY--QNPPTFN----GFNTTHST-GLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRRE  843
             NY    P  F     G NT  +T G+SR +S D     E+ RLR+E+ EVK EV+ IRRE
Sbjct  117   NYAASTPGKFTSTHQGLNTAQTTTGMSRAVSGDF----ELERLRSEVLEVKEEVKAIRRE  172

Query  844   VMNELHMTRYDVLKELTLLKGAVAQLSAAQ--TTGsvspstssssdplsAEDRAALTRVP  901
             VMNELH+TRYDVLKEL LLKGA+AQL+A Q     SVS + SSSSDPLS ++RAALTR  
Sbjct  173   VMNELHVTRYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPDERAALTRQT  232

Query  902   SKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLI  961
             S  TS+ T+DRLA SR NIH  PPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLI
Sbjct  233   STKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLI  292

Query  962   DFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQ  1021
             D TSELAAHARGL PGTRTWALTRVEEWLDAR+N+GNDT+LAVVG+GGTGKS FCGTVAQ
Sbjct  293   DSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQ  352

Query  1022  QFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFL  1081
             QFRGNLLAAHCCQFDRKSKS+PRNVLLS VHQLVD+LP FKNQLARLNLKYVLEE+DPFL
Sbjct  353   QFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFL  412

Query  1082  LAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMIS  1141
             LA KV VDPLNAVEEP+HATF+LV+G+DQC+ G NGRNELLE  +Q+IPQLPSWVGF++S
Sbjct  413   LAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVS  472

Query  1142  SKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGN  1201
             SKP SK AKRLPVSSVLDFSAKNGAFV+D SSLVDDIARNFSD+D+AEAK+VLK+KSGGN
Sbjct  473   SKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGN  532

Query  1202  FAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKA  1261
             FAYLEFTKQALSHPG+A ASKEGAVPLEVL +LP++L+DIY EIFEDKFGQGRAR+W KA
Sbjct  533   FAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKA  592

Query  1262  KPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALC  1321
             KPLLQL+VGAAAGPYSPVTE QAKEHF  TTEDLRMLRRSFVDLV VKHG+YR+ESSALC
Sbjct  593   KPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALC  652

Query  1322  SWLSDPARSEEQFYLSVDDALTALRKLrrsrssgsnsdhshsgssssdgsvpsttshtps  1381
             +WLSDPARSEEQFY SVDDAL ALRK+        +S  S   S +S     +   H  S
Sbjct  653   AWLSDPARSEEQFYFSVDDALLALRKI----RRVGSSSSSSGHSGNSSDGKAAKNGHASS  708

Query  1382  ratssraasskshqrahTRHEPRVNPEFKPMGILKRGKM  1420
             R ++    SSK+HQRAHTR+EPR +P++KP+GILKR K+
Sbjct  709   RPSNRVKTSSKTHQRAHTRYEPRTSPDYKPVGILKRNKL  747

>PHYRA_81098
Length=741

 Score = 994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/754 (73%), Positives = 621/754 (82%), Gaps = 27/754 (4%)

Query  674   LKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVNVSDDVEDMFYGRS  733
             LKNKLR   LHKK+  WALDEDSLRL + Q DA R DR+T +TDTVNV+DDVE+MFYG  
Sbjct  8     LKNKLR---LHKKDANWALDEDSLRLKQTQDDALRLDRSTTLTDTVNVTDDVEEMFYGGR  64

Query  734   TTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPsashlsnsfass----yasTP  789
             +T       SDVP YRTTEQ+RGT+ TL+ALHE+   + ++S  S   A++     ASTP
Sbjct  65    ST------VSDVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQFSATTPSNYAASTP  118

Query  790   GNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVMNELH  849
             G+  N   ++ F+T HST  +R IS D +   E+ RLR+E+ EVK EV+ IRREVMNELH
Sbjct  119   GHVPNQGAYHDFSTAHST--TRAIS-DAF---ELERLRSEVVEVKEEVKAIRREVMNELH  172

Query  850   MTRYDVLKELTLLKGAVAQLSAAQ---TTGsvspstssssdplsAEDRAALTRVPSKLTS  906
             +TRYDVLKEL LLKGA+AQL+A Q      SVS + SSSSDPLSA++RAALTR  S  TS
Sbjct  173   VTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAALTRQTSTKTS  232

Query  907   KTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSE  966
               T++RLA SR NIH  PPPAARASVRLTQLAPVADNALSTPL PQQIN+MFPLIDFTSE
Sbjct  233   SATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSE  292

Query  967   LAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGN  1026
             LAAHAR L PG+RTWALTRVEEWLDARFNVG+DT+LAVVG+GGTGKSAF GTVAQQFRGN
Sbjct  293   LAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGN  352

Query  1027  LLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKV  1086
             LLAAHCCQFDRKSKS+PRNVLLS VHQLVD+LPPFKNQLARLNLKYVLEE+DPF+LA KV
Sbjct  353   LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKV  412

Query  1087  FVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFS  1146
              VDPLNA+EEP+HATFMLV+G+DQCSAGP GRNELLEF +Q+IP LPSWVGFM+SSKP S
Sbjct  413   LVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSS  472

Query  1147  KFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLE  1206
             K AKRLPVSSVLDFSAKNGAFVSDVSSLV+D+ARNFSD D+AEAK+VLK+KSGGNFAYLE
Sbjct  473   KLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLE  532

Query  1207  FTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQ  1266
             FTKQALSHPGMA ASKEGAVPL VL +LP++L+DIY EIFEDKFGQGRAR+W KAKPLLQ
Sbjct  533   FTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  592

Query  1267  LIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSD  1326
             LIVGAAAGPYS VTE QAK+HF  T EDLRMLR SFVDLV V+HGAYR+ESSALC WLSD
Sbjct  593   LIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSD  652

Query  1327  PARSEEQFYLSVDDALTALRKLrrsrssgsnsdhshsgssssdgsvpsttshtpsratss  1386
             PARSEEQFY ++DDA+ ALR         S S  SHS S SSD S P++     S   SS
Sbjct  653   PARSEEQFYFAIDDAIQALRS-----MRRSVSSSSHSNSGSSDDSPPTSRRGHTSSRASS  707

Query  1387  raasskshqrahTRHEPRVNPEFKPMGILKRGKM  1420
             R  +SKS+QRAHTRH+PR   EFKP+GILKR K+
Sbjct  708   RVTTSKSNQRAHTRHDPRATQEFKPVGILKRNKL  741

>PHYSO_348903
Length=766

 Score = 986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/772 (68%), Positives = 613/772 (79%), Gaps = 28/772 (4%)

Query  666   MCLNLQAELKNKLRSSKL--HKKEGAWALDEDSLRLNKQQQDAD-RFDRNTAMTDTVNVS  722
             M  N    +KNKLRSS+L   KK+ AWALDEDSLRL + Q DA  R+DR+  ++DTVNV+
Sbjct  1     MVGNTMHRIKNKLRSSRLGSSKKDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60

Query  723   DDVEDMFYGRSTTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPsashlsnsfa  782
             DDVEDMFYGR+  +S  S  SDVP YRTTEQ+R T+ TL+ALHE+     + ++LS+SF+
Sbjct  61    DDVEDMFYGRNN-RSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFS  119

Query  783   ssyasTPGNY--QNPPTFNGF---------NTTHSTGLS---RTISEDTYNNNEVSRLRA  828
                 +TP NY    P  F+           +TT + G S    T+        E+ RLRA
Sbjct  120   QFSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRA  179

Query  829   ELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLSAAQ--TTGsvspstssss  886
             E+ EVK EV+ IRREVMNELH+TRYDVLKEL LLKGAVAQL+AAQ  +  SVS + SSS 
Sbjct  180   EVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSL  239

Query  887   dplsAEDRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALS  946
             DPLSA+DRA L R  S  TS  T++RLA SR N+   PPP ARASVRLTQLAPVAD+ALS
Sbjct  240   DPLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALS  299

Query  947   TPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVG  1006
             TPL  QQINEMFPLIDFTSELAAHARGL PG+RTWALTRVEEWLD+RFN G+D +LAVVG
Sbjct  300   TPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVG  359

Query  1007  DGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLA  1066
             +GGTGKSAFCGTVAQQFRGN+LAAHCCQFDRKSKSTPRNVLLS VHQ+VDN PPFKNQLA
Sbjct  360   EGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLA  419

Query  1067  RLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLS  1126
             RLNLKYVLEE+DP LLAAKV VDPLNA+EEP+ A FM+V+G+DQC+AG  GRNELLEF +
Sbjct  420   RLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFA  479

Query  1127  QIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDED  1186
             QIIPQLP+WVGF++SSKP SK AKRLPVSSVLDFSA+N AFV+DV+ LV+DIARNFSD+D
Sbjct  480   QIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDD  539

Query  1187  SAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIF  1246
               +AK +LK+KSGGNFAYLEFTKQALSHPGMA ASKEGAVPL VL+DLP++L+DIY EIF
Sbjct  540   FVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIF  599

Query  1247  EDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLV  1306
             EDKFGQGRAR+W KAKPLLQL+VGAA+GPYSPVTE QA+EHF  T EDLRMLRRSFVDLV
Sbjct  600   EDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLV  659

Query  1307  EVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKLrrsrssgsnsdhshsgss  1366
              V+HG+YR+ESSALC+WLSDPARSEEQFY S+DDAL ALR++            S   SS
Sbjct  660   AVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQM--------RRSGSSGSSS  711

Query  1367  ssdgsvpsttshtpsratssraasskshqrahTRHEPRVNPEFKPMGILKRG  1418
                GS    T+  P+ + ++   ++KSH R+H +HEPR NP++KP+GILKRG
Sbjct  712   GHSGSSSDGTTSAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRG  763

>HYAP_07104
Length=721

 Score = 859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/696 (64%), Positives = 529/696 (76%), Gaps = 48/696 (7%)

Query  674   LKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVNVSDDVEDMFYGRS  733
             LKNKLR   LHKK+G W LDEDS+RL + Q    R DR+  +TDTVN +DDVE+MFY  +
Sbjct  4     LKNKLR---LHKKDGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSST  60

Query  734   TTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPsashlsnsfassyasTPGNYQ  793
              T+S    T+  P YR+TEQ+ G   TLT+L+E+ A TPS                G   
Sbjct  61    QTRS----TNGPPQYRSTEQLPGRLLTLTSLNED-AETPS----------------GGSN  99

Query  794   NPPTFNGFNTTHSTGLSRTISEDTYNN------------------NEVSRLRAELQEVKA  835
                +F+ F + H+T +S      T+++                  +E+ +LR EL EVK 
Sbjct  100   ASSSFSQF-SDHATSISSVNLTSTHHHLTTSTSMMSHPRAVGGASSELEQLRFELIEVKQ  158

Query  836   EVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLSAA---QTTGsvspstssssdplsAE  892
             EV  IR+ V+NELH+TRYDVLKEL LLKGA+AQL+      TT        S S+PLS+ 
Sbjct  159   EVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSA  218

Query  893   DRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQ  952
             DR ALTR  S +TS  T+DRLA SRVN +  PPPAARASVRLTQLAPVAD+ALSTPL+  
Sbjct  219   DRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSV  278

Query  953   QINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGK  1012
             Q+N++FPLIDFT+ELAAHAR L PG+RTWALTR EEWL++RF  G D +LAVVG+GG+GK
Sbjct  279   QMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGK  338

Query  1013  SAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKY  1072
             SAFCGTVAQQ+RG L+AAHCCQFDRK KS+PRNVLLS VHQLV NLP FKNQLARLNLKY
Sbjct  339   SAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKY  398

Query  1073  VLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQL  1132
             VLEE+DP LLA+KV VDPLNA+E+P+   FMLV+G+DQC+ GP GRNELLEFL+Q+IPQL
Sbjct  399   VLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQL  458

Query  1133  PSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKR  1192
             PSW+G ++SSKP SK AKRLPVSSVLDFSAKN AFV+DVSSLVD+IA +F  ED  EAK 
Sbjct  459   PSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKE  518

Query  1193  VLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQ  1252
             VLK KSGGNFAYLEFTKQALS  GMA  SKEG V ++VL +LP++L+DIY EIFEDKFG 
Sbjct  519   VLKHKSGGNFAYLEFTKQALS--GMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGH  576

Query  1253  GRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGA  1312
             GRAR+W+KA+ +LQL +GA AGPYSPVTE QA+EHF  TTEDLR+LRRSFVDLV VKHG 
Sbjct  577   GRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGI  636

Query  1313  YRLESSALCSWLSDPARSEEQFYLSVDDALTALRKL  1348
             YR+E+SALC+WL DPAR+EEQFY ++DDAL ALRK+
Sbjct  637   YRIENSALCAWLCDPARAEEQFYFNIDDALQALRKM  672

>PHALS_06476
Length=726

 Score = 857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/755 (61%), Positives = 557/755 (74%), Gaps = 42/755 (6%)

Query  673   ELKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVNVSDDVEDMFYGR  732
             +LKNKLR S L KKE A+ L++DSLR    Q +  R DR+  +TDTVN++DDVE+MFY R
Sbjct  7     KLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVEEMFYNR  66

Query  733   STTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPsashlsnsfassyasTPGNY  792
             ST       TS +P YRTTEQ+RG N  L ALHE+     +AS  S+SF+   A+TP +Y
Sbjct  67    STA------TSGIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTPSSY  120

Query  793   --QNPPTFNGFNTTHSTGLSRTISEDTYNNN-EVSRLRAELQEVKAEVQTIRREVMNELH  849
                 P    G +   ST  + T +    + + ++ RL +E+ ++K+EV+TIRREVMNELH
Sbjct  121   AASTPGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELH  180

Query  850   MTRYDVLKELTLLKGAVAQLSAAQTTGsvspstssssdplsAE---DRAALTRVPSKLTS  906
             +TRYDVLKELTLLKGA+AQL++ ++  S S  +S+ S         +RAALTR     TS
Sbjct  181   VTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSSDERAALTRQTPTKTS  240

Query  907   KTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSE  966
             + T+DRLA  R+N +  PP A RAS RLTQLAPVAD+ALSTPLN QQINE FPLIDFTSE
Sbjct  241   QATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSE  300

Query  967   LAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGN  1026
             LAAHAR L PG+R+WALTR++EWLDARF++GNDT+LAVVG+GG+GKSAFCGTVAQQFRGN
Sbjct  301   LAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGN  360

Query  1027  LLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKV  1086
             LLAAHCCQFDRKSKS PRNVLLS VHQLVDNLP FKNQLARLNL+YVLEE+DPFLLA KV
Sbjct  361   LLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKV  420

Query  1087  FVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFS  1146
              +DPLNA+EEP H+TF+L++G+DQC+ G NGRNELLEF+SQII  LPSWVGF++SSKP S
Sbjct  421   LIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSS  480

Query  1147  KFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLE  1206
             K AK LPVSSVLDFSAKNGAFV+D SSLV+DI++ FSD+D+ EAKR+L +KSGGNFAYLE
Sbjct  481   KLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLE  540

Query  1207  FTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQ  1266
             FTKQALSHPGMA+ S  G VPL VL +LP++L+DIY EIFEDKFGQG AR W KAKPLLQ
Sbjct  541   FTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQ  600

Query  1267  LIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSD  1326
             LIVGAAAGPYS VTE QAK+      +DLRMLRRSFVD+V VKH                
Sbjct  601   LIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH----------------  644

Query  1327  PARSEEQFYLSVDDALTALRKLrrsrssgsnsdhshsgssssdgsvpsttshtpsratss  1386
                 EEQFY S++DAL ALRK+R + SS S+S      S  +        S   SR    
Sbjct  645   ----EEQFYFSIEDALLALRKMRLNSSSDSSSGDPGISSDKNAPDHNRRLSRANSRGKLP  700

Query  1387  raasskshqrahTRHEPRVNPE-FKPMGILKRGKM  1420
               +          RHEPR N E +KP+GILKRGK+
Sbjct  701   NKSQ---------RHEPRTNFENYKPVGILKRGKL  726

>PYIW_19969
Length=733

 Score = 638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/698 (49%), Positives = 456/698 (65%), Gaps = 84/698 (12%)

Query  689   AWALDEDSLRLNKQ-QQDADRFDRNTAMTDTVNVS------DDVEDMFY-----------  730
             A A DEDSLR++K  Q++A RF RNT M  +   S      DDVEDMFY           
Sbjct  28    ATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDMFYNGGDARSTSSS  87

Query  731   -------GRSTTQSQLSN------------TSDVPSYRTTEQMRGTNSTLTALHEEEAMT  771
                    GRST  S  S              +DV  YRTTEQ+RGT + L  L E+E + 
Sbjct  88    VRSTDTYGRSTAASTRSTDTYSRATGGSLRVTDV--YRTTEQLRGT-ANLIPLQEDEVLP  144

Query  772   PsashlsnsfassyasTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRAELQ  831
                   S +  +S   T GNY N  +  G                    +++  LR EL 
Sbjct  145   ----AASRTTTTSQMPTNGNYSNGNSGGG--------------------SQLDALRTELS  180

Query  832   EVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQL-SAAQTTGsvspstssssdpls  890
             E+K EVQ IRRE+MNE+H+TRYDVLKE+T+LKG + QL +A +T G              
Sbjct  181   EMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLS------------  228

Query  891   AEDRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLN  950
              ++   ++R  +  TSK TKDR A       +  P   RAS RLTQLAPVAD ALSTPL 
Sbjct  229   TDEINTISRTTALFTSKATKDRRA---TRDESSSPMLVRASSRLTQLAPVADEALSTPLL  285

Query  951   PQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGT  1010
               QI+EMFPLI+ + EL A +R     +R WA+ R +EW+D+RFNVG D +LA+VG+GG+
Sbjct  286   QHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGS  345

Query  1011  GKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNL  1070
             GKS   G ++ +F  N++A H C FDRKSKS+PRNVLLS V+Q++ NLP FKNQLARLNL
Sbjct  346   GKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNL  405

Query  1071  KYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIP  1130
             KYVLEESDP +LA K+ VDPL A+EEP+ A   +++GLDQC +   GRN+LL+FL+ IIP
Sbjct  406   KYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKS--RGRNDLLDFLAVIIP  463

Query  1131  QLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEA  1190
             +LP+W+G  I+SKP  +   RL +SS+LDFSAKN  +++D   +++DI  +FSD+D  +A
Sbjct  464   ELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQA  523

Query  1191  KRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKF  1250
             + +LKRKSGGNF +L+FTKQALSHPG  M    G +PL+VL DLP+S+++IY EIFEDKF
Sbjct  524   REILKRKSGGNFTFLDFTKQALSHPG--MEEDNGYIPLDVLHDLPESIYEIYEEIFEDKF  581

Query  1251  GQGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKH  1310
             G+GR RIW K +PLL+LIV AA+GPY+ +TE QA+E F  + ED+R +RRSFVD+++V+H
Sbjct  582   GKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRH  641

Query  1311  GAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKL  1348
             G YR+E+SAL  WL DP R+ EQFY+ V   ++ALR+L
Sbjct  642   GTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679

>PYIR_13418
Length=747

 Score = 637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/707 (49%), Positives = 454/707 (64%), Gaps = 92/707 (13%)

Query  691   ALDEDSLRLNKQ-QQDADRFDRNTAMTDTVN------VSDDVEDMFY-------------  730
             A DE++LR++K  Q++A RF RNT M  +        +SDDVE+MFY             
Sbjct  30    ATDEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEMFYNGSANGNANPSAS  89

Query  731   -------GRSTTQSQLS-------NTSDVPS--------YRTTEQMRGTNSTLTALHEEE  768
                    GRSTT S  S       N S            YRTTEQMRGTN  L  L E+E
Sbjct  90    ARSTDNFGRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQMRGTN--LMPLQEDE  147

Query  769   AMTPsashlsnsfassyasTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRA  828
              +                         P  +   TT +T         +   N +  LRA
Sbjct  148   VL-------------------------PAASRATTTMATA--------SNGGNPIDALRA  174

Query  829   ELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQL-SAAQTTGsvspstssssd  887
             EL E+K EVQ IRRE+MNE+H+TRYDVLKE+T+LKG + QL +A ++ G  S   S ++ 
Sbjct  175   ELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAV  234

Query  888   plsAEDRAA------LTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVA  941
                A+   +      ++R  +  TSK TK+R    R       P   RAS RLTQLAPVA
Sbjct  235   GAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAPVA  290

Query  942   DNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTV  1001
             D+ALSTPL   QI+EMFPL++ ++EL A A+   P +R WA+ R +EW+D+RFNVG D +
Sbjct  291   DDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNL  350

Query  1002  LAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPF  1061
             LA+VGDGG+GKS   G +  +F  N++A H C FDRKSKS+PRNVLLS V+QL+ NLP F
Sbjct  351   LALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLF  410

Query  1062  KNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNEL  1121
             KNQLARLNLKYVLEE+DP +LA KV VDPL A+EEP+ A   + +G+DQC +   GRN+L
Sbjct  411   KNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKS--KGRNDL  468

Query  1122  LEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARN  1181
             L+FL+ IIP+LP+WVG  I+SKP  +   +L ++S+LDFSAKN  +++D   L++DI  N
Sbjct  469   LDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGN  528

Query  1182  FSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDI  1241
             FSD+D  +A+ +LKRKSGGNF +L+FTKQALSHPG  M    G +PL+VL DLP+S+++I
Sbjct  529   FSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPG--MEEDNGYIPLDVLHDLPESIYEI  586

Query  1242  YTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRS  1301
             Y EIFEDKFG+GR+RIW K +PLL+LIV AA+GPY+ +TE QA+E F  + ED+R +RR+
Sbjct  587   YEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRA  646

Query  1302  FVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKL  1348
             FVD++ V HG YR+E+SAL  WL DP R+ EQFY+ V   +  LR+L
Sbjct  647   FVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693

>PYU1_G001733
Length=732

 Score = 632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/691 (48%), Positives = 453/691 (66%), Gaps = 82/691 (12%)

Query  693   DEDSLRLNKQ-QQDADRFDRNTAMTDTVN------VSDDVEDMFY---------------  730
             DED+LR++K   +DA R+ RNT M  +        +SDDVEDMFY               
Sbjct  32    DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNGGGGITRSTSDYTT  91

Query  731   GRSTTQSQLSN---------TSDVPSYRTTEQMRGTNSTLTALHEEEAMTPsashlsnsf  781
             GR+T+  + +N          +DV  YRTTEQ+R TN  L  L+E+E +           
Sbjct  92    GRTTSSMRDANGMNRSTSLRVTDV--YRTTEQLRNTN--LMPLNEDEVL-----------  136

Query  782   assyasTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIR  841
                    P   +         TT + G S           E   LRAEL E+K E+QTIR
Sbjct  137   -------PAAMRT--------TTGAAGGS-----------EADALRAELVEMKQEMQTIR  170

Query  842   REVMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGsvspstssssdplsAEDRAA----L  897
             RE+MNE+H+TRYDVLKE+T+LKG + QL AA  +  V    +        E   A    +
Sbjct  171   REMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTI  230

Query  898   TRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEM  957
             TR  +  TSK TKDRLA   V    +P      + RLTQLAPVAD+ALSTPL   QI++M
Sbjct  231   TRTTAVHTSKATKDRLAAREVT--AIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDM  288

Query  958   FPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCG  1017
             FPL+DF+++L  HA+   P +R WA  R ++W+D+RFNVG D +LA+VGDGG+GKS   G
Sbjct  289   FPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVG  348

Query  1018  TVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEES  1077
              +  +F  N++A H C+FDRKSKS+PRNVLLS V+QL+ NLP FKNQLARLNLKYVLEE+
Sbjct  349   ALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET  408

Query  1078  DPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVG  1137
             DP +LA KV VDPL A+EEP+ A  +LV+G+DQC +    RN+LL+FL+ IIP+ P+W+G
Sbjct  409   DPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKS--KDRNDLLDFLAAIIPEFPTWLG  466

Query  1138  FMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRK  1197
               I+SKP  +   +L ++S+LDFS KN  +++D   L++DI  NFSD+D +EA+ +LKRK
Sbjct  467   IFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRK  526

Query  1198  SGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARI  1257
             SGGNF +L+FTKQALSHPG  M  + G VPL+VL DLP+S+++IY EIFEDKFG+G  R+
Sbjct  527   SGGNFTFLDFTKQALSHPG--MEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRL  584

Query  1258  WAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLES  1317
             W K +PLL LIV AA+GPY+ +TE QA+E F  + +D+RM+RR+F D+++V+HG YR+E+
Sbjct  585   WKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMET  644

Query  1318  SALCSWLSDPARSEEQFYLSVDDALTALRKL  1348
             SA+  WL DP RS EQFY+++  ++  LR+L
Sbjct  645   SAMYEWLVDPQRSGEQFYVNISASMDILRRL  675

>PYAP_17763
Length=794

 Score = 570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/534 (53%), Positives = 390/534 (73%), Gaps = 16/534 (3%)

Query  826   LRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQL-SAAQTTGsvspstss  884
             LRAEL+E+K E+Q I+RE+MNE+H+TRYDVLKE+T+LKG + QL S  Q +G V   T++
Sbjct  183   LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242

Query  885   ssdp----------lsAEDRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRL  934
             ++            LS E++ AL+R  + + SK TK+R+  +R +   +PP     S RL
Sbjct  243   AAAMGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTRED--QIPPVLRSTSSRL  300

Query  935   TQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARF  994
             TQLAPV D+ALSTPL+ +QI++MFPLIDF++E+   +R    G+R W   RV+EWLD+RF
Sbjct  301   TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  360

Query  995   NVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQL  1054
             NVG D VLA+VGD G+GK+    +V  ++   ++A H C+FDRK+KS+PRNVLLS V+QL
Sbjct  361   NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420

Query  1055  VDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAG  1114
               +LP FK+QLARLNLKYVLEE+D   L+ KV +DPLNA+EEP+   F++ + +DQC  G
Sbjct  421   TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480

Query  1115  PNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSL  1174
               G N+L +FLS IIP+ P W+GF++SSKP  +FA  +PVSSVLDFSA+N  +++D   L
Sbjct  481   V-GYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFL  539

Query  1175  VDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDL  1234
             ++DIA  F D D AEAK++LK KSGGN++YLEFTKQALS+PGM  AS  G VP++VL DL
Sbjct  540   INDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS--GFVPVDVLHDL  597

Query  1235  PQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTED  1294
             PQSL++IY EIFEDKFG+GR R+W KA P+LQLI  AA+GPY+ +TE    +   +T ++
Sbjct  598   PQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDE  657

Query  1295  LRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKL  1348
             +RMLRR+F+D++ ++HG Y + SSA+  WL+D  R  EQ+++ V+  +  LRK+
Sbjct  658   VRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKV  711

>PHYSO_474929
Length=486

 Score = 569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/498 (62%), Positives = 334/498 (67%), Gaps = 135/498 (27%)

Query  1    MTIAPPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD  60
            M++APPH+LVLQGYLHKQA                    +E+TYSTKSGRKPRLLLSLGD
Sbjct  1    MSVAPPHELVLQGYLHKQAG-------------------DEVTYSTKSGRKPRLLLSLGD  41

Query  61   VQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPT  120
            VQV+DDQN VRHPGN+VFVLQTPSR+LFLSATTEQERR WV+ELR LL+GGY        
Sbjct  42   VQVVDDQNHVRHPGNYVFVLQTPSRKLFLSATTEQERRCWVTELRGLLSGGY--------  93

Query  121  VFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVFT  180
                   D V          DR K A KR SKER+AE+RRQQLPK+K+TF+E W++EVF 
Sbjct  94   -------DGV----------DRTKKAHKRASKERKAERRRQQLPKLKRTFTETWLDEVFV  136

Query  181  LPSGGTRAEMPLLDALCFAGIPKELRGR--------------------------------  208
             PSG TR ++PLLDALCFAGIPKELRGR                                
Sbjct  137  QPSGSTREDVPLLDALCFAGIPKELRGRAWAWILGNTLQVNEDLFNICKARAQAVLMEMS  196

Query  209  --------VAEGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVAH-------  253
                    V+ G  V   + I+DR RARRSSAVLPVQNML+DAVGIAEMLVAH       
Sbjct  197  LKRDVDHSVSPGRSVSSVSKISDRKRARRSSAVLPVQNMLQDAVGIAEMLVAHGERSIKL  256

Query  254  -------------------------------------DLGYVQGMSYLAATLCFHMDSFT  276
                                                 DLGYVQGMSYLAATLCFHMDSFT
Sbjct  257  VNVDMPRTFGHHPLFQPGAEGTERTTEVLEAYICYRPDLGYVQGMSYLAATLCFHMDSFT  316

Query  277  AFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVD  336
            AFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE+ELPALAAHFQE GIDAQMYAVD
Sbjct  317  AFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEYELPALAAHFQEIGIDAQMYAVD  376

Query  337  W-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
            W       SLPLDLALR+WDVYVLLGTPFFFQASMGLL+LFQDSLL M+A DIMRLLHNF
Sbjct  377  WALTLFTRSLPLDLALRIWDVYVLLGTPFFFQASMGLLSLFQDSLLAMEAEDIMRLLHNF  436

Query  390  PKTTSSCQLFEAISSNPL  407
            PK TSS QLFEAISS  L
Sbjct  437  PKNTSSRQLFEAISSVSL  454

>PITG_18461
Length=482

 Score = 530 bits (1364),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 290/496 (58%), Positives = 323/496 (65%), Gaps = 137/496 (28%)

Query  3    IAPPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQ  62
            +A PH+LVLQGYLHKQ+                     ++TYSTKSGRKPRLLL+LGDVQ
Sbjct  1    MAAPHELVLQGYLHKQS---------------------DITYSTKSGRKPRLLLTLGDVQ  39

Query  63   VIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPTVF  122
            VIDDQNQVRHPGNFVFVLQTP+R+LFLSATTEQERR WV ELR LL G Y+  H      
Sbjct  40   VIDDQNQVRHPGNFVFVLQTPTRKLFLSATTEQERRRWVGELRVLLPGSYDDLH------  93

Query  123  GRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVFTLP  182
                                 K  +KR SKERR E++RQQLPK+K+T++E+W++EVF+ P
Sbjct  94   -------------------HLKKLQKRASKERRMERKRQQLPKLKRTYTEVWLDEVFSHP  134

Query  183  SGGTRAEMPLLDALCFAGIPKELRGRV------------------------AEGSEVPLT  218
            SG TR ++PLLDALCFAGIPKELRGR                         A   E+ L 
Sbjct  135  SGSTRGDVPLLDALCFAGIPKELRGRAWAWILGNTLQVNEDLFQICKARAQAVLMEMSLK  194

Query  219  TD----------------INDRNRARRSSAVLPVQNMLKDAVGIAEMLVAH---------  253
             D                I+DR RA +SSAVLP QNML+DAVGIAEMLVAH         
Sbjct  195  RDVDHSASPSRSVSNVSKISDRKRASQSSAVLPSQNMLQDAVGIAEMLVAHGERSIKLVN  254

Query  254  -----------------------------------DLGYVQGMSYLAATLCFHMDSFTAF  278
                                               DLGYVQGMSYLAATLCFHMDSFTAF
Sbjct  255  VDMPRTFGHHPLFQPGGEGTERTTKVLEAYICYRPDLGYVQGMSYLAATLCFHMDSFTAF  314

Query  279  KALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-  337
            KAL ALMSSSLLFDMFRLEATRTFHYI+VYNQILE+ELPALAAHF E GIDAQMYAVDW 
Sbjct  315  KALAALMSSSLLFDMFRLEATRTFHYIDVYNQILEYELPALAAHFHEIGIDAQMYAVDWA  374

Query  338  ------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPK  391
                  SLPLDLALR+WDVYVLLGTPFFFQASMGLL+LFQDSLL M+A +IMRLLHNFPK
Sbjct  375  LTLFTRSLPLDLALRIWDVYVLLGTPFFFQASMGLLSLFQDSLLAMEAENIMRLLHNFPK  434

Query  392  TTSSCQLFEAISSNPL  407
             TSS QLF+AISS  L
Sbjct  435  NTSSRQLFKAISSVSL  450

>PYAR_13571
Length=666

 Score = 534 bits (1376),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 284/637 (45%), Positives = 404/637 (63%), Gaps = 65/637 (10%)

Query  721   VSDDVEDMFY--GRSTTQSQLSNTSD--VPSYRTTEQMRGTNSTLTALHEEEAMTPsash  776
             V +D ED FY  GR    + +S  SD  +PS R+T     T+S ++   + ++M     +
Sbjct  3     VPEDAEDTFYTRGRENNGTDISVRSDYQIPSARST-----TSSAMSYDDDNDSM-----Y  52

Query  777   lsnsfassyasTPGNYQNPPTFNGFNTTHSTG-----LSRTISEDTYNNNEVSRLRAELQ  831
                S   S A+TP N +                    + R+ +       + + +     
Sbjct  53    SGYSSDRSTATTPSNARTTENLRATGLETLNELEEEPVDRSTARYIGEQGDFTPMPTTAA  112

Query  832   EVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGsvspstssssdplsA  891
                  +  IRRE+MNE+H +RYDVLKE+T+LKG + QL                      
Sbjct  113   PAYTPMPAIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET-------------------  153

Query  892   EDRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNP  951
                  + R  + + SK+TK+R+  +R ++  VPP     SVRLTQLAPV D+ALSTPL  
Sbjct  154   -----MARRTTTVASKSTKERITTTRDDM--VPPLLRATSVRLTQLAPVDDSALSTPLTQ  206

Query  952   QQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTG  1011
             +QI+E+FPL+DF++E+   AR    GTR WA  RV+EWLD+RFNVG+D +LA+VGD GTG
Sbjct  207   EQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTG  266

Query  1012  KSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLK  1071
             K+                 H C+F+RK KS+PRNVLLS V+QL   LP FK+QLARLNLK
Sbjct  267   KT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLK  309

Query  1072  YVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQ  1131
             YVLEE+D   LA KV VDPL ++EEP+ A F+L++GLDQC    NG N+LL+FLS ++P+
Sbjct  310   YVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPE  368

Query  1132  LPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAK  1191
              PSW+GF+I++KP  +FA+++PV+S+LDFSAKN A+V+D + L+ DI   F  ED A+A 
Sbjct  369   CPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADAT  428

Query  1192  RVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFG  1251
             ++LK KS GN++YLEFT+QA+S+PGM   + +G+VP++VL DLPQSL++IY EIFEDKFG
Sbjct  429   QILKTKSCGNYSYLEFTRQAMSNPGME--APQGSVPVDVLHDLPQSLYEIYEEIFEDKFG  486

Query  1252  QGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHG  1311
             +GR R+W KA P+LQLI  AA+GPY+ +TE    +   +  +D+RMLRR+F+D++ ++HG
Sbjct  487   KGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHG  546

Query  1312  AYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKL  1348
              Y + SSAL  WL+DP R  E +++ V   +  LR++
Sbjct  547   TYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRV  583

>PYVX_23590
Length=689

 Score = 500 bits (1287),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 314/710 (44%), Positives = 412/710 (58%), Gaps = 137/710 (19%)

Query  673   ELKNKLRSS----------KLHKKEGAWALDEDSLRLNKQ-QQDADRFDRNTAMTDTVNV  721
             +LK KLR            K  + +G    D++SLRL++Q  +DA RF R+T ++   + 
Sbjct  3     KLKTKLRGGGSSSRRERDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSA  62

Query  722   SDD-VEDMFY-------------------GRSTTQSQLSNTSDVPSYRTTEQMRGTNSTL  761
               D VE+MFY                    RST  S    T+DV  YRTTEQ+R T   L
Sbjct  63    MSDDVEEMFYGGGPGGHAGHGGHAGHGGADRSTAGS--VRTTDV--YRTTEQLRSTG--L  116

Query  762   TALHEEEAMTPsashlsnsfassyasTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNN  821
               L E+  + P+                  Y + P  +G +     GL            
Sbjct  117   EPLAEDRVLPPAVP----------------YGSVPHTSGPHADGPGGL------------  148

Query  822   EVSRLRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGsvsps  881
               + LRAEL +V+AE Q IRREVMNELH+ RYDVLKE+T+LKGAVAQL AA   G     
Sbjct  149   --AALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTVLKGAVAQLLAALAPGGGDAG  206

Query  882   tssssdplsAEDRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLT-QLAPV  940
             +   S   +       +   ++L+                    PA RA++ +   LAPV
Sbjct  207   SRPGSAGSATSAATTASSSSAELS--------------------PADRAAIGVAPTLAPV  246

Query  941   ADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDT  1000
              D ALS PL P+Q++E+FPL+D ++++AA AR   PGTR WA  RV+EWLD+RFNVG DT
Sbjct  247   DDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDT  306

Query  1001  VLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPP  1060
             +L VVG  GTGKS FCG+V    +GN+LA H C+FDRK+KSTPR VLLS V Q+V NLPP
Sbjct  307   LLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVVANLPP  366

Query  1061  FKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNG--R  1118
             FK QLARLNLKYVLEE D F+LA KV +DPL A EEPI A  ++++GLDQC     G  R
Sbjct  367   FKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVR  426

Query  1119  NELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDI  1178
             NELLEFL+ ++PQLPSW+G ++SSKP  + A +L  +S+LDFS KN  FV D   LVDDI
Sbjct  427   NELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVDDI  486

Query  1179  ARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSL  1238
             A NF+D  +AEA+R+L+ K+GGNFAYL+FT+QALS PG+     +G + L++L DLP+SL
Sbjct  487   AANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGL----DDGELELDMLHDLPESL  542

Query  1239  FDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRML  1298
             ++IY EIFED                                            +D+R++
Sbjct  543   YEIYLEIFED-------------------------------------------NDDMRLV  559

Query  1299  RRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKL  1348
             +RSFVD++ V+ G YR+ESSAL  WLSDPARS E F+   D  +  LR+L
Sbjct  560   KRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRL  609

>PYU1_G001731
Length=529

 Score = 409 bits (1050),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 232/502 (46%), Positives = 294/502 (59%), Gaps = 123/502 (25%)

Query  24   SKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRHPGNFVFVLQTP  83
            S+HLK+W+IRYF+LT++EL YS KSG+KPR  L L + +V+DDQNQV H GNFV  L+  
Sbjct  1    SQHLKIWKIRYFILTRHELVYSKKSGKKPRRCLVLDEYRVVDDQNQVVHLGNFVIELKNA  60

Query  84   SRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPT---VFGRKLSDSVKTSTV--GTT  138
             RR++LSA TEQER +WV+ +R+L     +P  S  T      R  S+S+  + +  G  
Sbjct  61   HRRIYLSAATEQERTTWVNTIRSLQTN--DPESSSETGSMALLRNGSESILNTILLPGMR  118

Query  139  LHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVFTLPSGGTRAEMPLLDALCF  198
             + R    R R SK+RR E++RQ+LPK+K++FSE+WVE+VFT      + E  L++ LCF
Sbjct  119  ANRRLSGRRNRGSKDRRDERKRQRLPKMKKSFSELWVEDVFT---HSAKNEASLVEGLCF  175

Query  199  AGIPKELRGRV-----------------------------------AEGSEV--------  215
            AGIPKE+RGR                                    AE S +        
Sbjct  176  AGIPKEMRGRAWAWILGNKLQVNEDLFNICKARATAVRREMVLKKEAEKSGLNAERTDSA  235

Query  216  ---------PLTTDINDRNRARRSSAVLP----------VQNMLKDAVGIAEMLVAH---  253
                     P T D N  + +   +AV P           QNML++AV IAEMLVAH   
Sbjct  236  TSLASSASLPATDDSNATDPSNPVAAVAPDEDRPDSKEVAQNMLQEAVSIAEMLVAHGER  295

Query  254  -----------------------------------------DLGYVQGMSYLAATLCFHM  272
                                                     DLGYVQGMSY+AA LCFHM
Sbjct  296  SIRLVNIDMPRTFGHHPLFQAGADGTERTTEVLEAYICYRPDLGYVQGMSYIAAALCFHM  355

Query  273  DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQM  332
            DSFTAFKALV+LMS+SLLFDMFRLE  RTFHY+ VYNQI+E ELP L AH Q+ GI+AQM
Sbjct  356  DSFTAFKALVSLMSTSLLFDMFRLEEKRTFHYLGVYNQIVEFELPRLHAHLQDTGIEAQM  415

Query  333  YAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRL  385
            YAVDW       SLPL+LALR+WD +VL+GTPFFFQAS+G+L L++D+LL MDA +IMR 
Sbjct  416  YAVDWALSLFTRSLPLNLALRIWDCFVLIGTPFFFQASVGILALYEDALLTMDAEEIMRF  475

Query  386  LHNFPKTTSSCQLFEAISSNPL  407
            LHN PK+TS+  LF+AI S  L
Sbjct  476  LHNIPKSTSATDLFDAIESVAL  497

>CCI44111
Length=576

 Score = 377 bits (967),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 210/544 (39%), Positives = 312/544 (57%), Gaps = 18/544 (3%)

Query  811   RTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLS  870
             RT SE T    ++   R E++ ++ E+Q +R+E++  +  TRYD+LKE+  LKG VA +S
Sbjct  43    RTESEST--QKQIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMS  100

Query  871   A-------AQTTGsvspstssssdplsAEDRAALTRVPSKLTSKTTKDRLAKSRVNIHTV  923
                     A+       + + S+    A+D   L+   +   S    D    +R+    V
Sbjct  101   IKIDSPINAKINKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRL----V  156

Query  924   PPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWAL  983
                +      L  L  + +  LS PL+  +I+EMFPLID + ++ ++A  L  GTR WAL
Sbjct  157   SQSSILRESGLPTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWAL  216

Query  984   TRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTP  1043
               + +W+ + F  GN+ VL +VG+GG GKS   G V Q+F  NL A H  QFDRK  S+ 
Sbjct  217   DHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSS  276

Query  1044  RNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHA-TF  1102
             R+V+LS V Q    L  +K QL RLNL+Y+L ES+P ++A K+ +DPL A+ E      F
Sbjct  277   RDVVLSLVSQFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGF  336

Query  1103  MLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSA  1162
             +L +G+DQC    N  N+LLE LS I  + PSW+GF+++SK F  FA RL  +SV+    
Sbjct  337   VLFDGIDQCLV-KNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDG  395

Query  1163  KNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASK  1222
              N  F+ D   L++++   F  + + EA  +L RKSGGN  YL+F  +ALSHP   +  +
Sbjct  396   SNVHFLQDSRILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHP--ILHGE  453

Query  1223  EGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEG  1282
             +  + L+VLD+LP+S+ +I   IF+DKFGQG  R+W  AKP+L++IV AAAGPY  V E 
Sbjct  454   QTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGES  513

Query  1283  QAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDAL  1342
             Q K+ F     + RM+ R+F D++      YR+ +S+L  WL    RS + F+L+     
Sbjct  514   QIKQQFELRENEWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVF  572

Query  1343  TALR  1346
               LR
Sbjct  573   KFLR  576

>CCA22843
Length=586

 Score = 374 bits (959),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 205/541 (38%), Positives = 318/541 (59%), Gaps = 25/541 (5%)

Query  809   LSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQ  868
             L RT SE T N  E   +R E+Q+++ E+Q++R+E++  +  TRYD++KE+  L+G V  
Sbjct  48    LERTESESTKNQFEA--VRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTG  105

Query  869   LSAAQT----------TGsvspstssssdplsAEDRAALTRVPSKLTSKTTKDRLAKSRV  918
             +    T          T     + + ++   SAED   ++R  +   S    D   KS  
Sbjct  106   IGNGLTKIDVKSSPTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGF  165

Query  919   NIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGT  978
                 +    +  S  +    P+ ++ LS PL+  + +EMFP ID  S+L ++A  L  GT
Sbjct  166   VTERLNTKDSSFSTSV----PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGT  221

Query  979   RTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  1038
             R WAL RV+EW+++ F   ND +L ++G+GG+GKS   G + Q+F   L A H CQFDRK
Sbjct  222   RVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRK  281

Query  1039  SKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPI  1098
             S+S+ R+V+LS V Q     P +K QL  LNL+Y+L+ES+P ++A K+ ++PL A+  P+
Sbjct  282   SRSSSRDVVLSLVSQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PV  339

Query  1099  HAT---FMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVS  1155
               +   F+L +G+DQC    N  N+LL+ +S I  + PS +GF+++SK    F  +    
Sbjct  340   SNSTRGFVLFDGIDQCLV-ENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSK  398

Query  1156  SVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHP  1215
             S++    +NG F++D   L+++   NF  + + EA  +L RKSGGN  YL+FT++ALSHP
Sbjct  399   SIIHLHERNGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHP  458

Query  1216  GMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGP  1275
                +  +   + L+VLD+LP S+ DI+  IFEDKFGQG  R+W   KP+L+ IV AAAG 
Sbjct  459   --ILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGS  516

Query  1276  YSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFY  1335
             +  V E Q K+ F    E+ RM++RSF D++      YR+ +S+L +WL    RS + FY
Sbjct  517   HPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFY  575

Query  1336  L  1336
             +
Sbjct  576   I  576

>PHYRA_81092
Length=566

 Score = 338 bits (866),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 183/240 (76%), Gaps = 44/240 (18%)

Query  209  VAEGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVAH---------------  253
            V   +EV + T+I DR RARRSSA+LP QNML+DAVGIAEMLVAH               
Sbjct  292  VLPTTEVSMATEITDRKRARRSSAILPAQNMLQDAVGIAEMLVAHGERSIKLVNVDMPRT  351

Query  254  -----------------------------DLGYVQGMSYLAATLCFHMDSFTAFKALVAL  284
                                         DLGYVQGMSYLAATLCFHMDSFTAFKALVA+
Sbjct  352  FGHHPLFQPGAEGTARTTEVLEAYICYRPDLGYVQGMSYLAATLCFHMDSFTAFKALVAM  411

Query  285  MSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLA  344
            MSSSLLFDMFRLEATRTFHYIEVYNQILE+ELPALAAHFQE GIDAQMYAVDWSLPLDLA
Sbjct  412  MSSSLLFDMFRLEATRTFHYIEVYNQILEYELPALAAHFQELGIDAQMYAVDWSLPLDLA  471

Query  345  LRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISS  404
            LRLWDVYVLLGTPFFFQASMGLL+LFQDSLL M+  DIMRLLHNFPK+TSS QLF+AISS
Sbjct  472  LRLWDVYVLLGTPFFFQASMGLLSLFQDSLLAMEPEDIMRLLHNFPKSTSSQQLFDAISS  531

 Score = 252 bits (644),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 183/250 (73%), Gaps = 27/250 (11%)

Query  1    MTIAPPH-QLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLG  59
            M++APP  +LVLQGYLHKQA                   +NE+TYSTKSGRKPRLLL+LG
Sbjct  1    MSVAPPPLELVLQGYLHKQA-------------------RNEVTYSTKSGRKPRLLLTLG  41

Query  60   DVQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAG---GYNPSH  116
            DVQVIDDQNQVRHPGNFVFVLQTP+R+LFLSATTEQERRSWV+ELRALL G   G   S 
Sbjct  42   DVQVIDDQNQVRHPGNFVFVLQTPTRKLFLSATTEQERRSWVTELRALLPGGDVGVRRSI  101

Query  117  SEPTVFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVE  176
            S+ T+FGR  S + K S+   T+ + R  + KR SKERRAE+RRQQLPK+K+TF+E W++
Sbjct  102  SDSTIFGRNPSSAAKKSSAAATMQNGRNKSHKRASKERRAERRRQQLPKLKRTFTETWLD  161

Query  177  EVFTLPSGGTRAEMPLLDALCFAGIPKELRGRVAE---GSEVPLTTDINDRNRARRSSAV  233
            EVFT PSGGTR ++PLLDALCFAGIPKELRGR      G+ + +  D+ +  +A R+ AV
Sbjct  162  EVFTQPSGGTREDVPLLDALCFAGIPKELRGRAWAWTLGNTLQVNQDLFNICKA-RAQAV  220

Query  234  LPVQNMLKDA  243
            L   ++ +D 
Sbjct  221  LMEMSLKRDV  230

>PPTG_17131
Length=577

 Score = 323 bits (827),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 181/248 (73%), Gaps = 51/248 (21%)

Query  211  EGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVAH-----------------  253
            + S   L  +I+DR RARRSSAVLPVQNML+DAVGIAEMLVAH                 
Sbjct  298  DSSTTMLIPEISDRKRARRSSAVLPVQNMLQDAVGIAEMLVAHGERSIKLVNVDMPRTFG  357

Query  254  ---------------------------DLGYVQGMSYLAATLCFHMDSFTAFKALVALMS  286
                                       DLGYVQGMSYLAATLCFHMDSFTAFKALVALMS
Sbjct  358  HHPLFQPGAEGTERTTEVLEAYICYRPDLGYVQGMSYLAATLCFHMDSFTAFKALVALMS  417

Query  287  SSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SL  339
            SSLLFDMFRLEATRTFHYI+VYNQI E+ELPAL+AHF E GIDAQMYAVDW       SL
Sbjct  418  SSLLFDMFRLEATRTFHYIDVYNQIFEYELPALSAHFHEIGIDAQMYAVDWALTLFTRSL  477

Query  340  PLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLF  399
            PLDLALR+WDVYVLLGTPFFFQASMGLL+LFQDSLL M+A +IMRLLHNFPK TSS QLF
Sbjct  478  PLDLALRIWDVYVLLGTPFFFQASMGLLSLFQDSLLAMEAEEIMRLLHNFPKNTSSRQLF  537

Query  400  EAISSNPL  407
            +AISS  L
Sbjct  538  KAISSVSL  545

 Score = 312 bits (799),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 189/246 (77%), Gaps = 12/246 (5%)

Query  4    APPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQV  63
            A PH+LVLQGYLHKQ     SKHLK+WRIRYF+LTKN++TYSTKSGRKPRLLL+LGDVQV
Sbjct  5    AAPHELVLQGYLHKQ-----SKHLKIWRIRYFMLTKNDITYSTKSGRKPRLLLTLGDVQV  59

Query  64   IDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHS---EPT  120
            IDDQNQVRHPGNFVFVLQTP+R+LFLSATTEQERR WV+ELR LL G Y+  H    E T
Sbjct  60   IDDQNQVRHPGNFVFVLQTPARKLFLSATTEQERRRWVTELRVLLPGSYDDLHRSTLEST  119

Query  121  VFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVFT  180
            + GR  S + KTS  G T+    K + KR SKERR E++RQQLPK+KQT++E+W++EVFT
Sbjct  120  LIGRNPSSAAKTSNAGATIQHNLKRSNKRASKERRLERKRQQLPKLKQTYTEVWLDEVFT  179

Query  181  LPSGGTRAEMPLLDALCFAGIPKELRGRVAE---GSEVPLTTDINDRNRARRSSAVLPVQ  237
             PSG TR ++PLLDALCFAGIPKELRGR      G+ + +  D+    +A R+ AVL   
Sbjct  180  HPSGSTRDDVPLLDALCFAGIPKELRGRAWAWILGNTLQVNEDLFKICKA-RAQAVLMEM  238

Query  238  NMLKDA  243
            ++ +D 
Sbjct  239  SLKRDV  244

>PHYCA_576136
Length=569

 Score = 320 bits (819),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 179/241 (74%), Gaps = 51/241 (21%)

Query  218  TTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVAH------------------------  253
            T +I+DR RARRSSAVLPVQNML+DAVGIAEMLVAH                        
Sbjct  297  TPEISDRKRARRSSAVLPVQNMLQDAVGIAEMLVAHGERSIKLVNVDMPRTFGHHPLFQP  356

Query  254  --------------------DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDM  293
                                DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDM
Sbjct  357  GAEGTERTTEVLEAYICYRPDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDM  416

Query  294  FRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALR  346
            FRLEATRTFHYIEVYNQILE+ELP+++AHFQE GIDAQMYAVDW       SLPLDLALR
Sbjct  417  FRLEATRTFHYIEVYNQILEYELPSVSAHFQEIGIDAQMYAVDWALTLFTRSLPLDLALR  476

Query  347  LWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNP  406
            +WDVYVLLGTPFFFQASMGLL+LFQDSLL M+A  IMRLLHNFPK+TSS +LF AI S  
Sbjct  477  IWDVYVLLGTPFFFQASMGLLSLFQDSLLAMEAEGIMRLLHNFPKSTSSRELFGAIESVS  536

Query  407  L  407
            L
Sbjct  537  L  537

 Score = 286 bits (733),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 166/205 (81%), Gaps = 6/205 (3%)

Query  4    APPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQV  63
            A PH+L+LQGYLHKQ     SKHLK+WRIRYF+LT++++TYSTKSGRKPRLLL+LGDVQV
Sbjct  5    AAPHELLLQGYLHKQ-----SKHLKIWRIRYFMLTQDDITYSTKSGRKPRLLLTLGDVQV  59

Query  64   IDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPTVFG  123
            IDDQNQVRHPGN+VFVLQTP+R+LFLSATTEQERR WV+E+  LL  GY+  H  P+   
Sbjct  60   IDDQNQVRHPGNYVFVLQTPTRKLFLSATTEQERRRWVAEIVKLLP-GYDEIHRTPSDSM  118

Query  124  RKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVFTLPS  183
             ++  +  ++ +   L   RK   KR SK RR E++RQQLPK+K+T++E+W+EEVFT PS
Sbjct  119  IRIGRNPSSTVIAAPLQINRKRTHKRASKSRRTERKRQQLPKLKRTYTEIWLEEVFTQPS  178

Query  184  GGTRAEMPLLDALCFAGIPKELRGR  208
            G TR E+PLLDALCFAGIPKELRGR
Sbjct  179  GSTRDEVPLLDALCFAGIPKELRGR  203

>PHALS_03627
Length=601

 Score = 313 bits (801),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 163/257 (63%), Positives = 185/257 (72%), Gaps = 53/257 (21%)

Query  218  TTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVAH------------------------  253
            T DI+D+++ RRSSAVLPVQNML+DAVGIAEMLVAH                        
Sbjct  313  TPDISDKSKKRRSSAVLPVQNMLQDAVGIAEMLVAHGERSIKLVNVDMPRTFGHHPLFQP  372

Query  254  --------------------DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDM  293
                                DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDM
Sbjct  373  GAEGTKRTTEVLEAYICYRPDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDM  432

Query  294  FRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALR  346
            FRLEATRTFHYI+VYN+I E+ELP LAAHF+E GIDAQMYAVDW       SLPLDLALR
Sbjct  433  FRLEATRTFHYIDVYNKIFEYELPVLAAHFEEIGIDAQMYAVDWALTLFTRSLPLDLALR  492

Query  347  LWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSN-  405
            +WDVYVLLGTPFFFQASMGLL+ FQ+SLL M+  ++MRLLH FPK TSS QLF++ISS+ 
Sbjct  493  IWDVYVLLGTPFFFQASMGLLSFFQNSLLAMEPENVMRLLHTFPKNTSSRQLFDSISSDL  552

Query  406  -PLETMAARGKQSVFAA  421
             PL  +A+  ++ V A 
Sbjct  553  GPLVALASEPRKEVEAG  569

 Score = 257 bits (656),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 166/212 (78%), Gaps = 16/212 (8%)

Query  1    MTIA-PPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLG  59
            M++A  P +LVLQGYLHKQ     SKHLK+WRIRYF+LTK ELTYSTKSGRKPRLLL++G
Sbjct  1    MSVATAPDELVLQGYLHKQ-----SKHLKIWRIRYFVLTKKELTYSTKSGRKPRLLLTMG  55

Query  60   DVQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSH---  116
             +QVIDDQN V H GN+VF+LQT +R+LFLSATTEQERR WV+ELR LL   Y+  H   
Sbjct  56   QIQVIDDQNLVYHSGNYVFLLQTRTRKLFLSATTEQERRRWVAELRLLLPEAYDKLHRSI  115

Query  117  SEPTVFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVE  176
            S+ +  G+KLS +VKT  +    H       KRVS+ERR E++RQQLPK+K+TF+E+W+ 
Sbjct  116  SDSSNAGQKLSSAVKTYPIIKKYH-------KRVSRERRVERKRQQLPKLKRTFTEVWLN  168

Query  177  EVFTLPSGGTRAEMPLLDALCFAGIPKELRGR  208
            EVFT PSG TR E+PLLDALCFAGIPKELRGR
Sbjct  169  EVFTWPSGSTRDEVPLLDALCFAGIPKELRGR  200

>PYAP_17767
Length=502

 Score = 288 bits (738),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 188/451 (42%), Positives = 241/451 (53%), Gaps = 109/451 (24%)

Query  64   IDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRAL--------LAGGYNPS  115
            IDDQN V H GN V  L++P RR +LSA+TEQER SWV  +R+L        + GG   S
Sbjct  20   IDDQNAVVHLGNHVIELRSPLRRTYLSASTEQERASWVMAMRSLQQDHSHHSVTGGGGMS  79

Query  116  HSEPTVFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWV  175
                 +  R  S+S + S VG     +R + +KRVSKER+ E++R+QL K+K++FSE+WV
Sbjct  80   TINIPLLQRPASES-RLSVVGPK-GSKRHSGKKRVSKERKEERKRRQLVKLKKSFSEVWV  137

Query  176  -------------------------------------------EEVFTLPSGGTRA---E  189
                                                       EE+FT+      A   E
Sbjct  138  EDVLMHASRDDVPMLEALCFAGIPKELRGRVWSWVLGNKLQINEELFTICKARATAVQQE  197

Query  190  MPLLDALCFAGIPKEL--RGRVAEGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIA  247
            M L      AGI   +     ++ G   P   D +      + S  +   ++L DAV +A
Sbjct  198  MSLKREADVAGIKASIATESTLSSGESSPSGLDRSPTEEGEKVSKEMVKVHILLDAVDVA  257

Query  248  EMLVAH--------------------------------------------DLGYVQGMSY  263
            E LV+                                             D+GYVQGMSY
Sbjct  258  EKLVSRGERSIRLVSVDMPRTFGHHPLFQTGADGTTRTIEVLEAYSCYRPDVGYVQGMSY  317

Query  264  LAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHF  323
            LAA LCFHMDSFTAFK +V LMS+S+LFDMFR+EA RTFHYI VY++ILE+ELP + AHF
Sbjct  318  LAAALCFHMDSFTAFKGMVGLMSNSVLFDMFRMEAKRTFHYIHVYDKILEYELPHVHAHF  377

Query  324  QEQGIDAQMYAVDWS-------LPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLE  376
            Q  GIDAQMYAVDW+       LPL+LA RLWD +VLLGTPFFFQASMG+L LF++ LL 
Sbjct  378  QSAGIDAQMYAVDWALTLFTRCLPLNLAFRLWDCFVLLGTPFFFQASMGILALFEERLLV  437

Query  377  MDAGDIMRLLHNFPKTTSSCQLFEAISSNPL  407
            M   +IMR LH+ PKTT++ +LF AI S  L
Sbjct  438  MQPEEIMRFLHHIPKTTTAVELFAAIDSLSL  468

>SPRG_21393
Length=494

 Score = 285 bits (729),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 183/469 (39%), Positives = 251/469 (54%), Gaps = 76/469 (16%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQN  68
            +V +GYLHKQ     S+HLKLW+IRYF+LT   L YS KSGRKP+   +L  +  + DQN
Sbjct  5    VVHEGYLHKQ-----SQHLKLWKIRYFVLTTTALLYSKKSGRKPKATYALQHLDALTDQN  59

Query  69   QVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELR----ALLAGG------------Y  112
             V H  NFV  L+    RL++SA TE +R  WV  ++    +L  G              
Sbjct  60   LVVHDHNFVLELRYKKLRLYVSAPTEADRAKWVHLIKNCKDSLSVGADTTSEASLNTIER  119

Query  113  NPSHSEPTVFGRKLSDSVKTSTVGTTLHDRRKAARK-RVSKERRA--------EKR----  159
             PS SEP      + +S++   + +T  +RR   +  R+ K R +        E R    
Sbjct  120  KPSESEPLSVRSGIPESLRRRFLASTTKERRDERKAGRLPKLRTSFTEAWLEDEVRGRAW  179

Query  160  ----------RQQLPKIKQTFSEMWVEEVFTLPSGGTRAEMPLL--------DALCFAGI  201
                       +QL +I +T ++  + EV    +   R   P L                
Sbjct  180  AALLGNKLQINEQLFEICKTRAKAVLVEVAATKAKDMRPNRPSLTIDTSGLDGGFVVVTS  239

Query  202  PKELRGRVAEGSEVPLTTDINDRN-------RARRSSAVLPVQNMLKDAVGIAEMLVAH-  253
            P+  +  + E     L  D N+RN         R   +    Q     A    E+L A+ 
Sbjct  240  PQHAKSTLTEA----LIAD-NERNIKLVKLDMPRTFGSHPQFQAGAVGAQKTYEVLEAYT  294

Query  254  ----DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYN  309
                DLGYVQGMSYLAA LC HMDSF+AFKA+V+L+S+ LLFDM+RLE  RT HY+ VY+
Sbjct  295  CYRPDLGYVQGMSYLAAILCLHMDSFSAFKAMVSLLSTRLLFDMYRLEEDRTLHYLGVYD  354

Query  310  QILEHELPALAAHFQEQGIDAQMYAVDWS-------LPLDLALRLWDVYVLLGTPFFFQA  362
             IL+HELP L A+F+E G+DA+MY VDW+       +PLD+ LR+WDVY+LLGTPFFFQA
Sbjct  355  TILQHELPTLHAYFEEIGMDAKMYVVDWAFTLFTRCVPLDVVLRIWDVYILLGTPFFFQA  414

Query  363  SMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPLETMA  411
             M +L L+++ LL +D GD MR LH+ PK+TS    F+A+ +  L   A
Sbjct  415  CMAILILYEEHLLVLDLGDAMRFLHDIPKSTSPSDFFDALDAVNLSCSA  463

>PYIR_13420
Length=515

 Score = 253 bits (646),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 164/251 (65%), Gaps = 51/251 (20%)

Query  210  AEGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVAH----------------  253
            + G+E+ L  D  +++ ++ ++       ML++AV IAEMLVAH                
Sbjct  235  SNGTELKLIGDDENQSVSQSAADDEAHAAMLQEAVSIAEMLVAHGERSIRLVNVDMPRTF  294

Query  254  ----------------------------DLGYVQGMSYLAATLCFHMDSFTAFKALVALM  285
                                        DLGYVQGMSYLAA LCFHMDSFTAFKALV+LM
Sbjct  295  GHHPLFQPGADGTERTTEVLEAYICYRPDLGYVQGMSYLAAALCFHMDSFTAFKALVSLM  354

Query  286  SSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------S  338
            S+SLLFDMFRLE  RTFHY+ VYNQI+E+ELP L AHF+  GI+AQMYAVDW       S
Sbjct  355  STSLLFDMFRLEEKRTFHYLGVYNQIVEYELPRLHAHFENSGIEAQMYAVDWALTLFTRS  414

Query  339  LPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQL  398
            LPL+LALR+WD +V LGTPFFFQAS+G+LTL++D+LL M+A DIMR LHN PK+TS+  L
Sbjct  415  LPLNLALRIWDCFVFLGTPFFFQASVGILTLYEDALLGMEAEDIMRFLHNIPKSTSAPDL  474

Query  399  FEAISSNPLET  409
            F+AI S  L +
Sbjct  475  FDAIESVTLSS  485

 Score = 134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 115/176 (65%), Gaps = 9/176 (5%)

Query  58   LGDVQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHS  117
            + D +VIDDQN V H GNFV  L++ +R +F+SA+TEQER  WV+ +R+      + + S
Sbjct  3    VNDFRVIDDQNHVVHLGNFVIELKSATREVFISASTEQERTLWVNAIRSQQQTDQDATSS  62

Query  118  EPTVFGRKLSDSV-KTSTVGTTL-HDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWV  175
              T+  R +SDS+ + +T+   + H+RR     R SKER+ E++RQ+LPK+K++FSE+WV
Sbjct  63   STTLL-RNMSDSILQANTIPVLMAHNRRFGKPNRFSKERKEERKRQRLPKMKKSFSELWV  121

Query  176  EEVFTLPSGGTRAEMPLLDALCFAGIPKELRGRVAE---GSEVPLTTDINDRNRAR  228
            +++    S   + +  L++ALCFAGIPKE+RGR      G+++ +  D+    +AR
Sbjct  122  DDII---SQSGKQDSSLVEALCFAGIPKEVRGRAWAWILGNKLQVNEDLFKICKAR  174

>PYIW_14659
Length=564

 Score = 254 bits (649),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 152/222 (68%), Gaps = 51/222 (23%)

Query  239  MLKDAVGIAEMLVAH--------------------------------------------D  254
            ML +AV IAEMLVAH                                            D
Sbjct  313  MLLEAVSIAEMLVAHGERSIRLVNVDMPRTFGHHPLFQPGADGTERTTEVLEAYICYRPD  372

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            LGYVQGMSYLAATLCFHMDSFTAFKA+V+LMS+SLLFDMFRLE TRTFHY+ +YNQI+E+
Sbjct  373  LGYVQGMSYLAATLCFHMDSFTAFKAMVSLMSTSLLFDMFRLEETRTFHYLGIYNQIIEY  432

Query  315  ELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLL  367
            ELP L AHFQ+ GI+AQMYAVDW       SLPL+LALR+WD +V LGTPFFFQAS+G+L
Sbjct  433  ELPRLHAHFQDSGIEAQMYAVDWALTLFTRSLPLNLALRIWDCFVFLGTPFFFQASVGIL  492

Query  368  TLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPLET  409
            TL++D+LL M+A DIMR LHN PK+TS+  LF+AI S  L +
Sbjct  493  TLYEDALLAMEAEDIMRFLHNIPKSTSAPDLFDAIESVTLSS  534

 Score = 202 bits (514),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/235 (47%), Positives = 158/235 (67%), Gaps = 15/235 (6%)

Query  1    MTIAPPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD  60
            M++APP + VLQGYLHKQ     SKHLKLW+IR+F+LT+NEL YS KSG+K R  L L D
Sbjct  1    MSVAPPQEAVLQGYLHKQ-----SKHLKLWKIRFFILTRNELLYSKKSGKKLRGCLLLND  55

Query  61   VQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEP-  119
             +V+DDQN+V H GNFV  L++ +R + LSATTEQER +WV+ +R+L        H+   
Sbjct  56   FRVVDDQNRVVHLGNFVIQLKSSTREIHLSATTEQERAAWVNAIRSLQTNQDRLRHTASG  115

Query  120  TVFGRKLSDSVKTSTVGTTL--HDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEE  177
            T   R +S+SV  ++    L  H+RR     R SKER+ E++RQ+LPK+K++F E+W+++
Sbjct  116  TALLRNMSESVLQASAIPVLMAHNRRLGRPNRFSKERKEERKRQRLPKMKKSFGELWIDD  175

Query  178  VFTLPSGGTRAEMP-LLDALCFAGIPKELRGRVAE---GSEVPLTTDINDRNRAR  228
            +  L SG  R + P +++ALCF GIPKE+RGR      G+++ +  D+    +AR
Sbjct  176  II-LQSG--RHDAPNIVEALCFVGIPKEVRGRAWAWILGNKLQVNEDLFKICKAR  227

>SPRG_06355
Length=713

 Score = 238 bits (608),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 148/461 (32%), Positives = 246/461 (53%), Gaps = 40/461 (9%)

Query  899   RVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMF  958
             R  SKL+ +++K  L++    I        R S R     P+ D AL+ P     +N+  
Sbjct  264   RASSKLSRESSK--LSRESSKISRESSKLFRESTR----QPIKDQALTQPWE-NVLNQHL  316

Query  959   PLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGT  1018
             P ++        A  ++P TRTWA+ +  +W           VL VVG  G GKS     
Sbjct  317   PFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSH  372

Query  1019  VAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESD  1078
             +   +   ++A+H  ++D +  ++   +L+S  HQ+   LP F+ QL RLNL Y+++E D
Sbjct  373   LVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPD  430

Query  1079  PFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGF  1138
             P +LA K+ ++PL ++  P+ +  ++++ +D+ ++ P G N L+  L+ +  + PSWV F
Sbjct  431   PVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTP-GTN-LISLLADVALEFPSWVLF  488

Query  1139  MISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRV---LK  1195
             ++SS+P     K LP   VL F  ++  F +D +  V    ++  D+   + K +   LK
Sbjct  489   LLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAV----QSLMDKHGLDDKNILFLLK  544

Query  1196  RKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRA  1255
              KS G+F YL+F  QA     M  +  +  + LE    LP++L++IY ++FE+K+G+GR 
Sbjct  545   AKSQGSFLYLQFVDQAF---AMIHSEIDAGMILE----LPKTLYEIYDQVFEEKYGKGRR  597

Query  1256  RIWAKAKPLLQLIVGAA-------AGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEV  1308
             R+W K +P+L+ IVGAA       A P+  VTE   +  F     DL ++ RSF D+V V
Sbjct  598   RVWQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIVAV  655

Query  1309  KH--GAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRK  1347
                 G YRL+S  L  +L D +RS+E  +++V+  +  L K
Sbjct  656   DEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)

Query  826  LRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLSAA  872
            + A + E+K  V  IRR+VM ELH T+YD+LKE+T+L+GAV QL  A
Sbjct  142  MDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDA  188

>PYVX_19188
Length=625

 Score = 234 bits (597),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 152/232 (66%), Gaps = 54/232 (23%)

Query  227  ARRSSAVLPVQNMLKDAVGIAEMLVAH---------------------------------  253
            A  + A+ P  +MLKDAVGIAEMLVAH                                 
Sbjct  365  AENAPAIRP--DMLKDAVGIAEMLVAHGERSIHLVNVDMPRTFGHHPLFKAGAEGTERTT  422

Query  254  -----------DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTF  302
                       DLGYVQGMSYLAATLCFHMDSF AFKALVAL+SSSLLFDMFRLE +RTF
Sbjct  423  EVLEAYACYRPDLGYVQGMSYLAATLCFHMDSFAAFKALVALLSSSLLFDMFRLE-SRTF  481

Query  303  HYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLG  355
            HY  +YNQI E+ELP L  HF+  GID +MYAVDW       SLPL LALRLWD YVLLG
Sbjct  482  HYFAIYNQIFEYELPELYRHFEAAGIDPEMYAVDWALTLFTRSLPLHLALRLWDCYVLLG  541

Query  356  TPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPL  407
            TPFFFQASMG+L LF+D+LL M+A  ++R LHN PK+ +S ++F+AI++  L
Sbjct  542  TPFFFQASMGILALFEDTLLRMEAEQMVRFLHNLPKSVTSREIFDAIATVSL  593

 Score = 184 bits (466),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 132/222 (59%), Gaps = 27/222 (12%)

Query  1    MTIAPPHQLVLQGYLHKQAS----GPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLL  56
            M +A PH+LVLQGYLHKQ         S+HLKLW++R+F+L K EL Y+ KSGRKPR   
Sbjct  29   MRVAAPHELVLQGYLHKQVGLLSLAARSQHLKLWKVRFFMLAKTELLYTKKSGRKPRGAW  88

Query  57   SLGDVQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSH  116
             L ++QVIDDQN+V H  NFV  L TPSRR+FLSA TE+ER +WV+ +R LL    +P+ 
Sbjct  89   MLHELQVIDDQNEVDHGSNFVLELATPSRRIFLSAATEKERDAWVAAIR-LLQAEADPTA  147

Query  117  SEPTVFG------RKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTF  170
                  G      R+  D   T + G              ++ R    RR+ LPK+K+ F
Sbjct  148  RRGLRAGSLSCCSRRSVDEAPTGSCGR-------------ARPRXXXXRRRHLPKLKKPF  194

Query  171  SEMWVEEVFTLPS---GGTRAEMPLLDALCFAGIPKELRGRV  209
            +++W+EE+ T       G   E   L+ALCFAGIPKE+RGR 
Sbjct  195  TDVWLEEILTATREAVAGDEDESARLEALCFAGIPKEVRGRA  236

>PYAR_13572
Length=512

 Score = 228 bits (581),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 124/161 (77%), Gaps = 14/161 (9%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            DLGYVQGMSYLAA LCFHMDSFTAFKA+VALMS+S+LFDMFR+EA RTFHYI  Y +ILE
Sbjct  325  DLGYVQGMSYLAAALCFHMDSFTAFKAMVALMSNSVLFDMFRMEAKRTFHYINAYGRILE  384

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
             ELP L AHFQ  GIDAQMYAVDW       SLPL+LA RLWD +VL+GTPFFFQASM  
Sbjct  385  FELPQLHAHFQNSGIDAQMYAVDWALTLFTRSLPLNLAFRLWDCFVLVGTPFFFQASM--  442

Query  367  LTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPL  407
                 D LL M+  +IMR LH+ PKTT+S +LF AI S  L
Sbjct  443  -----DRLLAMEPEEIMRFLHHLPKTTTSVELFAAIDSVSL  478

 Score = 121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 103/167 (62%), Gaps = 24/167 (14%)

Query  55   LLSLGDVQVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNP  114
            L S  D Q IDDQN V H GNFV  L++P  R+FLSA TEQER +WV  +R+L     N 
Sbjct  6    LTSFCDAQ-IDDQNAVTHAGNFVIELRSPLLRVFLSAATEQERMTWVMAMRSLQQD--NS  62

Query  115  SHSEP--------TVFGRKLSDSVKTSTVGTTLHDRRKAA----RKRVSKERRAEKRRQQ  162
             HS           +  R  SD     T+G     RR++     RKRVSK+R+ E+RR+Q
Sbjct  63   HHSTAAAGSSAHLAILQRPASD----PTIGAM--PRRRSTITKRRKRVSKDRKEERRRRQ  116

Query  163  LPKIKQTFSEMWVEEVFTLPSGGTRAEMPLLDALCFAGIPKELRGRV  209
            LPK+K++FSE WVE+V T      R + PLL+ALCFAGIPKELRGRV
Sbjct  117  LPKLKKSFSEAWVEDVLT---RNDRDDAPLLEALCFAGIPKELRGRV  160

>SDRG_01763
Length=736

 Score = 232 bits (592),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 148/466 (32%), Positives = 245/466 (53%), Gaps = 40/466 (9%)

Query  898   TRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRL----TQLAPVADNALSTPLNPQQ  953
             TR  SKL+ +++K  L++    +       +R S +L    +   P+ D AL+ P     
Sbjct  278   TRASSKLSRESSK--LSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQPWE-NV  334

Query  954   INEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKS  1013
             +N+  P ++        A  ++P TRTWA+ +  +W           VL VVG  G GKS
Sbjct  335   LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKS  390

Query  1014  AFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYV  1073
                  +   +   ++A+H  ++D +    P  +L+S  HQ+   LP ++ QL RLNL Y+
Sbjct  391   TLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKLPDYQQQLVRLNLPYL  448

Query  1074  LEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLP  1133
             ++E DP +LA K+ ++PL ++  P+ +  ++++ +D+  + P G N L+  L+ +  + P
Sbjct  449   IQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTP-GAN-LISLLADVALEFP  506

Query  1134  SWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRV  1193
             SWV F++SS+      K LP   VL F  ++  F +D +  V  +     D+   + K +
Sbjct  507   SWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVM----DKHGLDDKNI  562

Query  1194  ---LKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKF  1250
                LK KS G+F YL+F  QA S   M  +  +  + LE    LP++L +IY ++FE+K+
Sbjct  563   LFLLKAKSQGSFLYLQFVDQAFS---MIHSEIDAGMILE----LPKTLHEIYDQVFEEKY  615

Query  1251  GQGRARIWAKAKPLLQLIVGAA-------AGPYSPVTEGQAKEHFGFTTEDLRMLRRSFV  1303
             G+GR R+W K + +L+ IVGAA       A P+  VTE   +  F     DL ++ RSF 
Sbjct  616   GKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLGQPDLALIARSFE  673

Query  1304  DLVEVKH--GAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRK  1347
             D+V V    G YRL+S  L  +L D ARS+E  +++V+  +  L K
Sbjct  674   DIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)

Query  826  LRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQL  869
            + A + E+K  V  IRR+VM ELH T+YD+LKE+T+L+GAV QL
Sbjct  155  MDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQL  198

>SPRG_18415
Length=336

 Score = 216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 131/174 (75%), Gaps = 12/174 (7%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            DLGYVQGMSYLAA LC HMDSF+AFKA+V+L+S+ LLFDM+RLE  RT HY+ VY+ IL+
Sbjct  141  DLGYVQGMSYLAAILCLHMDSFSAFKAMVSLLSTRLLFDMYRLEEDRTLHYLRVYDTILQ  200

Query  314  HELPALAAHFQEQGIDAQMYAVDWS-------LPLDLALRLWDVYVLLGTPFFFQASMGL  366
            HELP L A+F+E G+DA+MY VDW+       +PLD+ LR+WDVY+LLGTPFFFQA M +
Sbjct  201  HELPTLHAYFEEIGMDAKMYVVDWAFTLFTRCVPLDVVLRIWDVYILLGTPFFFQACMAI  260

Query  367  LTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEA-----ISSNPLETMAARGK  415
            L L+++ LL +D GD+MR LH+ PK+ S    F+A     +S + ++++ A G 
Sbjct  261  LILYEEHLLALDLGDVMRFLHDIPKSMSPSDFFDALDAVNLSCSAIDSLLAGGN  314

 Score = 34.7 bits (78),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (79%), Gaps = 0/19 (0%)

Query  190  MPLLDALCFAGIPKELRGR  208
            M  +  LCFAGIPKE+RGR
Sbjct  1    MAFVQGLCFAGIPKEVRGR  19

>SDRG_12684
Length=521

 Score = 221 bits (562),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 128/168 (76%), Gaps = 7/168 (4%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            DLGYVQGMSYLAA LC HMDSF+AFKA+V+L+S+ LLFDM+RLE  RT HY+ VY+ IL+
Sbjct  326  DLGYVQGMSYLAAILCLHMDSFSAFKAMVSLLSTRLLFDMYRLEEDRTLHYLRVYDTILQ  385

Query  314  HELPALAAHFQEQGIDAQMYAVDWS-------LPLDLALRLWDVYVLLGTPFFFQASMGL  366
            HELPAL A+F+E G+DA+MY VDW+       +PLD+ LR+WDVY+L+GTPFFFQA M +
Sbjct  386  HELPALHAYFEEIGMDAKMYVVDWAFTLFTRCVPLDVVLRIWDVYILVGTPFFFQACMAI  445

Query  367  LTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARG  414
            L L+++ LL +D GD MR LH+ PK+TS    F+A+ +  L   A  G
Sbjct  446  LILYEEHLLTLDLGDAMRFLHDIPKSTSPSSFFDALDAVNLSCSAIDG  493

 Score = 143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 131/238 (55%), Gaps = 17/238 (7%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQN  68
            +V +GYLHKQ     S+HLKLW+IRYF+LT   L YS KSGRKP+   +L  + V+ DQN
Sbjct  5    VVHEGYLHKQ-----SQHLKLWKIRYFVLTTTALLYSKKSGRKPKATYALQHLDVLTDQN  59

Query  69   QVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRA----LLAGGYNPSHSEPTVFGR  124
             V H  NFV  ++    RL++SA T+ +R  WV  +++    L  G    S +   +  R
Sbjct  60   LVVHDHNFVLEIRYEKLRLYVSAPTDADRAKWVHLIKSCKDQLSVGADTTSEASLNMVER  119

Query  125  KLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVFTLPSG  184
            K S+S   S         R+      +KERR E++  +LPK+K +F+E W+ +V  LP  
Sbjct  120  KPSESELLSVRSGISESLRRRFLASTTKERRDERKAARLPKLKTSFTEAWLHDV--LPHW  177

Query  185  GT---RAEMPLLDALCFAGIPKELRGRVAE---GSEVPLTTDINDRNRARRSSAVLPV  236
            G    +  M  +  LCFAGIPKE+RGR      G+++ +   + +  + R  + +L V
Sbjct  178  GDAKHQKPMDFVRGLCFAGIPKEVRGRAWAALLGNKLQINEQLFEICKTRAKAVLLDV  235

>H257_16579
Length=570

 Score = 208 bits (530),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 120/158 (76%), Gaps = 7/158 (4%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            DLGYVQGMSYLAA LC H+DSF AF+A+V+LMS+ L+FDM+RLE  RTF Y+ VY+ +L+
Sbjct  375  DLGYVQGMSYLAAILCLHLDSFGAFRAMVSLMSTRLMFDMYRLEEDRTFLYLTVYDTVLK  434

Query  314  HELPALAAHFQEQGIDAQMYAVDWS-------LPLDLALRLWDVYVLLGTPFFFQASMGL  366
            HELP L +HFQE G+D +MY VDW+       +PL++ LR+WD Y+ LGTPFFFQA M +
Sbjct  435  HELPTLYSHFQEIGMDPKMYVVDWAFTLFTRCVPLEVVLRIWDCYIYLGTPFFFQACMAI  494

Query  367  LTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISS  404
            L +++D+LL +D GD M+ LHN PK+ S    FEA+ +
Sbjct  495  LVMYEDTLLTLDLGDAMKFLHNVPKSCSPHDFFEAMDT  532

 Score = 149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/254 (39%), Positives = 144/254 (57%), Gaps = 28/254 (11%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQN  68
            +VL+GYLHKQ     SKHLKLW+IRYF+L +  L+YS KSG+K +    L DV VI DQN
Sbjct  5    VVLEGYLHKQ-----SKHLKLWKIRYFVLAEWTLSYSKKSGKKAKNSYELKDVHVIPDQN  59

Query  69   QVRHPGNFVFVLQT-PSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPTVFGRKL-  126
             V H  NFV  +Q    + ++LSA TE ER  W   ++A        +  + TV G KL 
Sbjct  60   YVVHDHNFVLDVQYGHDKHMYLSAPTESERLKWTQAIKATRGKWLELTSPDATVDGTKLP  119

Query  127  -SDSVKTSTVGTTLH-----------DRRKAARKR-VSKERRAEKRRQQLPKIKQTFSEM  173
               +   S+ G   H            +R   +KR  +KER+ E++R ++ K+K+ F  +
Sbjct  120  RDAASSASSSGFFGHLFQLPDSSASKSKRMMRKKRHATKERKDERKRARMAKMKKPFGSI  179

Query  174  WVEEVFTLPSGGTRAEMP--LLDALCFAGIPKELRGRVAE---GSEVPLTTDINDRNRAR  228
            W+E+V  LP  G  A +P  +++ALCFAGIPKELRGR      G+ + +   + D  R+ 
Sbjct  180  WLEDV--LPHWGDAAALPPHMVEALCFAGIPKELRGRAWSAMLGNRLQINEQLFDICRS-  236

Query  229  RSSAVLPVQNMLKD  242
            R+ AVL   ++++D
Sbjct  237  RAKAVLLEMHLVQD  250

>H310_02547
Length=564

 Score = 204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 119/158 (75%), Gaps = 7/158 (4%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            DLGYVQGMSYLAA LC H+DSF AF+A+V+LMS+ LLFDM+RLE  RT  Y+ VY+ +L 
Sbjct  369  DLGYVQGMSYLAAILCLHLDSFGAFRAMVSLMSTRLLFDMYRLEEERTLLYLSVYDSVLR  428

Query  314  HELPALAAHFQEQGIDAQMYAVDWS-------LPLDLALRLWDVYVLLGTPFFFQASMGL  366
            HELP L AHFQE GID +MY VDW+       +PL++ LR+WD Y+ LGTPFFFQA M +
Sbjct  429  HELPVLHAHFQEIGIDPRMYMVDWAFTLFTRCVPLEVVLRIWDCYMYLGTPFFFQACMAI  488

Query  367  LTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISS  404
            L +++++L+ +D GD M+ LHN PK+ S  + F+A+ +
Sbjct  489  LIMYENTLVTLDLGDAMKFLHNVPKSCSPHEFFQALDA  526

 Score = 151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/257 (39%), Positives = 142/257 (55%), Gaps = 34/257 (13%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQN  68
            +VL+GYLHKQ     SKHLKLW+IRYF+L +  L+YS KSG+  +   SL D+ VI DQN
Sbjct  5    VVLEGYLHKQ-----SKHLKLWKIRYFVLAERALSYSKKSGKMAKNTYSLKDLDVIPDQN  59

Query  69   QVRHPGNFVF-VLQTPSRRLFLSATTEQERRSWVSELRAL---------------LAGGY  112
             V H  NFVF V       ++LSA TE ER  W   ++A                L  G 
Sbjct  60   YVVHDHNFVFDVKYGDGEHMYLSAPTEAERLKWTQAIKATQGKLLHTDDGDGEKQLTDGR  119

Query  113  NPSHSEPTVFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSE  172
            + + S   V G        TS   TT    ++ A    +KER+ E++R ++PK+K+ F  
Sbjct  120  SSAASSTGVLGGVFQPPAATSRFQTTTSRYKRVA----TKERKDERKRARMPKMKKPFGA  175

Query  173  MWVEEVFTLPSGGTRAEM---PLLDALCFAGIPKELRGRVAE---GSEVPLTTDINDRNR  226
            +W+++V  LP  G +A +    L++ALCFAGIPKE+RGR      G+ + +   + D  R
Sbjct  176  IWLDDV--LPHWGDQAALVPPHLVEALCFAGIPKEIRGRAWSAMLGNRLQINEQLFDICR  233

Query  227  ARRSSAVLPVQNMLKDA  243
            A R+ AVL   +++K+A
Sbjct  234  A-RAKAVLLEMDLVKEA  249

>CCI44114
Length=369

 Score = 159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/255 (38%), Positives = 150/255 (59%), Gaps = 25/255 (10%)

Query  1    MTIAPPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD  60
            M  +    ++ QGYLHKQ     S+HLK+W+IRYF LT+  L YS +SG+ P+  + L +
Sbjct  1    MATSEEFAILKQGYLHKQ-----SRHLKVWKIRYFSLTRTHLLYSKRSGKAPKAAILLKE  55

Query  61   VQVIDDQNQVRHPGNFVFVLQTPS-RRLFLSATTEQERRSWVSELRALLAGGYNPSHSEP  119
            VQV +DQN+V HPGNFVF +QT +  R +LSA TE ER +W++E+RA      + SH   
Sbjct  56   VQVHEDQNKVLHPGNFVFEVQTATEHRYYLSAATELERIAWLTEIRA------SQSHHTC  109

Query  120  TVFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEKRRQQLPKIKQTFSEMWVEEVF  179
             V    +S      T  T +    +  R ++SK R+ E++R +L ++ ++F++ W+E++ 
Sbjct  110  IVNNSNISFE-SAHTWSTVIKGDTRKQRNKLSKTRKEERKRVKLRRMSKSFTDTWIEDIL  168

Query  180  TLPSGGTRAEMPLLDALCFAGIPKELRGRVAE---GSEVPLTTDI----NDRNRARRSSA  232
              P     +++  + ALCFAGIPKELRGRV     G+++ +  ++     DR +A RS  
Sbjct  169  PRPMP---SDIKSVVALCFAGIPKELRGRVWGWLLGNKLQINEELFRICKDRAKAVRSEI  225

Query  233  VL--PVQNMLKDAVG  245
             L   V  ++K + G
Sbjct  226  ALQKEVDAIMKLSAG  240

>PPTG_17130
Length=312

 Score = 149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 83/98 (85%), Gaps = 8/98 (8%)

Query  591  EAELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------  643
            E ELGAVY+P++I ITRVDGQM RTVAVT+VMDQLL Y QQ +QLLMVQEQLG       
Sbjct  190  ETELGAVYTPSHITITRVDGQMKRTVAVTEVMDQLLRYTQQNAQLLMVQEQLGHANRNLQ  249

Query  644  DQLQRSAEIINGLQNEVTMFRQMCLNLQAELKNKLRSS  681
            DQLQRSAEIINGLQNEVTMFRQMCLNLQAE+ + LRSS
Sbjct  250  DQLQRSAEIINGLQNEVTMFRQMCLNLQAEV-SLLRSS  286

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 89/123 (72%), Gaps = 5/123 (4%)

Query  410  MAARGKQSVFAAFNKLQVIA--VESEGSDeerqlerkerqkakkksrnkkkHSDSVQLKD  467
            MA RGK SVF+AFN+L+V       +GS EERQ ERKE+QK KKKSRNKKK SDS QLKD
Sbjct  1    MATRGKPSVFSAFNQLRVTEDFDSDDGSAEERQQERKEKQKQKKKSRNKKKSSDSAQLKD  60

Query  468  LAFvaapkpkktkgkknktvnS--SQSPAGSPAEETSVADAKREEKQSEVMEPKRALADV  525
            LAFV+  KPKK+K KKNK   +  SQSP GSP EE     +  EEK+ E+ EPKR++AD+
Sbjct  61   LAFVSVSKPKKSKSKKNKAATNAQSQSPPGSPVEEVPAVISVSEEKE-EMAEPKRSMADM  119

Query  526  IKG  528
            IK 
Sbjct  120  IKA  122

>PHYSO_293286
Length=318

 Score = 149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 78/91 (86%), Gaps = 7/91 (8%)

Query  591  EAELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------  643
            EAELGAVY+P +I ITRVDGQM RTVAVT+VMDQLL Y QQ +QLLMVQEQLG       
Sbjct  195  EAELGAVYTPAHITITRVDGQMKRTVAVTEVMDQLLRYTQQNAQLLMVQEQLGHANRSLQ  254

Query  644  DQLQRSAEIINGLQNEVTMFRQMCLNLQAEL  674
            DQLQRSAEIINGLQNEVTMFRQMCLNLQAE+
Sbjct  255  DQLQRSAEIINGLQNEVTMFRQMCLNLQAEV  285

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 4/121 (3%)

Query  410  MAARGKQSVFAAFNKLQVIAVESEGSDeerqlerkerqkakkksrnkkkHS--DSVQLKD  467
            MA RGK SVFAA ++L+V       +D   + +++ ++K K+K +++ K    DS QLKD
Sbjct  1    MATRGKPSVFAALSQLRVSEDFDSDNDSAEERQQERKEKQKQKKKSRNKKKNSDSAQLKD  60

Query  468  LAFvaapkpkktkgkknktvnSSQSPAGSPAEETSVADAKREEKQSEVMEPKRALADVIK  527
            LAFV+  KPKK+KGKK     ++Q+P GSP EE  +     EEK  EV EPKR+LAD+IK
Sbjct  61   LAFVSVSKPKKSKGKKKAGAGAAQTPPGSPVEE--MQPVASEEKVPEVAEPKRSLADMIK  118

Query  528  G  528
             
Sbjct  119  A  119

>PITG_18459
Length=311

 Score = 146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 82/98 (84%), Gaps = 8/98 (8%)

Query  591  EAELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------  643
            E ELGAVY+P++I ITRVDGQM RTVAVT+VMDQLL Y QQ +QLLMVQEQLG       
Sbjct  190  ETELGAVYAPSHITITRVDGQMKRTVAVTEVMDQLLRYTQQNAQLLMVQEQLGHANRNLQ  249

Query  644  DQLQRSAEIINGLQNEVTMFRQMCLNLQAELKNKLRSS  681
            DQLQ SAEIINGLQNEVTMFRQMCLNLQAE+ + LRSS
Sbjct  250  DQLQSSAEIINGLQNEVTMFRQMCLNLQAEV-SLLRSS  286

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 5/123 (4%)

Query  410  MAARGKQSVFAAFNKLQVIA--VESEGSDeerqlerkerqkakkksrnkkkHSDSVQLKD  467
            MA RGK SVF+AFN+L+V      ++GS EER  ERKE+QK KKKSRNKKK SDS QLKD
Sbjct  1    MATRGKPSVFSAFNQLRVSEDFDSNDGSAEERHQERKEKQKQKKKSRNKKKSSDSAQLKD  60

Query  468  LAFvaapkpkktkgkknktvnSSQ--SPAGSPAEETSVADAKREEKQSEVMEPKRALADV  525
            LAFV+  KPKK+K KKNK+  + Q  SP GS  EE    ++ RE K+ E  EP R+LA +
Sbjct  61   LAFVSVSKPKKSKNKKNKSATNVQPLSPTGSTGEEVPATNSGREAKE-EATEPMRSLAAM  119

Query  526  IKG  528
            I+ 
Sbjct  120  IRA  122

>PHYCA_556164
Length=301

 Score = 145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 84/104 (81%), Gaps = 8/104 (8%)

Query  593  ELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------DQ  645
            ELGAVY+P++I ITRVDGQM RTVAVT+VMDQLL Y QQ +QLLMVQEQLG       DQ
Sbjct  184  ELGAVYTPSHITITRVDGQMKRTVAVTEVMDQLLRYTQQNAQLLMVQEQLGHANRNLQDQ  243

Query  646  LQRSAEIINGLQNEVTMFRQMCLNLQAELKNKLRSSKLHKKEGA  689
            LQRSAE+INGLQNEVTMFRQMCLNLQAE+ + LRSS      G+
Sbjct  244  LQRSAEMINGLQNEVTMFRQMCLNLQAEV-SLLRSSTTAPDAGS  286

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 86/122 (70%), Gaps = 5/122 (4%)

Query  410  MAARGKQSVFAAFNKLQVIAVESEGSDee--rqlerkerqkakkksrnkkkHSDSVQLKD  467
            MA RGK SVF+AFN+L+V       +D    RQ ERKE+QK KKKSRNKKK SDS QLKD
Sbjct  1    MATRGKPSVFSAFNQLRVSEDFDSDNDSAEERQQERKEKQKQKKKSRNKKKSSDSAQLKD  60

Query  468  LAFvaapkpkktkgkknktvnSS--QSPAGSPAEETSVADAKREEKQSEVMEPKRALADV  525
            LAFV+  KPKK+K KKNK  N++  QSP GSP E+    D    EKQ EV EPKR++AD+
Sbjct  61   LAFVSVSKPKKSKNKKNKAANNAQPQSPTGSPTEDAQPTDTASNEKQ-EVAEPKRSMADM  119

Query  526  IK  527
            IK
Sbjct  120  IK  121

>PHYRA_81097
Length=239

 Score = 139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 80/98 (82%), Gaps = 8/98 (8%)

Query  591  EAELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------  643
            EAELGAVY+P +I ITRVDGQM RTVAVT+VMDQLL   QQ SQLLMVQ+QLG       
Sbjct  126  EAELGAVYTPAHITITRVDGQMKRTVAVTEVMDQLLLSTQQNSQLLMVQDQLGHANRNLQ  185

Query  644  DQLQRSAEIINGLQNEVTMFRQMCLNLQAELKNKLRSS  681
            DQLQRS EIINGLQNEV MFRQMCLNLQAE+ + LRSS
Sbjct  186  DQLQRSGEIINGLQNEVAMFRQMCLNLQAEV-SLLRSS  222

 Score = 41.2 bits (95),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 3/36 (8%)

Query  492  SPAGSPAEETSVADAKREEKQSEVMEPKRALADVIK  527
            SPAGSPAEE  V D  RE+K +E +EPKR LAD++K
Sbjct  22   SPAGSPAEE--VEDHVREQK-AEAVEPKRTLADLMK  54

>PHALS_06475
Length=223

 Score = 138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 7/91 (8%)

Query  591  EAELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------  643
            E ELGAVY+P++I ITRVDGQM RTV+VT+VMDQLL Y QQ +QLL VQEQLG       
Sbjct  102  ETELGAVYTPSHITITRVDGQMKRTVSVTEVMDQLLRYTQQNTQLLAVQEQLGHANRNLQ  161

Query  644  DQLQRSAEIINGLQNEVTMFRQMCLNLQAEL  674
            DQLQRSAEII+GLQNEVT+FRQMCLNLQAE+
Sbjct  162  DQLQRSAEIISGLQNEVTIFRQMCLNLQAEV  192

>PHYRA_81093
Length=298

 Score = 140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 80/98 (82%), Gaps = 8/98 (8%)

Query  591  EAELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------  643
            EAELGAVY+P +I ITRVDGQM RTVAVT+VMDQLL   QQ SQLLMVQ+QLG       
Sbjct  185  EAELGAVYTPAHITITRVDGQMKRTVAVTEVMDQLLLSTQQNSQLLMVQDQLGHANRNLQ  244

Query  644  DQLQRSAEIINGLQNEVTMFRQMCLNLQAELKNKLRSS  681
            DQLQRS EIINGLQNEV MFRQMCLNLQAE+ + LRSS
Sbjct  245  DQLQRSGEIINGLQNEVAMFRQMCLNLQAEV-SLLRSS  281

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 84/120 (70%), Gaps = 9/120 (8%)

Query  410  MAARGKQSVFAAFNKLQVI-AVES-EGSDeerqlerkerqkakkksrnkkkHSDSVQLKD  467
            MA RGK SVFAAFN+L+V  A +S +GS EERQ ERKE+QK KKKSR+KKK+SDS QLKD
Sbjct  1    MATRGKPSVFAAFNQLRVSDAFDSDDGSAEERQQERKEKQKQKKKSRSKKKNSDSAQLKD  60

Query  468  LAFvaapkpkktkgkknktvnSSQSPAGSPAEETSVADAKREEKQSEVMEPKRALADVIK  527
            LAF           K     N + SPAGSPAEE  V D  RE+K +E +EPKR LAD++K
Sbjct  61   LAF----VSVSKPKKTKGKKNKTPSPAGSPAEE--VEDHVREQK-AEAVEPKRTLADLMK  113

>HYAP_07105
Length=271

 Score = 139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 76/93 (82%), Gaps = 7/93 (8%)

Query  591  EAELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------  643
            E ELGAVY+P++I ITRVDGQM RTVAVT+VMDQLL Y QQ SQLL+VQEQLG       
Sbjct  178  ETELGAVYTPSHITITRVDGQMKRTVAVTEVMDQLLRYTQQNSQLLLVQEQLGHANRSLQ  237

Query  644  DQLQRSAEIINGLQNEVTMFRQMCLNLQAELKN  676
            DQLQR  EII GLQNEVTMFRQMCLNLQAE+ +
Sbjct  238  DQLQRRDEIITGLQNEVTMFRQMCLNLQAEVSH  270

 Score = 34.3 bits (77),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 65/121 (54%), Gaps = 5/121 (4%)

Query  410  MAAR--GKQSVFAAFNKLQVIAVESEGSDeerqlerkerqkakkksrnkkkHSDSVQLKD  467
            MA R   K SVF AFN+L+V   +    D   +  ++ER++ +K  +  +    +  LKD
Sbjct  1    MATRRGSKPSVFTAFNQLRVTE-DVNSDDGSEEERQQERKEKQKLKKKSRSKKKNRHLKD  59

Query  468  LAFvaapkpkktkgkknktvnS-SQSPAGSPAEETSVADAKREEKQSEVMEPKRALADVI  526
            LAFV+  KPKK+K KK     S SQSP   P +ET  A    EEK+ E   P R L  VI
Sbjct  60   LAFVSVSKPKKSKSKKKTETTSRSQSPTNLPVDETQTASGDGEEKKQEEEAP-RPLDQVI  118

Query  527  K  527
            +
Sbjct  119  Q  119

>PYU1_G001732
Length=294

 Score = 130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 7/90 (8%)

Query  592  AELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------D  644
            A+LGAVYSPT++KITRVDGQMTRT+AV+++MDQL  +G Q +QL +VQEQL        +
Sbjct  174  ADLGAVYSPTHVKITRVDGQMTRTIAVSEMMDQLYLFGHQNTQLRIVQEQLTVANHQMQE  233

Query  645  QLQRSAEIINGLQNEVTMFRQMCLNLQAEL  674
            +LQR AEIIN LQNEVTMFRQMCLNLQAE+
Sbjct  234  RLQRDAEIINSLQNEVTMFRQMCLNLQAEV  263

>PYVX_19191
Length=296

 Score = 126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 7/88 (8%)

Query  593  ELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------DQ  645
            ELGA+YSPT++KITR DGQMTRTVAV++VMDQLL +GQQ + LL +QEQ+        +Q
Sbjct  209  ELGALYSPTHVKITREDGQMTRTVAVSEVMDQLLRFGQQNAHLLGLQEQMARANHSLQEQ  268

Query  646  LQRSAEIINGLQNEVTMFRQMCLNLQAE  673
            LQR AEII GLQNEVTMFRQ+CL+LQAE
Sbjct  269  LQRDAEIIRGLQNEVTMFRQLCLSLQAE  296

>CCA22847
Length=364

 Score = 125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 10/121 (8%)

Query  227  ARRSSAVLPVQNMLKDAVGIAEMLVAHDLG----------YVQGMSYLAATLCFHMDSFT  276
            A R+  VL      +  +G  + L   DL           ++ GMSYLAA +C HMD+F 
Sbjct  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300

Query  277  AFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVD  336
            AFKAL ALMS++LLFDMFRL+  RTFHYI V+++IL++E+P + A+FQ  GID QMYAVD
Sbjct  301  AFKALSALMSTNLLFDMFRLQERRTFHYINVFDRILKYEVPDIHAYFQSSGIDVQMYAVD  360

Query  337  W  337
            W
Sbjct  361  W  361

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 86/160 (54%), Gaps = 20/160 (13%)

Query  99   SWVSELRALLAGGYNPSHSEPTVFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEK  158
            +W++E+RA      + S     V    LS S  T    T + D R   R +VSK RR E+
Sbjct  2    AWITEIRA------SQSQHTCKVVNSNLS-SESTHVWPTFIKDTRNQ-RNKVSKTRREER  53

Query  159  RRQQLPKIKQTFSEMWVEEVFTLPSGGTRAEMPLLDALCFAGIPKELRGRVAE---GSEV  215
            +R +L K+ ++F++ W+E++   P      +  L++ALCFAGIPKELRGRV     G+++
Sbjct  54   KRVKLKKLSKSFTDTWIEDILARPLS---TDSKLVEALCFAGIPKELRGRVWGWLLGNKL  110

Query  216  PLTTDI----NDRNRARRSSAVL--PVQNMLKDAVGIAEM  249
             +  ++     DR  A RS   L   V  ++K + G++ +
Sbjct  111  QINEELFIICKDRAEAVRSEIALQKEVDAIMKLSAGLSAL  150

>PYAR_16992
Length=1292

 Score = 112 bits (280),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 77/228 (34%), Positives = 121/228 (53%), Gaps = 30/228 (13%)

Query  189   EMPLLDALCFAGIPKELRGRV---AEGSEVPLTTDI-NDRNRARRSSAVLPVQN------  238
             + PL  A+   GIP  +R RV   A G+++ +T +I  +  R++ + A++          
Sbjct  969   DTPLAHAMWRQGIPPSIRARVWPLAIGNKLKITPEIFTESARSQHTLALIDTDLPRTFPS  1028

Query  239   -MLKDAVG-----IAEMLVAH-----DLGYVQGMSYLAATLCFHM--DSFTAFKALVALM  285
               L DA G     + E+L  +     DLGY+QGMSYLAA LC HM  D + AF+ L  LM
Sbjct  1029  LKLFDATGPYYEFLLEVLETYACYRPDLGYIQGMSYLAALLCLHMPQDRYLAFQCLANLM  1088

Query  286   SSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------S  338
              +  LF  + L+A  +  Y +++ + L   LP L  HFQ  GI + MY ++W        
Sbjct  1089  VNEHLFTFYLLDAELSDVYYKLFEEFLHSRLPELHRHFQSIGISSSMYLMNWLQTLFMQV  1148

Query  339   LPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLL  386
             LPL++A+R+ D ++L GT F F+ +M +  L Q  LL  +  + M ++
Sbjct  1149  LPLEVAVRVVDNFLLDGTVFLFRLAMAIHELLQSDLLGTEIDEAMPII  1196

>PYIW_17531
Length=1430

 Score = 108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 82/146 (56%), Gaps = 9/146 (6%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSYLAA LC HM  D +  F+ L  LM +  LF  + L+A  +  Y  ++++ 
Sbjct  1187  DLGYIQGMSYLAAMLCLHMPQDRYLTFQCLANLMVNEHLFTFYLLDAELSGVYYTLFDEF  1246

Query  312   LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
             L   LPAL  H    G+   MY ++W        LPL+LA R++D ++L GT F F+ +M
Sbjct  1247  LSARLPALHKHLDAIGVSCSMYLMNWLQTLFLQVLPLELAARVFDNFLLDGTVFLFRTAM  1306

Query  365   GLLTLFQDSLLEMDAGDIMRLLHNFP  390
              +  LFQ  LL  +  + M +L   P
Sbjct  1307  AIHELFQADLLHAEIDEAMPILQKNP  1332

>PYU1_G007420
Length=1346

 Score = 105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 82/142 (58%), Gaps = 9/142 (6%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSYLAA LC HM  D +  F+ L  LM +  LF  + L+A  +  Y  ++++ 
Sbjct  1104  DLGYIQGMSYLAAMLCLHMPHDRYLTFQCLANLMVNEHLFTFYLLDAELSGVYYTLFDEF  1163

Query  312   LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
             L   LPAL  H    GI   MY ++W        LPL+LA+R++D ++L GT F F+ +M
Sbjct  1164  LSARLPALHQHMGNIGISCSMYLMNWFQTLFLQVLPLELAVRVFDNFLLDGTVFLFRTAM  1223

Query  365   GLLTLFQDSLLEMDAGDIMRLL  386
              +  L Q  LL+ +  + M ++
Sbjct  1224  AIHELLQGDLLKAEIDEAMPMI  1245

>PYIR_23686
Length=1409

 Score = 105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 81/146 (55%), Gaps = 9/146 (6%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSYLAA LC HM  D +  F+ L  LM +  LF  + L+A  +  Y  ++++ 
Sbjct  1168  DLGYIQGMSYLAAMLCLHMPQDRYLTFQCLANLMVNEHLFTFYLLDAELSGVYYTLFDEF  1227

Query  312   LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
             L   LPAL  H    GI   MY ++W        LPL+LA R++D ++L GT F F+ +M
Sbjct  1228  LSARLPALHKHMGAIGISCSMYLMNWLQTLFLQVLPLELAARVFDNFLLDGTVFLFRTAM  1287

Query  365   GLLTLFQDSLLEMDAGDIMRLLHNFP  390
              +  L Q  LL  +  + M ++   P
Sbjct  1288  AIHELLQADLLRAEIDEAMPIIQKNP  1313

>PYAP_21745
Length=1298

 Score = 103 bits (257),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 83/142 (58%), Gaps = 9/142 (6%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSYLAA LC HM  D + AF+ L  LM +  LF  + L+A  +  Y +++ + 
Sbjct  1061  DLGYIQGMSYLAALLCLHMPQDRYLAFQCLANLMVNEHLFTFYLLDAELSDVYYKLFEEF  1120

Query  312   LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
             L   LP L  HFQ  GI + MY ++W        LPL++A+R+ D ++L GT F F+ +M
Sbjct  1121  LNSRLPDLRRHFQSIGISSSMYLMNWLQTLFLQVLPLEIAVRVIDNFLLDGTVFLFRTAM  1180

Query  365   GLLTLFQDSLLEMDAGDIMRLL  386
              +  L +  L+  D  + + ++
Sbjct  1181  AIHELLRGDLVGTDIDEAIPII  1202

>CCA21326
Length=954

 Score = 100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 84/152 (55%), Gaps = 10/152 (7%)

Query  254  DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
            DLGY+QGMSYLAA LC H+  + +  F+ L  LM    LF  + L+   +  Y +++ + 
Sbjct  759  DLGYIQGMSYLAAMLCLHIPTNPYLTFQCLANLMVQHHLFTFYLLDPALSNEYYQLFQEF  818

Query  312  LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
            L   LP +A  + E G+   MY ++W        LPL++A R++D ++L GT + F+ +M
Sbjct  819  LSIRLPQVAQKWDEMGLSTSMYLLNWLQTIFFQILPLEIAARVFDCFLLDGTDYLFRTAM  878

Query  365  GLLTLFQDSLLE-MDAGDIMRLLHNFPKTTSS  395
             +  +F D LL      D++ LL   P T SS
Sbjct  879  AIHEIFLDELLHAQQLEDVLPLLQRNPVTQSS  910

>SPRG_04368
Length=1142

 Score = 100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 78/270 (29%), Positives = 127/270 (47%), Gaps = 52/270 (19%)

Query  200   GIPKELRGRV---AEGSEVPLTTDINDRNRAR----RSSAVLPVQN--------------  238
             GIP  +R  V   A G+ + +T ++ D  R R    RS  +LP +               
Sbjct  834   GIPPSIRSTVWPLAIGNGLKITPEMYDIYRHRASKARSGEMLPTEGREHTVMLIHTDLPR  893

Query  239   -----MLKDAVG-----IAEMLVAH-----DLGYVQGMSYLAATLCFHM--DSFTAFKAL  281
                   L DA G     + E+L  +     DLGY+QGMSY+AA LC H+  D +  F+ L
Sbjct  894   TFPSLKLFDASGPYFEFLREVLETYACYRPDLGYIQGMSYIAALLCLHIPTDRYLTFQCL  953

Query  282   VALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW----  337
               +M    LF  + L+A  +  Y   ++      LP + AH Q  GI   MY ++W    
Sbjct  954   ANVMVHEHLFTFYLLKADLSHVYYAYFDDGFASTLPDVHAHLQSLGIQTSMYLMNWLQTL  1013

Query  338   ---SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLH-------  387
                 LPL++A R++D ++L G  F F+ ++G+++L   +LL+ +  + + LL        
Sbjct  1014  FLQVLPLEVASRVFDCFLLDGVGFLFRTALGIISLLSPTLLQSELEEALPLLQRHHQYHA  1073

Query  388   NFPKTTSSCQLFEAISSNPLETMAARGKQS  417
              +  T +  +LF+AI++  L +    G  S
Sbjct  1074  QWASTLTEDRLFDAIATMSLPSRITTGLDS  1103

>PYAP_17768
Length=112

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 61/100 (61%), Gaps = 19/100 (19%)

Query  594  LGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLL-----------------  636
            +GA+YSPT+I +TR DGQ++R +AV ++MDQL+ + Q  +QL                  
Sbjct  1    MGAIYSPTHITVTRADGQVSRQIAVAEMMDQLVRFQQHNAQLTVSSFPCFRFIEFSYFCN  60

Query  637  --MVQEQLGDQLQRSAEIINGLQNEVTMFRQMCLNLQAEL  674
              +    L + LQR A ++N LQNEV MFRQMCL+LQ E+
Sbjct  61   RQLANRSLQEDLQRGAAMVNSLQNEVAMFRQMCLSLQGEV  100

>PYVX_18712
Length=1302

 Score = 100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 80/142 (56%), Gaps = 9/142 (6%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSYLAA LC HM  D + AF+ L  LM    LF  + L+A  +  Y  ++++ 
Sbjct  1062  DLGYIQGMSYLAAMLCLHMPQDRYLAFQCLANLMVHEHLFTFYLLDAELSDVYYVLFDEF  1121

Query  312   LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
             L   LP L AH  + GI   MY ++W        LPL+LA R++D ++L GT F F+ ++
Sbjct  1122  LLARLPELHAHLADLGISNSMYLMNWLQTLFLQVLPLELAARVFDNFLLDGTVFLFRTAL  1181

Query  365   GLLTLFQDSLLEMDAGDIMRLL  386
              +  L    LL  D  + + +L
Sbjct  1182  AIHELLAPELLRADIDEALPIL  1203

>CCI45586
Length=955

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 84/155 (54%), Gaps = 10/155 (6%)

Query  254  DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
            DLGY+QGMSYLAA LC H+  + +  F+ L  LM    LF  + L+   +  Y +++ + 
Sbjct  754  DLGYIQGMSYLAAMLCLHIPTNPYLTFQCLANLMVQHHLFTFYLLDPALSNEYYQLFQEF  813

Query  312  LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
            L   LP +A  + E G+   MY ++W        LPL++A R++D ++L GT   F+ +M
Sbjct  814  LNLRLPQVAKKWHEMGLSTSMYLLNWLQTIFFQILPLEIAARVFDCFLLDGTDSLFRTAM  873

Query  365  GLLTLFQDSLLE-MDAGDIMRLLHNFPKTTSSCQL  398
             +  +F D LL      D++ LL   P T SS  L
Sbjct  874  AIHEIFIDELLHAQQLEDVLPLLQRNPTTQSSWAL  908

>H310_13597
Length=1191

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 93/169 (55%), Gaps = 12/169 (7%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSY+AA LC HM  D F  F+ L  +M    LF  + L+     +Y   +++ 
Sbjct  983   DLGYIQGMSYIAALLCLHMPTDRFLTFQCLANVMVHEHLFTFYLLDVDLAHNYYMWFDEF  1042

Query  312   LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
              + ELP L  HF   G+   ++ ++W        LPL++A R++D ++L G  F F+ ++
Sbjct  1043  FKMELPQLFQHFNSIGVPTSLFLMNWLQTLFLQVLPLEVASRVFDNFLLDGVLFLFRTAL  1102

Query  365   GLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPL-ETMAA  412
              +LTL   +LLE D    + LL    +  S  + FEA++ + L  T+AA
Sbjct  1103  AILTLLGPTLLENDLDVALPLLQRHYQHQS--RWFEALAEDKLFATIAA  1149

>PHYRA_73531
Length=1347

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 77/137 (56%), Gaps = 12/137 (9%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSYLAA LC HM  D + AF+ L  LM +  LF  + L+A     Y  +++  
Sbjct  1109  DLGYIQGMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFTFYLLDADLASVYYTLFDTF  1168

Query  312   LEHELPALAAHFQEQGI-DAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQAS  363
             L   LP L AH +E G+    MY ++W        LPL+ A R++D ++L GT F F+ +
Sbjct  1169  LNSRLPHLHAHLREIGVFSCSMYLMNWLQTLFLQVLPLESAARVFDNFLLDGTVFLFRTA  1228

Query  364   MGLLTLFQDSLL--EMD  378
             M +  L    LL  EMD
Sbjct  1229  MAIHELLAPQLLAAEMD  1245

>PPTG_04537
Length=1328

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/252 (30%), Positives = 120/252 (48%), Gaps = 53/252 (21%)

Query  189   EMPLLDALCFAGIPKELRGRV---AEGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVG  245
             + PL  +L   GIP  +R RV   A G+++ +T ++  R   RR++A    + + +DAV 
Sbjct  985   DTPLAHSLWRQGIPPSIRARVWPMAIGNKLKITPEMF-RIYRRRAAAYKKDRALKEDAVD  1043

Query  246   ---------------------------------IAEMLVAH-----DLGYVQGMSYLAAT  267
                                              + E+L  +     DLGY+QGMSYLAA 
Sbjct  1044  GGREHTLALIDTDLPRTFPSLKLFDSSGPYYAFLLEVLETYACYRPDLGYIQGMSYLAAM  1103

Query  268   LCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQE  325
             LC HM  D + AF+ L  LM +  LF  + L+A     Y  +++  L   LP L AH ++
Sbjct  1104  LCLHMPQDRYLAFQCLANLMVNEHLFTFYLLDADLASVYYTLFDAFLHSRLPHLHAHLRD  1163

Query  326   QGI-DAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEM  377
              G+    MY ++W        LPL+ A R++D ++L GT F F+ +M +  L    L++ 
Sbjct  1164  VGVFSCSMYLMNWLQTLFLQVLPLESAARVFDNFLLDGTVFLFRTAMAIHELLAPQLMQA  1223

Query  378   DAGDIMRLL-HN  388
             +   ++ +L HN
Sbjct  1224  EMDVVLPMLQHN  1235

>PHYSO_258036
Length=1271

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 94/331 (28%), Positives = 141/331 (43%), Gaps = 83/331 (25%)

Query  111   GYNPSHSEPTVFGRKLSDSVKTSTVGTTLHDR--------------RKAARKRVSKERRA  156
             G   S  +P  FGR       T TVGT  H R              R+A  ++  + RRA
Sbjct  851   GSEASEDDP-FFGRGSPGRPTTPTVGTRRHRRGSPPTLAMDLGEAPREAIHEKEEELRRA  909

Query  157   EKRRQQLPKIKQTFSEMWVEEVFTLPSGGTRAEMPLLDALCFAGIPKELRGRV---AEGS  213
             +K              +W   +  L       + PL  +L   GIP  +R RV   A G+
Sbjct  910   KK--------------LWRTRI--LRDWEENKDTPLAHSLWRQGIPPSIRARVWPMAIGN  953

Query  214   EVPLTTDI---------------------NDRNRARRSSAVLPVQNM--------LKDAV  244
             ++ +T ++                     +D +  R  +  L   ++        L D+ 
Sbjct  954   KLKVTPEMFKIYRRRAAAYKKDRAAKEKNDDVDGGREHTLALIDTDLPRTFPSLKLFDSS  1013

Query  245   G-----IAEMLVAH-----DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFD  292
             G     + E+L  +     DLGY+QGMSYLAA LC HM  D + AF+ L  LM +  LF 
Sbjct  1014  GPYYAFLLEVLETYACYRPDLGYIQGMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFT  1073

Query  293   MFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGI-DAQMYAVDW-------SLPLDLA  344
              + L+A     Y  +++  L   LP L AH +E G+    MY ++W        LPL+ A
Sbjct  1074  FYLLDADLANVYYTLFDTFLNSRLPHLHAHLREIGVFSCSMYLMNWLQTLFLQVLPLESA  1133

Query  345   LRLWDVYVLLGTPFFFQASMGLLTLFQDSLL  375
              R++D ++L GT F F+ +M +  L    LL
Sbjct  1134  ARVFDNFLLDGTVFLFRTAMAIHELLAPQLL  1164

>PITG_17882
Length=1289

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 81/146 (55%), Gaps = 11/146 (8%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSYLAA LC HM  D + AF+ L  LM +  LF  + L+A     Y  +++  
Sbjct  1051  DLGYIQGMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFTFYLLDADLANVYYTLFDAF  1110

Query  312   LEHELPALAAHFQEQGI-DAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQAS  363
             L   LP L AH ++ G+    MY ++W        LPL+ A R++D ++L GT F F+ +
Sbjct  1111  LSARLPHLHAHLRDVGVFSCSMYLMNWLQTLFLQVLPLESAARVFDNFLLDGTVFLFRTA  1170

Query  364   MGLLTLFQDSLLEMDAGDIMRLL-HN  388
             M +  L    L+  +   ++ LL HN
Sbjct  1171  MAIHELLAPQLMRAEMDVVLPLLQHN  1196

>SDRG_09643
Length=1125

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 78/270 (29%), Positives = 126/270 (47%), Gaps = 52/270 (19%)

Query  200   GIPKELRGRV---AEGSEVPLTTDINDRNRAR----RSSAVLPVQN--------------  238
             GIP  +R  V   A G+ + +T ++ D  R R    RS  +LP +               
Sbjct  817   GIPPSIRSTVWPLAIGNGLKITPEMYDIYRHRATKARSGEMLPTEGREHTVMLIHTDLPR  876

Query  239   -----MLKDAVG-----IAEMLVAH-----DLGYVQGMSYLAATLCFHM--DSFTAFKAL  281
                   L DA G     + E+L  +     DLGY+QGMSY+AA LC H+  D +  F+ L
Sbjct  877   TFPSLKLFDASGPYFEFLREVLETYACYRPDLGYIQGMSYIAALLCLHIPTDRYLTFQCL  936

Query  282   VALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW----  337
               +M    LF  + L+A  +  Y   Y+      LP + AH    GI   MY ++W    
Sbjct  937   ANVMVHEHLFTFYLLKADLSHVYYAYYDDYFASTLPDVHAHLMGLGIQTSMYLMNWLQTL  996

Query  338   ---SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLH-------  387
                 LPL++A R++D ++L G  F F+ ++G+++L   +LL+ +  + + LL        
Sbjct  997   FLQVLPLEVASRVFDCFLLDGVGFLFRTALGIISLLSPTLLQSELEEALPLLQRHHQYHA  1056

Query  388   NFPKTTSSCQLFEAISSNPLETMAARGKQS  417
              +  T +  +LF+AI++  L +    G  S
Sbjct  1057  QWASTLTEDRLFDAIATTSLPSRITTGLDS  1086

>HYAP_13668
Length=1203

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 74/135 (55%), Gaps = 10/135 (7%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSYLAA LC HM  D + AF+ L  LM +  LF  + L+A     Y  +++  
Sbjct  965   DLGYIQGMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFTFYLLDADLANVYYTLFDAF  1024

Query  312   LEHELPALAAHFQEQGI-DAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQAS  363
             L    P L AH +E GI    MY ++W        LPL+ A R++D ++L GT F F+ +
Sbjct  1025  LNSRHPHLHAHLREIGIMSCSMYLMNWLQTLFLQVLPLESATRVFDNFLLDGTVFLFRTA  1084

Query  364   MGLLTLFQDSLLEMD  378
             M +  L    L+  D
Sbjct  1085  MAIHELLGPRLIVAD  1099

>PHALS_06775
Length=1185

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 95/189 (50%), Gaps = 24/189 (13%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSYLAA LC HM  D + AF+ L  LM    LF  + L+A     Y  ++   
Sbjct  951   DLGYIQGMSYLAAMLCLHMPQDRYLAFQCLANLMVHEHLFTFYLLDAELASVYYTLFEAF  1010

Query  312   LEHELPALAAHFQEQGIDA-QMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQAS  363
             LE     L  HF+  GI +  MY ++W        LPL+ A R++D ++L GT F F+ +
Sbjct  1011  LEIRCSQLLVHFRNIGISSCSMYLMNWLQTLFLQVLPLESAARVFDNFLLDGTIFLFRIA  1070

Query  364   MGLLTLFQDSLLEMDAGDIMRLL-HNFPKTT------SSCQLFEAISSNPLETMAARGKQ  416
             M +  L    LL  +   ++ LL HN    T      S   LFE +S+  + T       
Sbjct  1071  MAIHELLAPQLLTAEMDVVLPLLQHNIMYQTIWHTQVSEQALFEKVSTIAVPT-------  1123

Query  417   SVFAAFNKL  425
              ++AA +++
Sbjct  1124  HIYAALDRV  1132

>H257_09861
Length=1164

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 9/134 (7%)

Query  254   DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
             DLGY+QGMSY+AA LC H+  D +  F+ L  +M    LF  + L+      Y   ++  
Sbjct  944   DLGYIQGMSYIAALLCLHIPTDRYLTFQCLANVMVHEHLFTFYLLDVDLANDYYMWFDVY  1003

Query  312   LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
              E ELP L  H  + GI + M+ ++W        LPL++A R++D ++L G    F+ ++
Sbjct  1004  FEMELPRLQTHLMQLGIPSSMFLMNWLQTLYLQVLPLEVASRVFDNFLLDGVLLLFRTAL  1063

Query  365   GLLTLFQDSLLEMD  378
              +LTL   +L+E D
Sbjct  1064  AILTLLGPTLMEHD  1077

>CCA22845
Length=431

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 85/191 (45%), Gaps = 49/191 (26%)

Query  227  ARRSSAVLPVQNMLKDAVGIAEMLVAHDLG----------YVQGMSYLAATLCFHMDSFT  276
            A R+  VL      +  +G  + L   DL           ++ GMSYLAA +C HMD+F 
Sbjct  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300

Query  277  AFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVD  336
            AFKAL ALMS++LLFDMFRL                           QE+   +  Y  D
Sbjct  301  AFKALSALMSTNLLFDMFRL---------------------------QERRRASVRYITD  333

Query  337  WSLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSC  396
              L                  F  + +  LL +++ +LLE+D  ++MRLLH FP   S+ 
Sbjct  334  RRLK------------YFCNEFHTKMAKALLKVYERNLLELDEAEMMRLLHKFPSDISAD  381

Query  397  QLFEAISSNPL  407
             LF A+ +  L
Sbjct  382  VLFTALGNVAL  392

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 86/160 (54%), Gaps = 20/160 (13%)

Query  99   SWVSELRALLAGGYNPSHSEPTVFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEK  158
            +W++E+RA      + S     V    LS S  T    T + D R   R +VSK RR E+
Sbjct  2    AWITEIRA------SQSQHTCKVVNSNLS-SESTHVWPTFIKDTRNQ-RNKVSKTRREER  53

Query  159  RRQQLPKIKQTFSEMWVEEVFTLPSGGTRAEMPLLDALCFAGIPKELRGRVAE---GSEV  215
            +R +L K+ ++F++ W+E++   P      +  L++ALCFAGIPKELRGRV     G+++
Sbjct  54   KRVKLKKLSKSFTDTWIEDILARPLS---TDSKLVEALCFAGIPKELRGRVWGWLLGNKL  110

Query  216  PLTTDI----NDRNRARRSSAVL--PVQNMLKDAVGIAEM  249
             +  ++     DR  A RS   L   V  ++K + G++ +
Sbjct  111  QINEELFIICKDRAEAVRSEIALQKEVDAIMKLSAGLSAL  150

>H257_00498
Length=371

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 92/202 (46%), Gaps = 19/202 (9%)

Query  227  ARRSSAVLPVQNMLKDAVGIAE-----MLVAH-----DLGYVQGMSYLAATLCFHMDSFT  276
            +R      P  ++ KDA  + +     +L A+     ++GY QGM +++A    +M    
Sbjct  153  SRDIGRTFPKHHLFKDATSLGQGALMNVLRAYSVYDPNVGYCQGMGFISALFLSYMPEEQ  212

Query  277  AFKALVALMSSSL--LFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYA  334
             F  +VA ++     + DM+R    R    +  ++Q ++  LP LA H   +G+   MYA
Sbjct  213  TFWHVVACLNQKKYGMADMYRPGMPRVMEIMWTFDQSMKQYLPKLADHLDAEGLHPTMYA  272

Query  335  VDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLH  387
              W       S P +   R+WD+Y+  G    ++ ++ LLT+ + +LL+     IM    
Sbjct  273  TQWFVTLYSYSFPFEFVTRVWDIYLHEGWKIVYRVALALLTVSEKTLLDASFEKIMEFFR  332

Query  388  NFPKTTSSCQLFEAISSNPLET  409
            + P +  + ++       PL T
Sbjct  333  DLPTSVHTAEVLAVALEIPLTT  354

>PYIR_13429
Length=253

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 7/67 (10%)

Query  593  ELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLMVQEQLG-------DQ  645
            +LGA+YSPT++KITR DGQMTRT+AV+++MDQL  +G Q +QL +VQEQL        +Q
Sbjct  185  DLGAIYSPTHVKITRADGQMTRTIAVSEMMDQLYLFGNQNAQLRIVQEQLTVANRSMQEQ  244

Query  646  LQRSAEI  652
            LQR A +
Sbjct  245  LQRDAVV  251

>SDRG_04304
Length=369

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 89/202 (44%), Gaps = 19/202 (9%)

Query  227  ARRSSAVLPVQNMLKDAVGIAE-----MLVAH-----DLGYVQGMSYLAATLCFHMDSFT  276
            +R      P  ++ KDA  I +     +L A+     D+GY QGM +++A    +M    
Sbjct  151  SRDIGRTFPKHHLFKDAQSIGQGALMNILKAYSVYDPDVGYCQGMGFISALFLSYMPEEH  210

Query  277  AFKALVALMSSSL--LFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYA  334
             F  LVA+++     L DM+R    R    I +++  +   LP L  H   +G+   MYA
Sbjct  211  TFWQLVAVLNQKKYGLADMYRPGMPRVVEIIAIFDACIRLYLPKLGVHMDNEGLHPTMYA  270

Query  335  VDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLH  387
              W       S P +   R+WD+++  G    ++ ++ LL + + +LL      IM    
Sbjct  271  TQWFVTIFAYSFPFEFVTRVWDIFLHEGWKIVYRVAIALLKISEKALLGKKFEKIMEFFK  330

Query  388  NFPKTTSSCQLFEAISSNPLET  409
            + P +    QL +     P+ T
Sbjct  331  DLPTSVDVKQLLDTAWDIPMTT  352

>SPRG_07340
Length=365

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 88/202 (44%), Gaps = 19/202 (9%)

Query  227  ARRSSAVLPVQNMLKDAVGIAE-----MLVAH-----DLGYVQGMSYLAATLCFHMDSFT  276
            +R      P  ++ KDA  I +     +L A+     D+GY QGM +++A    +M    
Sbjct  147  SRDIGRTFPKHHLFKDAQSIGQGALMNILKAYSVYDPDVGYCQGMGFISALFLSYMPEEH  206

Query  277  AFKALVALMSSSL--LFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYA  334
             F  LVA+++     L DM+R    R    I +++  +   LP L  H   +G+   MYA
Sbjct  207  TFWQLVAVLNQKKFGLADMYRPGMPRVVEIIAIFDACIRLYLPKLGTHMDNEGLHPTMYA  266

Query  335  VDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLH  387
              W       S P +   R+WD+++  G    ++ ++ LL + + +LL      IM    
Sbjct  267  TQWFVTIFAYSFPFEFVTRVWDIFLHEGWKIVYRVAIALLKISEKALLGKKFEKIMEFFK  326

Query  388  NFPKTTSSCQLFEAISSNPLET  409
              P +    QL +     P+ T
Sbjct  327  ELPTSVDVKQLLDTAWDIPMTT  348

>PYVX_16052
Length=291

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 78/164 (48%), Gaps = 9/164 (5%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL--LFDMFRLEATRTFHYIEVYNQI  311
            D+GY QGM +LAA    ++    AF  +VA ++     L +++R    +    + V  Q+
Sbjct  112  DVGYCQGMGFLAAVFLSYVPEPEAFWLVVACLNHRRYDLANLYRPGMPKVQEALFVCEQL  171

Query  312  LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
            L+  LP LAAH + +G+   MY   W       S P D   R+WD ++  G    F+ ++
Sbjct  172  LKARLPKLAAHLEREGLHPTMYLTQWLLTLFAYSFPFDFVTRVWDAFLHEGWKIVFRVAL  231

Query  365  GLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPLE  408
             LL L Q +LL++    +M      P    + Q+  A    PL+
Sbjct  232  ALLELAQPALLQLKFEAMMDFFRELPAQIDTEQVLAAAFRLPLK  275

>PHYCA_41956
Length=140

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 60/106 (57%), Gaps = 10/106 (9%)

Query  254  DLGYVQGMSYLAATLCFHM--DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
            DLGY+QGMSYLAA LC HM  D + AF+ L  LM +  LF  + L+A     Y  +++  
Sbjct  35   DLGYIQGMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFTFYLLDADLANVYYTLFDTF  94

Query  312  LEHELPALAAHFQEQGI-DAQMYAVDW-------SLPLDLALRLWD  349
            L   LP L AH +E G+    MY ++W        LPL+ A R++D
Sbjct  95   LNSRLPHLHAHLREIGVFSCSMYLMNWLQTLFLQVLPLESAARVFD  140

>PHALS_07987
Length=365

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 95/231 (41%), Gaps = 35/231 (15%)

Query  200  GIPKELRGRVAE---GSEVPLTTDIN-------------DRNRARRSSAVLPVQNMLKD-  242
            GIP+ LRGRV     GS   L+ +               +   AR      P   + +D 
Sbjct  104  GIPEALRGRVWSYLAGSSQMLSNNSGIYHQLVQTIGVPCEETIARDIGRTFPKHTLFRDR  163

Query  243  ----AVGIAEMLVAHDL-----GYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL--LF  291
                   +  ML A+ L     GY QGM +++A    +M    AF  LVA ++     L 
Sbjct  164  SSLGQCALMNMLKAYSLHDPEVGYCQGMGFISAMFLCYMPEQQAFWLLVACLNHKRYGLA  223

Query  292  DMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSL-------PLDLA  344
            D++R    +      V+  +L+ ++P L+ H + +G+   MY   W L       P DL 
Sbjct  224  DLYRPRMPKVLEVTYVFQGLLKQQMPHLSTHLENEGLHPTMYLTQWFLTLFTYNFPFDLV  283

Query  345  LRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSS  395
             R+WD ++  G    ++ ++ L+ + Q  L+      IM    + P    +
Sbjct  284  TRVWDAFLHEGWKVIYRVALALMKISQKILMNSKFESIMEYFRDLPNKVDT  334

>PHYRA_86528
Length=226

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)

Query  591  EAELGAVYSPTYIKITRVDGQMTRTVAVTDVMDQLLHYGQQTSQLLM  637
            EAELGAVY+P +I ITRVDGQM RTVAVT+VMDQLL   QQ SQLLM
Sbjct  180  EAELGAVYTPAHITITRVDGQMKRTVAVTEVMDQLLLSTQQNSQLLM  226

 Score = 40.8 bits (94),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 3/36 (8%)

Query  492  SPAGSPAEETSVADAKREEKQSEVMEPKRALADVIK  527
            SPAGSPAEE  V D  RE+K +E +EPKR LAD++K
Sbjct  76   SPAGSPAEE--VEDHVREQK-AEAVEPKRTLADLMK  108

>CCI40039
Length=365

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/244 (24%), Positives = 112/244 (46%), Gaps = 35/244 (14%)

Query  200  GIPKELRGRV----AEGSEVPL-----------TTDI-NDRNRARRSSAVLPVQNML--K  241
            GIP+ LRGRV    A  +++ +           T DI  + + AR      P   +   K
Sbjct  102  GIPEALRGRVWCHLAASTQMAMHNPGVYRELLQTIDIPCEDSIARDIGRTFPKHYLFHAK  161

Query  242  DAVG---IAEMLVAH-----DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL--LF  291
            +++G   +  +L A+     D+GY QGM++L+A    ++    +F  LVA ++     L 
Sbjct  162  NSLGQGALMNVLKAYSLHDPDVGYCQGMAFLSAMFLSYIPEEQSFWHLVACLNHKRYDLA  221

Query  292  DMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLA  344
            +++R    +    + V+ +++   +P +A H +E+G+    Y   W       S P +  
Sbjct  222  NIYRPGMPKVGELVFVFERLMALYIPRVAVHLREEGLHPTTYLSQWFITLFTYSFPFNFV  281

Query  345  LRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISS  404
             R+WD+++L G    ++ ++ L+ + Q  LL +    IM    + P T    ++     S
Sbjct  282  TRVWDIFLLEGWKIIYRVALALIKISQKQLLSIQFESIMEFFRDLPTTVQIEEVLAVAFS  341

Query  405  NPLE  408
             P++
Sbjct  342  IPIK  345

>PHYRA_73846
Length=359

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 95/231 (41%), Gaps = 45/231 (19%)

Query  200  GIPKELRGRVA---------------------EGSEVPLTTDINDRNRARRSSAVLPVQN  238
            GIP+ LRGRV                      + ++VP    I     AR      P  +
Sbjct  117  GIPEALRGRVWSHLAGSTQMLLNNPGAYHQLLQTAQVPCEETI-----ARDIGRTFPRHS  171

Query  239  MLKDAVGIAEMLVA--------HD--LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSS  288
            + +D   + +  +         HD  +GY QGM +L+A    +M    AF  LVA ++  
Sbjct  172  LFRDRSSLGQCALMNVLKAYSLHDPEVGYCQGMGFLSAMFLCYMPEQQAFWLLVACLNHK  231

Query  289  L--LFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSL-------  339
               L D++R    +      V+  +L+  +P L+AH + +G+   MY   W L       
Sbjct  232  RYGLADLYRPRMPKVPEVTFVFQALLKQLMPQLSAHLENEGLHPTMYLTQWFLTLFTYNF  291

Query  340  PLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFP  390
            P +   R+WD ++  G    ++ ++ LL + Q +LL      IM    + P
Sbjct  292  PFEFVTRVWDSFLHEGWKVIYRVALALLKISQKTLLSSKFEAIMEYFRDLP  342

>H310_01299
Length=378

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 89/202 (44%), Gaps = 19/202 (9%)

Query  227  ARRSSAVLPVQNMLKDAVGIAE-----MLVAH-----DLGYVQGMSYLAATLCFHMDSFT  276
            +R      P  ++ KD+  + +     +L A+     ++GY QGM +++A    +M    
Sbjct  160  SRDIGRTFPKHHLFKDSTSLGQGALMNVLRAYSVYDPNVGYCQGMGFISALFLSYMPEEQ  219

Query  277  AFKALVALMSSSL--LFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYA  334
             F  +VA ++     + D++R    R    + ++ Q ++  +P L  H   +G+   MYA
Sbjct  220  TFWHVVACLNQKKYGMADIYRPGMPRVMEIMWIFEQSMKLYVPKLTDHLAAEGLHPTMYA  279

Query  335  VDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLH  387
              W       S P +   R+WD+Y+  G    ++ ++ LL + +  LL      IM    
Sbjct  280  TQWFVTLYSYSFPFEFVTRVWDIYLHEGWKIVYRVAVALLKVSEKVLLGAKFEKIMEFFR  339

Query  388  NFPKTTSSCQLFEAISSNPLET  409
            + P +  + ++  A    P+ T
Sbjct  340  DLPTSVDTTEVLAAALEIPMTT  361

>PPTG_00980
Length=383

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/226 (25%), Positives = 96/226 (42%), Gaps = 35/226 (15%)

Query  200  GIPKELRGRV----AEGSEVPL-----------TTDI-NDRNRARRSSAVLPVQNMLKDA  243
            GIP+ LRGRV    A  S++ L           TT +  +   AR      P  ++ +D 
Sbjct  122  GIPEALRGRVWSHLAGSSQMLLNNPGAYHQLLQTTQVPCEETIARDIGRTFPKHSLFRDR  181

Query  244  VGIAEMLVA--------HD--LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL--LF  291
              + +  +         HD  +GY QGM +L A    +M    AF  LVA ++     L 
Sbjct  182  SSLGQCALMNVLKAYSLHDPEVGYCQGMGFLTAMFLCYMPEQQAFWLLVACLNHKRYGLA  241

Query  292  DMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSL-------PLDLA  344
            D++R    +      ++  + +  +P L+AH + +G+   MY   W L       P +  
Sbjct  242  DLYRPRMPKVPEVTFIFEGLFKQLMPQLSAHLENEGLHPTMYLTQWFLTLFTYNFPFEFV  301

Query  345  LRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFP  390
             R+WD ++  G    ++ ++ L+ + Q +LL      IM    + P
Sbjct  302  TRVWDAFLHEGWKVIYRVALALMKISQKTLLSAKFETIMDYFRDLP  347

>PHYSO_313441
Length=361

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/226 (25%), Positives = 94/226 (42%), Gaps = 35/226 (15%)

Query  200  GIPKELRGRVAE---GSEVPLTTDINDRNR-------------ARRSSAVLPVQNMLKDA  243
            GIP+ LRGRV     GS   L  +    ++             AR      P  ++ +D 
Sbjct  119  GIPEALRGRVWSHLAGSSQMLLNNPGAYHQLLQTARVPCEETIARDIGRTFPRHSLFRDR  178

Query  244  VGIAEMLVA--------HD--LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL--LF  291
              + +  +         HD  +GY QGM +L+A    +M    AF  LVA ++     L 
Sbjct  179  SSLGQCALMNVLKAYSLHDPEVGYCQGMGFLSAMFLCYMPEQQAFWLLVACLNHKRYGLA  238

Query  292  DMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSL-------PLDLA  344
            D++R    +      V+  + +  +P L+AH + +G+   MY   W L       P +  
Sbjct  239  DLYRPRMPKVPEVTFVFQGLFKQIMPQLSAHLENEGLHPTMYLTQWFLTLFTYNFPFEFV  298

Query  345  LRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFP  390
             R+WD ++  G    ++ ++ LL + Q +LL      IM    + P
Sbjct  299  TRVWDAFLHEGWKVIYRVALALLKVSQKTLLSSKFETIMEYFRDLP  344

>PITG_01821
Length=372

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 95/226 (42%), Gaps = 35/226 (15%)

Query  200  GIPKELRGRV----AEGSEVPL-----------TTDI-NDRNRARRSSAVLPVQNMLKDA  243
            GIP+ LRGRV    A  S++ L           TT +  +   AR      P  ++ +D 
Sbjct  121  GIPEALRGRVWSHLAGSSQMLLNNPGAYHQLLQTTQVPCEETIARDIGRTFPKHSLFRDR  180

Query  244  VGIAEMLVA--------HD--LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL--LF  291
              + +  +         HD  +GY QGM +L A    +M    AF  LVA ++     L 
Sbjct  181  SSLGQCALMNVLKAYSLHDPEVGYCQGMGFLTAMFLCYMPEQQAFWLLVACLNHKRYGLA  240

Query  292  DMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSL-------PLDLA  344
            D++R    +      ++  + +  +P L+AH + +G+   MY   W L       P +  
Sbjct  241  DLYRPRMPKVPEVTFIFEGLFKQLMPQLSAHLENEGLHPTMYLTQWFLTLFTYNFPFEFV  300

Query  345  LRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFP  390
             R+WD ++  G    ++ ++ L+ L Q +LL      IM      P
Sbjct  301  TRVWDAFLHEGWKVIYRVALALMKLSQKTLLSSKFELIMEYFRELP  346

>CCA14002
Length=782

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 112/244 (46%), Gaps = 35/244 (14%)

Query  200  GIPKELRGRV----AEGSEVPL-----------TTDIN-DRNRARRSSAVLPVQNML--K  241
            GIP+ LRGRV    A  +++ +           T DI  + + AR      P   +   K
Sbjct  518  GIPEALRGRVWCHLAASTQMAMHNPGVYRELLQTIDIPFEDSIARDIGRTFPKHYLFHAK  577

Query  242  DAVG---IAEMLVAH-----DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL--LF  291
            +++G   +  +L A+     D+GY QGM++L+A    ++    +F  LVA ++     L 
Sbjct  578  NSLGQGALMNVLKAYSLHDPDVGYCQGMAFLSAMFLSYIPEEQSFWHLVACLNHKRYDLA  637

Query  292  DMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLA  344
            +++R    +    + V+ +++   +P +A H +E+G+    Y   W       S P +  
Sbjct  638  NIYRPGMPKVGELVFVFEKLMALYIPRVAIHLREEGLHPTTYLSQWFITLFTYSFPFNFV  697

Query  345  LRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISS  404
             R+WD+++L G    ++ ++ L+ + Q  LL +    IM    + P T    Q+     S
Sbjct  698  TRVWDIFLLEGWKIIYRVALALIKISQKQLLSIQFEAIMEFFRDLPTTVQIDQVLAVAFS  757

Query  405  NPLE  408
             P++
Sbjct  758  IPIK  761

>PYIR_21637
Length=354

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/231 (23%), Positives = 93/231 (40%), Gaps = 45/231 (19%)

Query  200  GIPKELRGRVA---------------------EGSEVPLTTDINDRNRARRSSAVLPVQN  238
            GIP+ LRGRV                      +   VP    I     AR      P   
Sbjct  126  GIPEALRGRVWCHLAGSTQMMINNPGVYHDFLQSKSVPCEETI-----ARDIGRTFPKHY  180

Query  239  MLKDAVGIAEMLVA--------HD--LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSS  288
            +  +   + +  +         HD  +GY QGM +L+A    +M    +F  LVA ++  
Sbjct  181  LFNERTSLGQCALMNVLKAYSLHDPEVGYCQGMGFLSAMFLSYMPEEQSFWHLVACLNHK  240

Query  289  L--LFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SL  339
               L +++R    +    I V+ ++++  +P +A H + +G+   MY   W       + 
Sbjct  241  RYDLANLYRPRMPKVPELIFVFEKLMDQLMPQVARHLEAEGLHPTMYLTQWFITLFTYNF  300

Query  340  PLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFP  390
            P +   R+WD+++  G    F+ ++ L+ + Q +LL +    IM      P
Sbjct  301  PFEFVTRVWDMFLYEGWKVIFRVALALMKVSQKTLLSIKFEGIMEFFRELP  351

>PYAP_24506
Length=597

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 71/132 (54%), Gaps = 10/132 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL-LFDMFRLEATRTFHYIEVYNQILE  313
            +GY Q M+++AA L  HM+   AF  LVA++   +  +    +  +R      V++++++
Sbjct  284  VGYCQSMNFIAAVLLQHMEEEEAFWVLVAMVEDLIPQYHTKNMLGSRAEQ--RVFSELVQ  341

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
             +LP+L  H Q  G+D + + + W       +LPL+  +R+WDV+   G+    +  + L
Sbjct  342  QKLPSLFRHLQALGVDLEPFTLKWFLCLFLNTLPLETVMRIWDVFFSEGSHVILRVGLVL  401

Query  367  LTLFQDSLLEMD  378
            L L Q  ++E D
Sbjct  402  LKLIQQRIVECD  413

>CCA16834
Length=613

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 77/157 (49%), Gaps = 16/157 (10%)

Query  249  MLVAHDL-----GYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            ML A+ L     GY Q M+++   +   M    AF  L AL+     F +     ++T  
Sbjct  391  MLAAYSLHNPSIGYCQSMNFITGMMLLFMPEEDAFWLLTALLHEKPSFYLCAGNYSQTML  450

Query  304  YIE----VYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYV  352
                   V+ Q+++  LP +A+HF+  GI  Q+  + W       +LP + ALR+WDV++
Sbjct  451  GSRTDQLVFQQLVQKCLPDIASHFKANGIQIQLITLHWFLCGFLRTLPTETALRVWDVFL  510

Query  353  LLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
            L G    FQ ++ +L  ++  +L+ +  D+  ++ + 
Sbjct  511  LDGQKILFQVALAILDWYRPCILKAEHDDLQAMMRDL  547

>PHYCA_541937
Length=277

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/252 (23%), Positives = 98/252 (39%), Gaps = 48/252 (19%)

Query  200  GIPKELRGRV---------------------AEGSEVPLTTDINDRNRARRSSAVLPVQN  238
            GIP+ LRGRV                      + + VP    I     AR      P  +
Sbjct  27   GIPEALRGRVWSHLAGSSQMLLNNPGAYHQLLQAAHVPCEETI-----ARDIGRTFPRHS  81

Query  239  MLKD-----AVGIAEMLVAHDL-----GYVQGMSYLAATLCFHMDSFTAFKALVALMSSS  288
            + +D        +  +L A+ L     GY QGM +L+A    +M    AF  LVA ++  
Sbjct  82   LFRDRSSLGQCALMNVLKAYSLHDPEVGYCQGMGFLSAMFLCYMPEQQAFWLLVACLNHK  141

Query  289  L--LFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSL-------  339
               L D++R    +      ++  + +  +P L+ H + +G+   MY   W L       
Sbjct  142  RYGLADLYRPRMPKVPEVTFIFEGLFKQYMPQLSTHLENEGLHPTMYLTQWFLTLFTYNF  201

Query  340  PLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLF  399
            P +   R+WD ++  G    ++ ++ L+ + Q +LL      IM    + P    +    
Sbjct  202  PFEFVTRVWDAFLHEGWKVIYRVALALMKISQKTLLSAKFEAIMDYFRDLPNKVRA---I  258

Query  400  EAISSNPLETMA  411
            E +   P   +A
Sbjct  259  EVLGVCPCADIA  270

>SDRG_04575
Length=1003

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 105/219 (48%), Gaps = 12/219 (5%)

Query  928   ARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVE  987
             A+   RL Q+A      L       ++  +F    F ++++ + +G     R W L +++
Sbjct  399   AKYPQRLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLD  456

Query  988   EWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAH-CCQFDRKSKSTPRNV  1046
             +W        +D V  + G  GTGKSA    + Q  R  + A H  C+ D +++S  R  
Sbjct  457   QWKQT-----HDQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSH-RRC  509

Query  1047  LLSFVHQLVDNLPPFKNQLARLN-LKYVLEESDPFLLAAKVFVDPLNAVEEPIHATF-ML  1104
             +LS  +QL   LP + + L + + L+ V+  S    L   + V PL+A+ EP      +L
Sbjct  510   ILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVIL  569

Query  1105  VEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSK  1143
             ++GLD         N L+  L  ++ +LPSWV  +++S+
Sbjct  570   LDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVILTSR  608

>PYVX_23242
Length=516

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 87/174 (50%), Gaps = 17/174 (10%)

Query  222  NDRNRARRSSAVLPVQNMLKDAVGIAEMLVAHDLGYVQGMSYLAATLCFHMDSFTAFKAL  281
            NDR R RR+ ++  ++ +L+     A  +    +GY Q M++LAA L   M+   AF  L
Sbjct  167  NDRAR-RRNKSISELRRVLQ-----AYSVRNPAIGYCQSMNFLAAVLLHQMEEEEAFWVL  220

Query  282  VALMSS-SLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW---  337
            VA++   +  +    +  +R      V++ +++ +LPAL  H Q  G+D + + + W   
Sbjct  221  VAIVEELTPQYHTRSMSGSRADQ--RVFSDLVQQKLPALYHHMQRLGVDFEPFTLKWFLC  278

Query  338  ----SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEM-DAGDIMRLL  386
                +LP +  +R+WDV+   G+    +  + LL L Q  +L   DA D+  L 
Sbjct  279  LFLNTLPFEPVMRIWDVFFCEGSHVLLRVGLALLKLNQPRILACDDAFDVYELF  332

>SPRG_12621
Length=1003

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 136/317 (43%), Gaps = 43/317 (14%)

Query  979   RTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAH-CCQFDR  1037
             R W L ++++W        +D V  V G  GTGKSA    + Q  R  + A H  C+ D 
Sbjct  461   REWVLDQLDQWKQT-----HDQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDE  514

Query  1038  KSKSTPRNVLLSFVHQLVDNLPPFKNQLARLN-LKYVLEESDPFLLAAKVFVDPLNAVEE  1096
             +++S  R  +LS  +QL   LP + + L + + L+ V+  S    L   + V PL A+ E
Sbjct  515   QTQSH-RRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAE  573

Query  1097  PIHATF-MLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISS-------KPFSKF  1148
             P      +L++GLD         N L+  L  ++ +LPSWV  +++S       +    F
Sbjct  574   PATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQGF  633

Query  1149  AKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSA----EAK-RVLKRKSGGNFA  1203
             A ++ +    D S +      D+ S +      +    +A    EA  + +  ++ G F 
Sbjct  634   APQIALDKCADHSRQ------DIMSYLQKALLPYLPSTTAGVVPEATLQFIAGRAEGLFL  687

Query  1204  YLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKP  1263
             Y      ALS   + + + EG          P  +     + FE +F     +     +P
Sbjct  688   YASHIVHALSQHRLTLDNLEG---------FPTGMGGYLRQFFESQFTPEHYK--EHIRP  736

Query  1264  LLQLIVGAAAGPYSPVT  1280
             LL+++  A    Y P+T
Sbjct  737   LLEVLCAA----YEPLT  749

>PYU1_G004829
Length=637

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 68/133 (51%), Gaps = 10/133 (8%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSS-SLLFDMFRLEATRTFHYIEVYNQIL  312
            D+GY Q M++LAA L  HM+   AF  LVA++   +  +    +  +R      V++ ++
Sbjct  337  DIGYCQSMNFLAAILLHHMEEEEAFWVLVAMVEELTPHYHARSMAGSRADQ--RVFSDLV  394

Query  313  EHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMG  365
            + +LP+L  H Q  G+D + + + W       +LP +  LR+WD+    G+    +  + 
Sbjct  395  QQKLPSLYQHMQHLGVDFEPFTLKWFLCSFLNTLPFEPVLRIWDLLFCEGSHVLLRVGLT  454

Query  366  LLTLFQDSLLEMD  378
            LL L Q  +L  D
Sbjct  455  LLKLMQPRILACD  467

>PHYKE_4935
Length=293

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 77/181 (43%), Gaps = 24/181 (13%)

Query  211  EGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVA--------HD--LGYVQG  260
            E S VP    I     AR      P  ++ +D   + +  +         HD  +GY QG
Sbjct  112  ETSHVPCEETI-----ARDIGRTFPRHSLFRDRSSLGQCALMNVLKAYSLHDPEVGYCQG  166

Query  261  MSYLAATLCFHMDSFTAFKALVALMSSSL--LFDMFRLEATRTFHYIEVYNQILEHELPA  318
            M +L+A    +M    AF  LVA ++     L D++R    +      V+  + +  +P 
Sbjct  167  MGFLSAMFLCYMPEQQAFWLLVACLNHKRYGLADLYRPRMPKVPEVTFVFEGLFKQLMPQ  226

Query  319  LAAHFQEQGIDAQMYAVDWSL-------PLDLALRLWDVYVLLGTPFFFQASMGLLTLFQ  371
            L+AH + +G+   MY   W L       P +   R+WD ++  G    F+ ++ LL   Q
Sbjct  227  LSAHLENEGLHPTMYLTQWFLTLFTYNFPFEFVTRVWDAFLHEGWKIIFRVALALLKTSQ  286

Query  372  D  372
            +
Sbjct  287  N  287

>CCI42299
Length=614

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 71/146 (49%), Gaps = 11/146 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIE----VYNQ  310
            +GY Q M+++   +   +    AF  L  L+     F +     ++T         V+ +
Sbjct  410  IGYCQSMNFITGMMLLFIPEEDAFWLLSVLLHEDPSFYLCAENYSQTMLGSRTDQLVFQK  469

Query  311  ILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQAS  363
            +++   P +AAHF+  GI   +  + W       +LP + ALR+WDV++L G   FF+ +
Sbjct  470  LIQKRYPDIAAHFKANGIQIHLITLHWFLCGFLRTLPTETALRVWDVFLLDGQQVFFRVA  529

Query  364  MGLLTLFQDSLLEMDAGDIMRLLHNF  389
            + +L  ++ S+LE    D+  LL + 
Sbjct  530  LAILEWYRPSILEAGTDDLQALLRDL  555

>CCI42301
Length=601

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 71/146 (49%), Gaps = 11/146 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIE----VYNQ  310
            +GY Q M+++   +   +    AF  L  L+     F +     ++T         V+ +
Sbjct  410  IGYCQSMNFITGMMLLFIPEEDAFWLLSVLLHEDPSFYLCAENYSQTMLGSRTDQLVFQK  469

Query  311  ILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQAS  363
            +++   P +AAHF+  GI   +  + W       +LP + ALR+WDV++L G   FF+ +
Sbjct  470  LIQKRYPDIAAHFKANGIQIHLITLHWFLCGFLRTLPTETALRVWDVFLLDGQQVFFRVA  529

Query  364  MGLLTLFQDSLLEMDAGDIMRLLHNF  389
            + +L  ++ S+LE    D+  LL + 
Sbjct  530  LAILEWYRPSILEAGTDDLQALLRDL  555

>PYVX_21513
Length=1446

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 77/346 (22%), Positives = 137/346 (40%), Gaps = 52/346 (15%)

Query  979   RTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  1038
             R W   RV++W++   +  +  V  + G  G+GK++    + Q F   + A H    +  
Sbjct  438   RDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDD  496

Query  1039  SKSTPRNVLLSFVHQLVDNLPPFKNQL-ARLNLKYVLEESDPFLLAAKVFVDPLNAVEEP  1097
                  R  +LS  +QL   LP +   L +R  L+ ++  S    L   + V+PLN ++ P
Sbjct  497   QTHIARRCVLSLAYQLTTQLPEYGVFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRP  556

Query  1098  IHATFMLVEGLDQCSAGPNGR---------------NELLEFLSQIIPQLPSWVGFMISS  1142
                  +L++GL+   +G                     L+  L  ++ +LPSWV  ++ S
Sbjct  557   AKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLS  616

Query  1143  KPFSKFAKRLPV---SSVLD-FSAKN--------GAFVSDVSSLVDDIARNFSDEDSAEA  1190
             +       RL     S V+D F+ +N        G+ ++   SL  DI    + E S  +
Sbjct  617   REDHDVMTRLQTYIPSVVIDHFAQENECDIKKFVGSALAPKKSLA-DIVEAATAETSGRS  675

Query  1191  K-----------RVLKRKSGGNFAYLEFTKQA-----LSHPGMAMASKEGAVPLEVLDDL  1234
             +           R  + + G     +E   +      L    +    +EG V L  LD L
Sbjct  676   RLTTLARHVSFIRSPRNRPGATTEQIEMIARRAEGLFLYAANIVQGIEEGRVALNELDKL  735

Query  1235  PQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVT  1280
             P  +     + F+  F     +     +P L+++  A    Y P+T
Sbjct  736   PTGMGGCLRQFFDSHFDDNTYK--TTIRPALEVLCAA----YEPLT  775

>PYAP_14184
Length=1184

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 95/192 (49%), Gaps = 18/192 (9%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            LGY QG++YL A L   ++   AF  L+ ++   L+ D +            V+  ++  
Sbjct  372  LGYCQGLNYLVARLLLFVEEEEAFYLLIKMIG--LVPDDYYTTMLGLAVDQHVFADLVRL  429

Query  315  ELPALAAHFQE---QGIDAQMYAVDWSLPL-------DLALRLWDVYVLLGTPFFFQASM  364
            + P +A H +E    G++  +   +W L L       ++ LR+WD+  LLG    F+ ++
Sbjct  430  QAPDVAKHLEELGGSGMELSLACTEWFLTLFSSPCARNVTLRIWDLIFLLGDEILFRVAL  489

Query  365  GLLTLFQDSLLEMDA-GDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQSVFAAFN  423
             LL L +D+L++ +  GD++R L+   +  +       + +   ET+  R +   F A +
Sbjct  490  ALLDLDKDTLMKCNTYGDMLRQLNEIGRKETDADRL-VVEAQKKETV-CRMRIDDFRAHH  547

Query  424  KLQV---IAVES  432
            +LQ+   IAV+S
Sbjct  548  RLQLATGIAVQS  559

>H310_08292
Length=1007

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 80/353 (23%), Positives = 137/353 (39%), Gaps = 31/353 (9%)

Query  929   RASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEE  988
             + +VR+ QL       L       ++  +F    F +E+A   +G     R W + ++ +
Sbjct  407   KYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIAKFTQGF--AGREWVMDQLTQ  464

Query  989   WLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLL  1048
             W              V G  GTGK+A    + Q  +  + A H    D +    PR  +L
Sbjct  465   W-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCIL  518

Query  1049  SFVHQLVDNLPPFKNQLARLN-LKYVLEESDPFLLAAKVFVDPLNAVEEPIHATF-MLVE  1106
             S  +QL   LP +   L +   L+ ++  S    L   + V PLNA+ +P      +L++
Sbjct  519   SLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILLD  578

Query  1107  GLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLP--VSSV-LDFSAK  1163
             GLD         N  +  L  ++ +LPSWV  + +S+      ++L   V  V LD    
Sbjct  579   GLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALDKCVD  638

Query  1164  NGAFVSDVSSLVDDIARNFSDEDSA-----EAKRVLKRKSGGNFAYLEFTKQALSHPGMA  1218
               +  +D+   +      F   D       E    +  +S G F Y      AL      
Sbjct  639   QSS--ADMLKYLQAALVPFVRPDEGAVVPLETLHAIVARSEGLFLYASHIVHAL------  690

Query  1219  MASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGA  1271
                 +  + L+ L+  P  +     + FED+F           +PLL+++  A
Sbjct  691   ---HQKRLTLDKLESFPVGMGGYLRQFFEDQFSAHHYE--TSIRPLLEVLCAA  738

>PYU1_G005666
Length=338

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/130 (24%), Positives = 65/130 (50%), Gaps = 9/130 (7%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL--LFDMFRLEATRTFHYIEVYNQI  311
            ++GY QGM +L+A    +M    +F  LVA ++     L +++R    +    I ++ ++
Sbjct  204  EVGYCQGMGFLSAMFLSYMPEEQSFWHLVACLNHKRYDLANLYRPRMPKVPELIFIFEKL  263

Query  312  LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
            +E  +P +A H + +G+   MY   W       + P +   R+WD+++  G    F+ ++
Sbjct  264  MEQLMPQIAKHLESEGLHPTMYLTQWFITLFTYNFPFEFVTRVWDMFLYEGWKIIFRVAL  323

Query  365  GLLTLFQDSL  374
             L+ + Q  +
Sbjct  324  ALMKISQSEV  333

>PYAR_13649
Length=397

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/158 (27%), Positives = 68/158 (43%), Gaps = 9/158 (6%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL--LFDMFRLEATRTFHYIEVYNQI  311
            ++GY QGM +L A    +M    +F  LVA ++     L  ++R    +    + V+ ++
Sbjct  192  EVGYCQGMGFLTAMFLSYMPEEQSFWHLVACLNHKRYDLAGLYRPRMPKVPEVMFVFERL  251

Query  312  LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
            L   LP LA H + +G+   MY   W       S P D   R+WD ++  G    F+ ++
Sbjct  252  LATHLPVLARHLESEGMHPTMYLTQWFVTLFTYSFPFDFVTRVWDAFLCEGWKVIFRVAL  311

Query  365  GLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAI  402
             LL + Q              L  +P T  S +   AI
Sbjct  312  ALLKISQSEFHNYYYYYYYWSLTTYPLTFFSTEALLAI  349

>PHYKE_9410
Length=462

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 75/160 (47%), Gaps = 29/160 (18%)

Query  255  LGYVQGMSYLAA----------TLC-FHMDSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            +GY QGM Y+AA          T C    +S +AF  LV L     L DMF        H
Sbjct  261  VGYCQGMDYVAAHVLNKVKRGGTACDTKTESESAFWLLVTLFEQYGLHDMF----APGLH  316

Query  304  YIEVY----NQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDV  350
             + V+     ++LE   PALA HF ++ +  +M+AV W          LP D   R+WD+
Sbjct  317  KLHVHCFQTQRLLELTEPALAEHFMQEKVPIEMFAVGWFQTLYLYLNVLPTDSLDRIWDI  376

Query  351  YVLLGT-PFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
            ++   T     + ++ LL L ++ ++E    +IM+  + F
Sbjct  377  FLFEKTWKILLRVAVALLQLSKEHVMEKPIDEIMQFFNTF  416

>PYIW_24571
Length=390

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 66/132 (50%), Gaps = 10/132 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSS-SLLFDMFRLEATRTFHYIEVYNQILE  313
            +GY Q M++LAA L  HM+   AF  LVAL+   +  +    +  +R      V+  +++
Sbjct  76   IGYCQSMNFLAAVLLHHMEEEEAFWVLVALVEELTPHYHTRSMSGSRADQ--RVFADLVQ  133

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
             +LPAL  H +  G+D + + + W       +LP +  +R+WDV    G+    +  + L
Sbjct  134  QKLPALFQHMRTLGVDFEPFTLKWFLCLFLNTLPFEPVMRIWDVVFCEGSHVLLRVGLAL  193

Query  367  LTLFQDSLLEMD  378
            L L Q  +L  D
Sbjct  194  LKLNQPRILACD  205

>PYAR_19963
Length=568

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 69/132 (52%), Gaps = 10/132 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL-LFDMFRLEATRTFHYIEVYNQILE  313
            +GY Q M++LAA L  ++D   AF  LVA++   +  F    +  +R      V++++++
Sbjct  267  IGYCQSMNFLAAVLLQYLDEEEAFWVLVAMVEELIPQFHSKSMVGSRAEQ--RVFSELVQ  324

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
             +LP +  H Q  G+D + + + W       +LPL+  +R+WDV+   G+    +  + L
Sbjct  325  LKLPQVYQHMQSLGVDLEPFTLKWFLCLFLNTLPLEPVMRVWDVFFCEGSHVLLRVGLTL  384

Query  367  LTLFQDSLLEMD  378
            L L Q  +L  D
Sbjct  385  LKLSQPRILACD  396

>PYIR_16290
Length=570

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/245 (24%), Positives = 107/245 (44%), Gaps = 48/245 (20%)

Query  175  VEEVFTLPSGGTRAEMPLL----DALCFAGIPKELRGRV-------AEGSEVPLTT--DI  221
            V++VF+  +    AE+ LL    D+L  +GIP  LRGRV       AE     + +  D+
Sbjct  139  VKQVFS--NFANAAEVLLLSRQFDSLLRSGIPPHLRGRVWWMSSGAAEKQHAAVESYPDL  196

Query  222  NDRNRARRSSAVLPVQNMLKDAVGIAEMLVAHD-----------------------LGYV  258
              R       A + ++  L     + ++  + D                       +GY 
Sbjct  197  VKRLHTLSKCASMEIEKDLPRTFPVEQVADSEDHLRQSSMGELRRVLQAYSLRNPKIGYC  256

Query  259  QGMSYLAATLCFHMDSFTAFKALVALMSS-SLLFDMFRLEATRTFHYIEVYNQILEHELP  317
            Q M++LAA L  HM+   AF  LV+++   +  +    +  +R      V++ +++ +LP
Sbjct  257  QSMNFLAAVLLHHMEEEEAFWVLVSIVEELTPHYHTRSMAGSRADQ--RVFSDLVQQKLP  314

Query  318  ALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLF  370
             L  H +  G+D + + + W       +LP +  +R+WDV+   G+    +  + LL L 
Sbjct  315  TLYQHMRSLGVDFEPFTLKWFLCLFLNTLPFEPVMRIWDVFFCEGSHVLLRVGLALLKLN  374

Query  371  QDSLL  375
            Q  ++
Sbjct  375  QPRIM  379

>PYAP_19866
Length=637

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/154 (27%), Positives = 68/154 (44%), Gaps = 16/154 (10%)

Query  254  DLGYVQGMSYLAATLCFHM----DSFTA-----FKALVALMSSSLLFDMFRLEATRTFHY  304
            D+GY QGM+Y+AA L  HM    D+  A     F  L AL+    + DM+R +       
Sbjct  152  DIGYCQGMNYVAAALLIHMTRQPDASIAPQEASFWLLTALVRHYGMDDMWRAKMPGLSRS  211

Query  305  IEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTP  357
            + VY Q+L      L  H +  G+   +    W        L LD+ +R+WD+ ++ G  
Sbjct  212  LHVYQQLLRRHFYDLHTHLRNIGMHPSLLVTQWFATLFARVLSLDVLVRVWDIVLVDGWK  271

Query  358  FFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPK  391
              F+ ++ +    +  ++ MD       L   P+
Sbjct  272  MIFRIALAITAHLRPQIISMDIEACSEFLRKHPR  305

>H257_11773
Length=1026

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 84/355 (24%), Positives = 146/355 (41%), Gaps = 35/355 (10%)

Query  929   RASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEE  988
             + +VRL QL       L       ++  +F    F +E++   +G     R W + ++ E
Sbjct  422   KYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLTE  479

Query  989   WLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLL  1048
             W        +     + G  GTGK+A   +V Q  +  + A H    + +     R  +L
Sbjct  480   W-----KASSSQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCVL  533

Query  1049  SFVHQLVDNLPPFKNQLARLN--LKYVLEESDPFLLAAKVFVDPLNAVEEPIHATF-MLV  1105
             S  +QL   LP +   L + +  L+ ++  S    L   + V PLNA+ +P      +L+
Sbjct  534   SLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVILI  593

Query  1106  EGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLP--VSSV-LDFSA  1162
             +GLD         N  +  L+  +  LP WV ++++S+      ++L   V  V LD   
Sbjct  594   DGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALD---  650

Query  1163  KNGAFVSDVS------SLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPG  1216
             K G    D        +LV  +A    D  +A  + +++R S G F Y      ALS   
Sbjct  651   KCGHQTRDDMLKYLQLALVQFVANADKDVPAATLRFIVER-SEGLFLYASHIVNALS---  706

Query  1217  MAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGA  1271
                   +  + L+ L+  P  +     + FED+F           +PLL+++  A
Sbjct  707   ------QKRLTLDKLESFPVGMGGYLRQYFEDQFTALHYE--TSVRPLLEVLCAA  753

>PYAP_22230
Length=1116

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 96/420 (23%), Positives = 158/420 (38%), Gaps = 89/420 (21%)

Query  979   RTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  1038
             R W L  + +W++     G+  V  V G  G+GK++    + Q     + A H    D  
Sbjct  496   RAWLLESIRQWINTPVTSGS-KVFWVTGQIGSGKTSVAARMVQ-LMPEIAAFHFALQDDD  553

Query  1039  SKSTPRNVLLSFVHQLVDNLPPFKNQLARLN-LKYVLEESDPFLLAAKVFVDPLNAVEEP  1097
                  R  +LS  +QL   LP +   L   + L+ ++  S    L   + V+PLNA+  P
Sbjct  554   QTQLARRCVLSLAYQLTTQLPEYAVFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAIARP  613

Query  1098  I--HATFMLVEGL-------DQCSAGPN------GRNE---------------------L  1121
                    +L++GL       D  + GP       GR                       L
Sbjct  614   KSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGSSDECL  673

Query  1122  LEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPV---SSVLDFSAKNG-----AFV-----  1168
             +  L  +I +LP WV  ++ S+       +L V   S  LD   +        FV     
Sbjct  674   VSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENEADIREFVEMALC  733

Query  1169  ------SDVSSLVD---------------DIARNFSDEDSAEAKRVLKRKSGGNFAYLEF  1207
                   S +S  V                 ++ N   + SAE   V+ ++S G F Y   
Sbjct  734   SPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKISAEQVEVITKRSEGLFLYAAN  793

Query  1208  TKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQL  1267
               QA+         +EG + ++ L+ LP  L     + FE  F     +   K +P+L++
Sbjct  794   IVQAI---------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYK--TKIRPVLEV  842

Query  1268  IVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAY-RLESSALCSWLSD  1326
             +  A    Y P+T       F ++T + + +  SF  L+ V    Y R   S++  W+ D
Sbjct  843   LCAA----YEPMTTAMLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSSVLEWVQD  898

>CCA14618
Length=659

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/222 (24%), Positives = 92/222 (41%), Gaps = 19/222 (9%)

Query  223  DRNRARRSSAVLPVQNMLKDAVGIAEMLVAHDLGYVQGMSYLAATLCFH-MDSFTAFKAL  281
            D N   R  A+  V N +    G          GY QGM+++ A      ++   A+   
Sbjct  149  DYNTKSRQQALFRVLNAIAHTEG----------GYCQGMNFIVAMFFVEGLEEADAYALF  198

Query  282  VALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW----  337
              L+    L  M+    +    Y + ++Q+L   LP +  HF  QG    MY ++W    
Sbjct  199  HYLLRKRHLARMYHPTCSFLDDYFQQFDQLLLRRLPKVHQHFASQGFFIPMYGIEWFTTL  258

Query  338  ---SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTS  394
               S  L+LA  + D+++      F +  +G+L L +D LL M   D +R    F +   
Sbjct  259  FSLSTKLELACAILDMFLAGVRDIFLRMGLGILELLEDKLLCMSFEDFLRDFKPFVRKID  318

Query  395  SCQ-LFEAISSNPLETMAARGKQSVFAAFNKLQVIAVESEGS  435
              Q +F A+S +  + M       +    +K+ ++   + GS
Sbjct  319  PYQAVFRALSIDITDQMECDVIVYLANKHSKMHIVKEANSGS  360

>PYU1_G007203
Length=519

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 92/207 (44%), Gaps = 25/207 (12%)

Query  209  VAEGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVAHDLGYVQGMSYLAATL  268
            + E S +P      D++ A +  ++  V N + +A          + GY QGM+++AA  
Sbjct  101  IFERSHLP------DKDIASQQQSLFRVLNAISEA----------EDGYCQGMNFIAALF  144

Query  269  CFH-MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQG  327
                +D   A+   + L+    L  +++  +T    Y+E +N + + ELP L  H   QG
Sbjct  145  LVEGLDEADAYALFLYLLKKRHLARIYQRSSTFLDDYLEHFNLMFQRELPDLHQHILSQG  204

Query  328  IDAQMYAVDWSLPL-------DLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAG  380
                MY ++W   L       DLA  ++D++ +     F +  + +L L +  L+ M   
Sbjct  205  FVIPMYGIEWFTTLFSLSTKADLACAIFDLFFVGVQDIFLRMGLAILKLLESKLMCMTFE  264

Query  381  DIMRLLHNFPKTTSSCQ-LFEAISSNP  406
            D +R      +     Q +F+A+S  P
Sbjct  265  DFLREFKPLVRQIDPYQAIFQALSFRP  291

>H257_01934
Length=1022

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 100/445 (22%), Positives = 177/445 (40%), Gaps = 60/445 (13%)

Query  919   NIHTVPPPA--ARASVRLTQLAPVADNALSTPLNPQQINEMFPLID---FTSELAAHARG  973
             + HT P     AR S R  QL    +  +      QQ   +F L+    F S+++   +G
Sbjct  401   SFHTTPWTLHDARYSTRREQLIAALNGRVGLDQEGQQ-ARLFSLLSPFSFQSQISTATQG  459

Query  974   LVPGTRTWALTRVEEWL-----DARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLL  1028
                  R W L   +EW+     +AR       V  + G  G+GK+A    + Q  R  ++
Sbjct  460   YC--GRAWVLHEFDEWVTSPPSNAR------RVFLLTGVIGSGKTALAAHIIQN-RPEVV  510

Query  1029  AAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFL-----LA  1083
             A H    + +     R  +L+ V+QL   LP + N L   + K  LEE+  F+     L 
Sbjct  511   AFHLASHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEET-VFVGNLADLV  567

Query  1084  AKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSK  1143
              ++ + PL  +  P     +L++G++     P   + L+  L+  + + P+W+ F+ +S+
Sbjct  568   QELLIAPLERIATPPSTMVILIDGIE---CFPCADDNLVAILTASLNRWPAWMRFVFTSR  624

Query  1144  PFSKFAKRL------PVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRV---L  1194
                +    L      P++  LD +        DV   +D    +  D        V   L
Sbjct  625   EDPRVLSLLQAYMLPPIA--LDLACAQSK--RDVRQYLDTALGSHFDISPPMPPHVIDLL  680

Query  1195  KRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGR  1254
               ++ G F Y      ++S          G   L+ LD++P ++     + F  +F    
Sbjct  681   VDRTQGLFLYARHLVDSIS---------SGQWNLDNLDNVPTTMGGFLHQNFATQFPV-V  730

Query  1255  ARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYR  1314
              +     +P+L+++  A    + P+T         F     + L+  F  L     G   
Sbjct  731   DKYKVDVRPVLEVVCAA----HEPLTLDALSAIMHFDVYQAQKLQSDFGSLFHAGEGGVI  786

Query  1315  LESS-ALCSWLSDPARSEEQFYLSV  1338
             L    +L  WL DP RS   +++ V
Sbjct  787   LPFHLSLLDWLQDP-RSAGDYFVDV  810

>PYIR_14107
Length=1176

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 86/416 (21%), Positives = 167/416 (40%), Gaps = 81/416 (19%)

Query  979   RTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  1038
             R W   ++E W+ +        V  V G  G+GK+A    + Q     + A H    + +
Sbjct  550   REWLFMQLENWIASPTAT---QVFWVTGQIGSGKTALAARMVQVI-PEIAAFHFALQEDE  605

Query  1039  SKSTPRNVLLSFVHQLVDNLPPFKNQL-ARLNLKYVLEESDPFLLAAKVFVDPLNAVEEP  1097
                  R  +LS  +QL   LP +   L +R  L+ ++  S+   L  ++ V+PLN +  P
Sbjct  606   QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  1098  --IHATFMLVEGL--------------------------------DQCSAGPNGRNELLE  1123
                    +L++GL                                D C++ P+G   L+ 
Sbjct  666   QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  1124  FLSQIIPQLPSWVGFMISSKPFSKFAKRL---PVSSVLDFSAKNGAFVSDVSSLVDDI--  1178
              L  ++ +LP+WV  ++ S+       +L     S VLD S K+ +   D+   V+++  
Sbjct  726   ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIVLD-SLKSES-QQDIKRYVENMLG  783

Query  1179  -------------------ARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAM  1219
                                A  FS++ S E   ++ ++S G F Y     Q++       
Sbjct  784   ESPATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI-------  836

Query  1220  ASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPV  1279
               +E  + ++ L+ LP  +   + + F+  F + + +     +P+L+++  +    + P 
Sbjct  837   --EEKRLAVDQLESLPIGMGGYFRQFFDGHFDEQQYQ--DSIRPVLEVLCAS----FEPF  888

Query  1280  TEGQAKEHFGFTTEDLRMLRRSFVDLVEV-KHGAYRLESSALCSWLSDPARSEEQF  1334
             +         +   D + +  SF  L+ +   G  R   S++C W+ DPA + + F
Sbjct  889   SLWNIVSILNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAGKYF  944

>PYIW_17165
Length=356

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/212 (25%), Positives = 88/212 (42%), Gaps = 45/212 (21%)

Query  200  GIPKELRGRVA---------------------EGSEVPLTTDI-NDRNRA---------R  228
            GIP+ LRGRV                      +   VP    I  D  R          R
Sbjct  125  GIPEALRGRVWCHLAGSTQMMLNNPGVYHEFLQAKSVPCEETIARDIGRTFPKHYLFNER  184

Query  229  RSSAVLPVQNMLKDAVGIAEMLVAHDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSS  288
             S     + N+LK     A  L   ++GY QGM +L+A    +M    +F  LVA ++  
Sbjct  185  SSLGQCALMNVLK-----AYSLHDPEVGYCQGMGFLSAMFLSYMPEEQSFWHLVACLNHK  239

Query  289  L--LFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SL  339
               L +++R    +    I V+ ++++  +P +A H + +G+   MY   W       + 
Sbjct  240  RYDLANLYRPRMPKVPELIFVFEKLMDQLMPQVARHLEAEGLHPTMYLTQWFITLFTYNF  299

Query  340  PLDLALRLWDVYVLLGTPFFFQASMGLLTLFQ  371
            P +   R+WD+++  G    F+ S+ L+ + Q
Sbjct  300  PFEFVTRVWDMFLYEGWKVIFRVSLALMKVSQ  331

>PYAP_15111
Length=744

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 69/144 (48%), Gaps = 9/144 (6%)

Query  240  LKDAVGIAEMLVAHDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLL-FDMFRLEA  298
            LK+ +G A  L   ++GY Q M+++A  +   M    AF    ++M    L  + +    
Sbjct  434  LKNVLG-AYSLHNREIGYCQSMNFIAGMMVLFMKEEDAFWLFCSIMERRYLPAENYTQSM  492

Query  299  TRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVY  351
              T     V+  ++E ELPAL+   +  GI  Q+  + W       +LP +LALR+WD +
Sbjct  493  VGTQTDQLVFKTLVERELPALSERLESCGIQIQLITLHWFLCAFVCTLPTELALRVWDWF  552

Query  352  VLLGTPFFFQASMGLLTLFQDSLL  375
             L G    F  ++G+L   +  +L
Sbjct  553  FLDGQEVLFITAIGILKQAEQKIL  576

>PPTG_06525
Length=759

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 84/187 (45%), Gaps = 22/187 (12%)

Query  210  AEGSEVPLTTDINDRNR----ARRSSAVLPVQNMLKDAVGIAEMLVAHDLGYVQGMSYLA  265
            A G +V  T  I +R+     A + SA+  V N + +A          + GY QGM+++A
Sbjct  110  AIGRDVTRTFSIFERSHQHQLAAQQSALFRVLNAIAEA----------EDGYCQGMNFIA  159

Query  266  ATLCFH-MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQ  324
            A      +    A+   + ++    L  ++   +T    Y++ + Q+   +LP L AH  
Sbjct  160  ALFLVEGLSEADAYALFLYILKKRHLAGIYHRSSTFLDEYLQHFEQMFIRDLPKLHAHLL  219

Query  325  EQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEM  377
             QG    MY ++W       S   DLA  ++D++ +     F +A + +L L +  L+ M
Sbjct  220  AQGFAIPMYGIEWFTTLFSLSTKTDLACAIFDLFFVGVQDIFLRAGLAILKLLEAKLMCM  279

Query  378  DAGDIMR  384
               D +R
Sbjct  280  TFEDFLR  286

>PYAR_18942
Length=1201

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 95/194 (49%), Gaps = 22/194 (11%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            LGY QG++Y+ A L   +D   AF  L  ++   L+ D +            V+  ++  
Sbjct  352  LGYCQGLNYIVARLLLFVDEVEAFFLLTKMLR--LVPDDYYTTMLGLAVDQHVFADLVRV  409

Query  315  ELPALAAHFQE---QGIDAQMYAVDWSL-------PLDLALRLWDVYVLLGTPFFFQASM  364
            + P +  H +E    G++  +   +W L       P ++ +R+WD+  LLG    F+  +
Sbjct  410  QAPEIVKHLEELGGSGMELSLACTEWFLTLFSSPCPREVTIRIWDLIFLLGDEILFRVGL  469

Query  365  GLLTLFQDSLLEMDA-GDIMRLLHNFPKTTSSCQ--LFEAISSNPLETMAARGKQSVFAA  421
             LL L + +LL+ ++ GD++R L+   + T   +  + +A  ++    + +R +   F A
Sbjct  470  ALLDLEKPALLKCNSYGDMLRSLNEIGRKTIDAKQLVLDAQKTD----VVSRLRIDDFRA  525

Query  422  FNKLQV---IAVES  432
             ++LQ+   IAV+S
Sbjct  526  HHRLQLATGIAVQS  539

>H257_10638
Length=549

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 93/223 (42%), Gaps = 44/223 (20%)

Query  207  GRVA-EGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVAHD--LGYVQGMSY  263
            GRVA E S   L+  +  RN A   S     Q++     GI   L +    +GY QGM Y
Sbjct  291  GRVAIESSASGLSDGLFSRNNAMDHSD----QDIQSQLTGILLALASRYPLVGYCQGMDY  346

Query  264  LAATLCFHMDSF---------------------------TAFKALVALMSSSLLFDMFRL  296
            +AA L  H+ S                            T+F   VAL+    L  MF  
Sbjct  347  IAAHLLQHVISHSTQATAASALSAVPLSSKAQRLVEEEETSFWLFVALLDQYGLEAMFSP  406

Query  297  EATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLAL---------RL  347
              ++   +   +N+ L+  LP L AHF+ +G+  QMY V W   L L L          +
Sbjct  407  GLSKLHLHCYQFNRFLQLGLPKLHAHFEVEGMSVQMYLVGWFQTLFLYLNALPRHSIDNM  466

Query  348  WDVYVLLGT-PFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
            WD+++   +    F+ ++ LL++ +  LL+       R L+ F
Sbjct  467  WDIFMAEKSWKILFRVALALLSMCEAHLLQQPIDSASRFLNTF  509

>PHYRA_75352
Length=563

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 84/187 (45%), Gaps = 22/187 (12%)

Query  210  AEGSEVPLTTDINDRNR----ARRSSAVLPVQNMLKDAVGIAEMLVAHDLGYVQGMSYLA  265
            A G +V  T  I +R+R    A + SA+  V N + +A          + GY QGM+++A
Sbjct  94   AIGRDVTRTFSIFERSRQHQLAAQQSALFRVLNAIAEA----------EDGYCQGMNFIA  143

Query  266  ATLCFH-MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQ  324
            A      +    A+   + ++    L  ++   +T    Y++ + Q+   +LP L AH  
Sbjct  144  ALFLVEGLAEADAYALFLYMLKKRHLAGIYHRSSTFLDEYLQHFEQMFLRDLPKLHAHLL  203

Query  325  EQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEM  377
             QG    MY ++W       S   DLA  ++D++ +     F +  + +L L +  L+ M
Sbjct  204  AQGFAIPMYGIEWFTTLFSLSTKTDLACAIFDLFFVGVQDIFLRTGLAILKLLEAKLMCM  263

Query  378  DAGDIMR  384
               D +R
Sbjct  264  AFEDFLR  270

>CCA16959
Length=858

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 66/129 (51%), Gaps = 10/129 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL-LFDMFRLEATRTFHYIEVYNQILE  313
            +GY Q M++LAA L   +     F  L  ++   +  F    +  +R      V + ++E
Sbjct  550  VGYCQSMNFLAAMLLQQLAEEETFWVLAVIVEDLIPQFHERNMRGSRVEQL--VLSDLVE  607

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
             +LP L AHFQ+ G++   +A+ W       +LPL++ +R+WDV++  G     + ++ L
Sbjct  608  QKLPNLYAHFQQLGVEFGPFAMKWFLCLFINTLPLEMVMRIWDVFLYEGGHVVLRVALTL  667

Query  367  LTLFQDSLL  375
            L L +  LL
Sbjct  668  LKLSEHQLL  676

>SPRG_04496
Length=780

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 74/152 (49%), Gaps = 21/152 (14%)

Query  255  LGYVQGMSYLAATLCFHMD--SFTAFKALVALMSSSL--LFDMFR----LEATRTFHYIE  306
            +GY QGM++LAA +  +++     AF  L A+  S    + DM++    L   R F    
Sbjct  553  VGYCQGMNFLAAFMLANVEWNEAQAFWLLAAMAVSPTYEIMDMYKPGVPLLNLRFFQL--  610

Query  307  VYNQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDVYVLLGTP  357
              + +++  LPA+ AHF+ Q     M A  W         +LP D  +R+ D +V+ G  
Sbjct  611  --HMLVKQWLPAVHAHFEAQDFHVSMCASGWFMTLFTNFDTLPPDAVVRVMDGFVVYGWK  668

Query  358  FFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
              F+ ++ LLT  + ++L  D   I+ L +N 
Sbjct  669  MIFRVALALLTYLESAILAADLEAIVDLFYNL  700

>PYU1_G008908
Length=516

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 65/131 (50%), Gaps = 12/131 (9%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEA---TRTFHYIEVYNQI  311
            +GY Q M+++A  +   MD   AF  L  ++  + L      ++   T+T     V+  +
Sbjct  375  IGYCQSMNFIAGMMLLFMDEEDAFWLLCVVLHKNYLPAANYTQSMVGTQTDQL--VFKWL  432

Query  312  LEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASM  364
            ++ ELP +AA  +  GI   +  + W       +LP + ALR+WD + L G    F  ++
Sbjct  433  IDQELPEVAARLEACGIQIPLVTLHWFLCAFVCTLPTESALRVWDWFFLDGEEVLFTVAV  492

Query  365  GLLTLFQDSLL  375
            G+L L +D +L
Sbjct  493  GILKLAEDEIL  503

>PYIR_22150
Length=799

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 65/137 (47%), Gaps = 8/137 (6%)

Query  256  GYVQGMSYLAATLCFH-MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            GY QGM+++AA      ++   A+   + L+    L  +++  +T    Y+E +N + + 
Sbjct  242  GYCQGMNFIAALFLVEGLEEADAYALFLYLLKKRHLARIYQRSSTFLDDYLEHFNLMFQR  301

Query  315  ELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLL  367
            ELP L  H   QG    MY ++W       S   DLA  ++D++ +     F +  + +L
Sbjct  302  ELPDLHQHLLAQGFVIPMYGIEWFTTLFSLSTKTDLACAIFDLFFVGVQDIFLRMGLAIL  361

Query  368  TLFQDSLLEMDAGDIMR  384
             L +  L+ M   D ++
Sbjct  362  KLLESKLMCMTFEDFLK  378

>PITG_08141
Length=587

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 81/186 (44%), Gaps = 34/186 (18%)

Query  255  LGYVQGMSYLAATLCFHM-----------DSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            +GY QGM Y+AA +   +           ++ + F  LV L     L DMF        H
Sbjct  383  VGYCQGMDYIAAHVLNKVKKSGSAADTKAEAESTFWLLVTLFERYELHDMF----APGLH  438

Query  304  YIEVY----NQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDV  350
             + V+     ++LE   PALA HF  + +  +M+AV W          LP D   R+WDV
Sbjct  439  TLHVHCFQTQRLLELTEPALAGHFASEKVPIEMFAVGWFQTLYLYLNVLPQDSLDRIWDV  498

Query  351  YVLLGT-PFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPLET  409
            ++         + ++ LL L ++ ++E    +IM+  + F          E ++ +PL  
Sbjct  499  FLFEKNWKIMLRMALALLQLSKEHVMEKPIDEIMQFFNTFADNAD-----EILAESPLTE  553

Query  410  MAARGK  415
             A R K
Sbjct  554  RALRLK  559

>SPRG_16563
Length=745

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 74/152 (49%), Gaps = 21/152 (14%)

Query  255  LGYVQGMSYLAATLCFHMD--SFTAFKALVALMSSSL--LFDMFR----LEATRTFHYIE  306
            +GY QGM++LAA +  +++     AF  L A+  S    + DM++    L   R F    
Sbjct  518  VGYCQGMNFLAAFMLANVEWNEAQAFWLLAAMAVSPTYEIMDMYKPGVPLLNLRFFQL--  575

Query  307  VYNQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDVYVLLGTP  357
              + +++  LPA+ AHF+ Q     M A  W         +LP D  +R+ D +V+ G  
Sbjct  576  --HMLVKQWLPAVHAHFEAQDFHVSMCASGWFMTLFTNFDTLPPDAVVRVMDGFVVYGWK  633

Query  358  FFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
              F+ ++ LLT  + ++L  D   I+ L +N 
Sbjct  634  MIFRVALALLTYLESAILAADLEAIVDLFYNL  665

>PYAR_14788
Length=795

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 82/378 (22%), Positives = 140/378 (37%), Gaps = 62/378 (16%)

Query  992   ARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFV  1051
             A  N     V  V G  G GK++    + Q     + A H    +       R  +LS  
Sbjct  409   ASINELRSKVFWVTGQIGAGKTSVAAKMVQTIP-EIAAFHFALQEDDQTQLARRCVLSLA  467

Query  1052  HQLVDNLPPFKNQLARLNLKYVLEESDPFL----LAAKVFVDPLNAVEEPI--HATFMLV  1105
             +QL   LP +      L     LEE  P      L A + + PLNA+  P       +L+
Sbjct  468   YQLTTQLPAYA---VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLI  524

Query  1106  EGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRL-PVSSVLDFSAKN  1164
             +GL+  ++   G    +  L  +I +LPSWV  ++ S+       +L   S  +    + 
Sbjct  525   DGLEHLASNTGGAGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRRE  584

Query  1165  GAFVSDVSSLVD------------------------DIARNFSD-----------EDSAE  1189
                  D+   V+                         I  +F++           + S+E
Sbjct  585   QENEEDIRGFVEAALCSPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSE  644

Query  1190  AKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDK  1249
                ++ ++S G F Y     Q++         +EG + ++ L  LP  L     + FE  
Sbjct  645   QVELITKRSEGLFLYAVNIVQSI---------EEGRLSVDQLASLPLGLGGYLRQFFESH  695

Query  1250  FGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVK  1309
             F     +   K +P+L+++  A    Y P+T       F ++T D   +  SF  L  + 
Sbjct  696   FDDTTYK--TKIRPVLEVLCAA----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCIS  749

Query  1310  HGAY-RLESSALCSWLSD  1326
                Y R   S++  W+ D
Sbjct  750   DDGYMRPFHSSVLEWVQD  767

>PYIW_14777
Length=813

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 65/137 (47%), Gaps = 8/137 (6%)

Query  256  GYVQGMSYLAATLCFH-MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            GY QGM+++AA      ++   A+   + L+    L  +++  +T    Y+E +N + + 
Sbjct  254  GYCQGMNFIAALFLVEGLEEADAYALFLYLLKKRHLARIYQRSSTFLDDYLEHFNLMFQR  313

Query  315  ELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLL  367
            ELP L  H   QG    MY ++W       S   DLA  ++D++ +     F +  + +L
Sbjct  314  ELPDLHRHMLAQGFVIPMYGIEWFTTLFSLSTKTDLACAIFDLFFVGVQDIFLRIGLAIL  373

Query  368  TLFQDSLLEMDAGDIMR  384
             L +  L+ M   D ++
Sbjct  374  KLLESKLMCMTFEDFLK  390

>SDRG_05349
Length=534

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 71/167 (43%), Gaps = 31/167 (19%)

Query  254  DLGYVQGMSYLAATLCFHMDSF---------------------TAFKALVALMSSSLLFD  292
            D+GY QGM Y+ A +  H+ +                        F  LVAL  S  L  
Sbjct  316  DVGYCQGMDYITAHILEHVKAADRKFGEASPQKRAAATQVQVEATFWILVALFESYGLRQ  375

Query  293  MFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDL  343
            MF    TR   +   +  + +  LPAL  HF+ + +  +MY V W         +LP + 
Sbjct  376  MFSPGLTRLHLHCYQFRCLFQAALPALYDHFEAEHVMVEMYIVGWFQTLFLYLNALPKET  435

Query  344  ALRLWDVYVL-LGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
               +WD+++        F+A++G+L L +  L+     ++M  L+ F
Sbjct  436  LDAIWDIFLFERSWKIMFRAALGMLKLAEPHLMGKSIDEMMVFLNTF  482

>PYVX_14776
Length=1143

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 73/160 (46%), Gaps = 13/160 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            LGY QG++Y+ A     +D   AF  L+ ++   L+ D +            V+  ++  
Sbjct  326  LGYCQGLNYIVARSLLFLDEEEAFYLLIKMIR--LVPDDYYTSMLGLAVDQHVFADLVRI  383

Query  315  ELPALAAHFQE---QGIDAQMYAVDWSLPL-------DLALRLWDVYVLLGTPFFFQASM  364
            +LP +A H       G+D  +   +W L L       ++ +++WD   L G    F+ ++
Sbjct  384  QLPTVADHLTNLGGTGMDLSLACTEWFLTLFSSPCEREVTIQIWDSIFLFGDELLFRVAL  443

Query  365  GLLTLFQDSLLEMDA-GDIMRLLHNFPKTTSSCQLFEAIS  403
             LL L +D+LL+    GDI++ L+      S     E ++
Sbjct  444  ALLQLAKDALLKSTVYGDILKYLNAVSACVSDVLPIEVVT  483

>SDRG_07983
Length=991

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 93/223 (42%), Gaps = 23/223 (10%)

Query  928   ARASVRLTQLAPVADNALSTPLNPQQINEMFPLID---FTSELAAHARGLVPGTRTWALT  984
             AR   R  QL    D  +    + QQ   +F L+    F S+++   +  V   R W L 
Sbjct  391   ARYKTRYHQLLSALDGQIGLDHDGQQ-ARLFSLLSPFSFQSQISKLTQLFV--AREWVLA  447

Query  985   RVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPR  1044
             + + W+          +  + G  G+GKSA    + Q  R  + A H    +     + R
Sbjct  448   KYDAWVQ---TPNGSRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEEDQTQSAR  503

Query  1045  NVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFL----LAAKVFVDPLNAVEEPIHA  1100
               +LS V+QL   LP + N    +N +  LEE  P      L   + + PL+A+  P   
Sbjct  504   RCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVKSLVDLIHALLIAPLSAIAHPASI  560

Query  1101  TFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSK  1143
               +L++G+D    G       +  L+  +   PSWV F+  ++
Sbjct  561   LVLLIDGIDCFEPG------FVATLTAHMDLWPSWVRFVFGTR  597

>PYIR_19786
Length=1282

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 91/203 (45%), Gaps = 35/203 (17%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYI-------EV  307
            LGY QG++Y+ A +   +D   AF          LL  M RL     +  +        V
Sbjct  344  LGYCQGLNYIVARMLQFLDEEEAFY---------LLIKMLRLVPEDYYTTMLGLAVDQHV  394

Query  308  YNQILEHELPALAAHFQE---QGIDAQMYAVDWSLPL-------DLALRLWDVYVLLGTP  357
            +  ++  ++P +  H  E    G++  +   +W L L       ++ +R+WD   LLG  
Sbjct  395  FTDLVRLQMPDITEHLTELGGSGVELSLACTEWFLTLFASPCDREVTVRIWDSIFLLGDE  454

Query  358  FFFQASMGLLTLFQDSLLEMDA-GDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQ  416
              F+ ++ L+ L ++SLL  +  GD+++ L+   +  +    F+ +  +  +    R + 
Sbjct  455  ILFRVALALMQLEKNSLLGCEHYGDMLKHLNEIGRGKTDA--FDLMKLSREQDCVYRARI  512

Query  417  SVFAAFNKLQVI------AVESE  433
              F A ++LQ+       AVESE
Sbjct  513  EDFRAHHRLQLASGIVASAVESE  535

>SDRG_11933
Length=772

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 73/152 (48%), Gaps = 21/152 (14%)

Query  255  LGYVQGMSYLAATLCFHMD--SFTAFKALVALMSSSL--LFDMFR----LEATRTFHYIE  306
            +GY QGM++LAA +  +++     AF  L A+  S    + DM++    L   R F    
Sbjct  545  VGYCQGMNFLAAFMLANVEWNEAQAFWLLTAMAVSPTYEIMDMYKPGVPLLNLRFFQL--  602

Query  307  VYNQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDVYVLLGTP  357
              + +++  LPA+ AHF+ Q     M A  W         +LP D  +R  D +V+ G  
Sbjct  603  --HMLVKQWLPAVHAHFEAQDFHVSMCASGWFMTLFTNFDTLPPDAVVRTMDGFVVYGWK  660

Query  358  FFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
              F+ ++ LLT  + ++L  D   I+ L +N 
Sbjct  661  MIFRVALALLTYLEPAILAADFEAIVDLFYNL  692

>PPTG_14278
Length=584

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 72/160 (45%), Gaps = 29/160 (18%)

Query  255  LGYVQGMSYLAATLCFHM-----------DSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            +GY QGM Y+AA +   +           ++ + F  LV L     L DMF        H
Sbjct  380  VGYCQGMDYIAAHVLNKVKKSGSAADTKAEAESTFWLLVTLFERYELHDMF----APGLH  435

Query  304  YIEVY----NQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDV  350
             + V+     ++LE   PALA HF  + +  +M+AV W          LP D   R+WDV
Sbjct  436  KLHVHCFQTQRLLELTEPALAEHFASEKVPIEMFAVGWFQTLYLYLNVLPQDTLNRIWDV  495

Query  351  YVLLGT-PFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
            ++         + ++ LL L ++ ++E    +IM+  + F
Sbjct  496  FLFEKNWKIMLRVALTLLQLSEEYVMEKPIDEIMQFFNTF  535

>PYIW_14104
Length=1257

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 90/200 (45%), Gaps = 25/200 (13%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMS---SSLLFDMFRLEATRTFHYIEVYNQI  311
            LGY QG++Y+ A +  ++D   AF  L+ L+          M  L   +      V+  +
Sbjct  333  LGYCQGLNYIVARMLQYLDEEEAFYLLIKLLRLVPEDYYTTMLGLAVDQ-----HVFTDL  387

Query  312  LEHELPALAAHFQE---QGIDAQMYAVDWSLPL-------DLALRLWDVYVLLGTPFFFQ  361
            +  ++P +  H  E    G++  +   +W L L       D+ +R+WD   LLG    F+
Sbjct  388  VRLQMPDITDHLTELGGSGVELSLACTEWFLTLFASPCDKDVTVRIWDSIFLLGDEILFR  447

Query  362  ASMGLLTLFQDSLLEMDA-GDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQSVFA  420
             ++ L+ L + SLL  +  GD+++ L+   +  +    F  +  +  +    R +   F 
Sbjct  448  VALALMQLEKSSLLACEHYGDMLKNLNEIGRGKTDA--FGLMKLSREQDCIYRARIEDFR  505

Query  421  AFNKLQ----VIAVESEGSD  436
            A ++LQ    ++A  +E  D
Sbjct  506  AHHRLQLASGIMASAAESED  525

>CCI42036
Length=777

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 63/137 (46%), Gaps = 8/137 (6%)

Query  256  GYVQGMSYLAATLCFH-MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            GY QGM+++ A      ++   A+     L+    L  M+    +    Y + ++++L  
Sbjct  178  GYCQGMNFIVAMFFVEGLEEADAYALFHYLLRKRHLARMYHPTCSFLDDYFQQFDRLLMR  237

Query  315  ELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLL  367
             LP +  H   QG    MY ++W       S  L+LA  + D+++      F +  +G+L
Sbjct  238  RLPKIHQHLVSQGFSIPMYGIEWFTTLFSLSTKLELACAILDMFLAGVRDIFLRMGLGIL  297

Query  368  TLFQDSLLEMDAGDIMR  384
             L +D LL M+  D +R
Sbjct  298  ELLEDKLLCMNFEDFLR  314

>PYVX_15147
Length=539

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 59/130 (45%), Gaps = 9/130 (7%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIE--VYNQIL  312
            +GY Q M+++   L   MD+  AF  L  ++  S         A+     I+  V+  ++
Sbjct  321  IGYCQSMNFIVGMLLLFMDAEDAFWLLCTMLHGSYYLPADNYSASMAGIQIDQLVFRALV  380

Query  313  EHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMG  365
              ELP +    ++ GI  ++  V W       +LP   ALR+WD   L G    F  ++G
Sbjct  381  RKELPLIFPRLEQLGIQIELMTVHWFLCAFIGTLPTSTALRVWDWLFLRGQVVLFVVAVG  440

Query  366  LLTLFQDSLL  375
            +L L Q  +L
Sbjct  441  ILRLAQPRIL  450

>SDRG_14365
Length=552

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 66/141 (47%), Gaps = 11/141 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLL-FDMFRLEATRTFHYIEVYNQILE  313
            +GY Q M++LAA L  +M    AF  L  ++   +  +    +  +R   +  V++ ++ 
Sbjct  291  VGYCQSMNFLAAVLLVYMGEEEAFWVLACVIEDLVPEYHTTSMVGSRVDQH--VFHALVA  348

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
            H+LP +AAH     +        W       SLPL+  LR+WDV+   G     +  + L
Sbjct  349  HKLPEVAAHLNTLHVHLAPLTFKWFLCLFVNSLPLETTLRVWDVFFAEGAKVIHRIGLTL  408

Query  367  LTLFQDSLLEMD-AGDIMRLL  386
            L L  D++L  D A D+   L
Sbjct  409  LKLHADAILACDEAFDVYETL  429

>PYIW_23821
Length=666

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 68/147 (46%), Gaps = 9/147 (6%)

Query  237  QNMLKDAVGIAEMLVAHDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRL  296
            +N LK+ +  A  L    +GY Q M+++A  L   M    AF  L  ++    L      
Sbjct  378  KNELKNVL-CAYSLHNPSVGYCQSMNFIAGMLLLFMSEEDAFWLLCVMLHKKYLPAANYT  436

Query  297  EATRTFHYIE-VYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLW  348
            ++       + V+  +++ ELP LA   +  GI  Q+  + W       +LP + ALR+W
Sbjct  437  QSMAGTQADQLVFKWLVDRELPKLAGRLEFCGIQIQLVTLHWFLCAFVCTLPTESALRVW  496

Query  349  DVYVLLGTPFFFQASMGLLTLFQDSLL  375
            D + L G    F  ++G+L L +  +L
Sbjct  497  DWFFLDGEQVLFTVAIGILKLAESKIL  523

>H310_10917
Length=549

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 78/171 (46%), Gaps = 40/171 (23%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKA----------LVALMSSS------LLFDMFRLEA  298
            +GY QGM Y+AA +  H+ ++ A  A          ++AL  ++       LFD + LEA
Sbjct  343  VGYCQGMDYIAAHVLEHVIAYYAQTAKGRGALSKAQILALEEAASFWLLVALFDNYGLEA  402

Query  299  T----------RTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLALR--  346
                       R F +    N++LE  LP L AHF  + I  +MY V W   L L L   
Sbjct  403  MFSPGLQQLHLRCFQF----NRVLEQGLPRLHAHFDRECISTEMYLVGWFQTLFLYLNAL  458

Query  347  -------LWDVYVLLGT-PFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
                   +WD+++   +    F++++ +L+L +  L++       R L+ F
Sbjct  459  PKPTTDAIWDIFLFEKSWKILFRSALAMLSLCETHLVDQPIDIASRFLNTF  509

>SPRG_19030
Length=1000

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 93/223 (42%), Gaps = 23/223 (10%)

Query  928   ARASVRLTQLAPVADNALSTPLNPQQINEMFPLID---FTSELAAHARGLVPGTRTWALT  984
             AR   R  QL    +  +    + QQ   +F L+    F S+++   +  V   R W L 
Sbjct  399   ARYKTRYNQLLAALNGQIGLDHDGQQ-ARLFSLLSPFSFQSQISKLTQLFV--AREWVLA  455

Query  985   RVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPR  1044
             + + W+          +  V G  G+GKSA    + Q  R  + A H    +     + R
Sbjct  456   KYDAWVQ---TPNGSRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEEDQTQSAR  511

Query  1045  NVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFL----LAAKVFVDPLNAVEEPIHA  1100
               +LS V+QL   LP + N    LN +  LEE  P      L   + + PL+A+  P   
Sbjct  512   RCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLSAIAHPASI  568

Query  1101  TFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSK  1143
               +L++G++    G       +  L+  +   PSWV F+  ++
Sbjct  569   LVLLIDGIECFEPG------FVATLTAHMDLWPSWVRFVFGTR  605

>H257_16768
Length=137

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 54/109 (50%), Gaps = 9/109 (8%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTY--STKSGRKPRLLLSL---GDVQV  63
            ++ +G L K+ +G    H   W+ RYF LT NEL Y   T    K  L LS    G +++
Sbjct  11   MIKEGSLFKKGAGGGLLHRSNWKRRYFKLTDNELLYFDPTDGHLKGALNLSACGHGSLEI  70

Query  64   ----IDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALL  108
                          G + F L+TPSRRL L+A TE +  +W+  L+ +L
Sbjct  71   QPEDCTKTGTSASSGVWRFALRTPSRRLVLAAKTEDDMTAWIQALQVVL  119

>PYIR_21788
Length=631

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 74/179 (41%), Gaps = 26/179 (15%)

Query  252  AHDLGYVQGMSYLAATLCFHMDSF------------------TAFKALVALMSSSLLFDM  293
            A D+ Y QGM+Y+AATL   ++                    TAF  L AL+ +  + D+
Sbjct  152  AKDVAYCQGMNYVAATLLLMLNENSLESQEEESAACDGSPEETAFWILYALIHNLGMADV  211

Query  294  FRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALR  346
            +R +       I +YNQ+L+     L  H ++ G+     A  W        LP     R
Sbjct  212  WRSKMPGLSRCIYLYNQLLQVHFNDLYVHLRQIGMHPSFLATQWFVTLFARVLPAQSVHR  271

Query  347  LWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKT-TSSCQLFEAISS  404
            +WD++ L G    F+ ++ +    +  +L MD           PK    S  + E ISS
Sbjct  272  VWDLFFLDGWKMVFRVALAITAHIRPFILHMDMEQCSDFFRQNPKLRLDSITVDELISS  330

>PYAR_18160
Length=631

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 64/138 (46%), Gaps = 13/138 (9%)

Query  240  LKDAVGIAEMLVAHDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEA-  298
            LK  +G   +   H +GY Q M+++A  L   M+   AF    AL+    L      +A 
Sbjct  311  LKHVLGAYSLHNPH-IGYCQSMNFIAGMLLLFMNEEDAFWIFCALLEKRYLPAENYTQAM  369

Query  299  --TRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWD  349
              T+T     V+ +++  ELP LA      GI  Q+  + W       +LP + ALR+WD
Sbjct  370  VGTQTDQL--VFKELVSQELPVLAERLDLCGIQIQLVTLHWFLCAFVCTLPTESALRVWD  427

Query  350  VYVLLGTPFFFQASMGLL  367
             + L G    F  ++G+L
Sbjct  428  WFCLDGQEVLFITAIGIL  445

>PYAP_17517
Length=1024

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 69/157 (44%), Gaps = 23/157 (15%)

Query  257  YVQGMSYLAATLCFHM---DSFTAFKALVALMSSSLLFDMFRLEATRTFHY-IEVYNQIL  312
            Y  GM  + A L  ++   D+F AF+ L+      +L   +  E+   F     V  ++L
Sbjct  156  YCHGMVEICAVLSTYLSEEDAFWAFRLLL-----EVLLPKYHEESIVDFQIDCLVLQELL  210

Query  313  EHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVL------LGTPFF  359
            E + PALA H    G+  Q+    W       SLP DL  RL+D+ ++      L +   
Sbjct  211  EQQDPALADHLAHTGVTIQVLCTKWFFSFFAESLPFDLVCRLYDILLVDICCRRLSSKII  270

Query  360  FQASMGLLTLFQDSLLEM-DAGDIMRLLHNFPKTTSS  395
            F  +  +     + LLEM D   I+ L+  F  TT S
Sbjct  271  FSTAAAVFLYLSEMLLEMNDPSVIVELICEFCLTTLS  307

 Score = 45.8 bits (107),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 66/150 (44%), Gaps = 17/150 (11%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHY-IEVYNQILE  313
            +GY QGM+ + A L  ++D  T+   L  L+ + L    + +++    H    V N +L 
Sbjct  606  VGYCQGMNEILAVLLQYLDERTSLLGLSLLIETVL--PAYHVDSMIGLHTDCAVMNTLLR  663

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLL------GTPFFF  360
               P L  H Q  G++ ++    W       SLP    L++ D+ +        G+    
Sbjct  664  QNDPELHTHIQNTGLNMEILCTKWLVTCFLTSLPPFCGLKVMDMLLARVTEKQSGSRVLL  723

Query  361  QASMGLLTLFQDSLLEM-DAGDIMRLLHNF  389
               M +    ++SLL   DAG+++  ++ +
Sbjct  724  GVGMAIFFTLRESLLNAKDAGEVLMAINEY  753

>HYAP_04777
Length=502

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 74/160 (46%), Gaps = 29/160 (18%)

Query  255  LGYVQGMSYLAATL--------CFH---MDSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            +GY QGM Y+AA +        C H    ++ + F  LV L     L DMF    +   H
Sbjct  301  VGYCQGMDYIAAHVLDQVKRSGCVHDMKGEAESTFWLLVILFEQYGLHDMF----SPGLH  356

Query  304  YIEVY----NQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDV  350
             + V+     ++LE   PA+AAHF ++ +  +M+ V W          LP +   R+WDV
Sbjct  357  TLHVHCFQTQRLLELSNPAVAAHFAKEKVPIEMFIVGWFQTLYLYFNVLPGESLDRIWDV  416

Query  351  YVL-LGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
            ++         + ++ LL L  + ++E    +IM+  + F
Sbjct  417  FLFEKNWKIMLRVALALLQLSDEYVMEKPIDEIMQFFNTF  456

>CCI47502
Length=641

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 73/174 (42%), Gaps = 38/174 (22%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSS-------------------LLFDMF  294
            D+GY QGM Y+A  +  +    T+  +   + SS                    LL  +F
Sbjct  412  DVGYCQGMDYIAVHILDYTKKHTSVDSDDTVDSSKVSSSCRTAATSEEVERAFWLLVCLF  471

Query  295  RLEATRTFHYIEVYN---------QILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLAL  345
                 R      + N         +I+E  +P+LA HF++  +  +MY V WS  L L L
Sbjct  472  EQYGLRQLFLPGLQNLQSQCFQLKRIIELTMPSLAEHFEKNKVITEMYMVGWSQTLFLYL  531

Query  346  ---------RLWDVYVLLGTP-FFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
                     R+WD++V    P    +AS+ LL + +  + + +  +IM+ L  F
Sbjct  532  TVLPRQSLDRIWDIFVWEKNPKIILRASLALLQIAEPYIRDQETDEIMQFLSGF  585

>SPRG_08792
Length=263

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (51%), Gaps = 9/114 (8%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLG-------DV  61
            ++  G L+++  GP    L+ W + +F+LT N L Y +++G K R  + L        +V
Sbjct  89   VIYSGVLYRRRRGPMQHWLERWTLSHFVLTWNCLRYYSQNGEKLRGEIDLSHCSEHSIEV  148

Query  62   QVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPS  115
              +D     R    + F ++T +RRL +SA TE E   WV  L  LLA G + S
Sbjct  149  LPVDSVFNGRQATLWRFAVRTRTRRLIMSAMTEFEMNVWVKHL--LLAMGLDAS  200

>SPRG_21394
Length=526

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 65/129 (50%), Gaps = 7/129 (5%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            ++GY Q M+++   L   +    AF  L  L+   L ++ +            V+ ++++
Sbjct  296  EIGYCQSMNFIVGILVLFLPEEDAFWLLAVLLDKFLPWENYSRSMVGAQVDQIVFKRLVK  355

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
             + PAL+A  +  GID ++ ++ W       +LPL+ ALR+WD+ +  G    F A++ +
Sbjct  356  LQAPALSAMLETHGIDIELVSLQWFLCVFLCTLPLETALRVWDLLLFYGQEVVFDAALCV  415

Query  367  LTLFQDSLL  375
            L L +  ++
Sbjct  416  LQLGEQDIM  424

>SDRG_13716
Length=263

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (51%), Gaps = 9/114 (8%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLG-------DV  61
            ++  G L+++  GP    L+ W + +F+LT N L Y +++G K R  + L        +V
Sbjct  89   VIYSGVLYRRRRGPMQHWLERWTLSHFVLTWNCLRYYSQNGEKLRGEIDLSHCNEHSIEV  148

Query  62   QVIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPS  115
              +D     R    + F ++T +RRL +SA TE E   WV  L  LLA G + S
Sbjct  149  LPVDSVFNGRQATLWRFAVRTRTRRLIMSAMTEFEMNVWVKHL--LLAMGLDAS  200

>PHALS_12045
Length=621

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 92/209 (44%), Gaps = 32/209 (15%)

Query  210  AEGSEVPLTTDI-----NDRNRARRSSAVLPVQNMLKDAVGIAEMLVAHDLGYVQGMSYL  264
            A G E  +  DI     NDR  +        + N+LK     A  L A D+GY QGM+Y+
Sbjct  108  ATGVEGEIDRDIERTFPNDRFFSDDGDGKRLLGNVLK-----AVALYADDVGYCQGMNYV  162

Query  265  AA-----------TLCFHMDSFT----AFKALVALMSSSLLFDMFRLEATRTFHYIEVYN  309
             A           T+  ++D+F+    AF   +AL+    + ++++ +       I ++ 
Sbjct  163  VASLLLVMKDAENTMALNLDNFSMQEVAFWLTLALIRRKGMDELWKHKMPGLSRCIFLFQ  222

Query  310  QILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQA  362
            Q+L+     L+AHF++ G+ + +    W        L     +R+WD+  + G    ++ 
Sbjct  223  QLLKQHFYDLSAHFRQIGMHSSIMVTQWFVTVFARVLDTQTLVRVWDLVFMDGWKAVYRV  282

Query  363  SMGLLTLFQDSLLEMDAGDIMRLLHNFPK  391
            ++ L+   + +LL MD       L   PK
Sbjct  283  ALALIARLRPTLLAMDLEQCSEFLRWNPK  311

>SDRG_12702
Length=510

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 63/129 (49%), Gaps = 7/129 (5%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            ++GY Q M+++   L   +    AF  L  L+   L ++ +            V+ +++ 
Sbjct  280  EIGYCQSMNFIVGILVLFLPEEDAFWLLAVLLEKFLPWENYSRSMVGAQVDQIVFKRLVT  339

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
             + PAL+A  +  GID ++ ++ W       +LPL+ ALR+WD+    G    F A++ +
Sbjct  340  LQAPALSAMLETHGIDIELVSLQWFLCVFLCTLPLETALRVWDLLFFYGQEVVFDAALCI  399

Query  367  LTLFQDSLL  375
            L L +  ++
Sbjct  400  LQLGEQDIM  408

>PYU1_G004478
Length=1198

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/199 (23%), Positives = 88/199 (44%), Gaps = 27/199 (14%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVA---LMSSSLLFDMFRLEATRTFHYIEVYNQI  311
            LGY QG++Y+ A +   +D   AF  L+    L+       M  L   +      V+  +
Sbjct  325  LGYCQGLNYIVARILLFLDEEEAFYLLIKMIRLVPEDYYTSMLGLAVDQ-----HVFTDL  379

Query  312  LEHELPALAAHFQE---QGIDAQMYAVDWSLPL-------DLALRLWDVYVLLGTPFFFQ  361
            +  + P +  H  +    G++  +   +W L L       ++ +R+WD   LLG    F+
Sbjct  380  VRIQTPDITEHLTDLGGSGVELSLACTEWFLTLFASPCDKEVTVRIWDSIFLLGDEMLFR  439

Query  362  ASMGLLTLFQDSLLEM-DAGDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQSVFA  420
             ++ L+ L + +L+   + GD+++ L+   +  +       +S +  +    R +   F 
Sbjct  440  VALALMQLEKSTLINCKNYGDMLKHLNEIGRENTDASDLLRLSRD--QDCVYRARIEDFR  497

Query  421  AFNKLQVI------AVESE  433
            A ++LQ+       AVESE
Sbjct  498  AHHRLQLASGIVASAVESE  516

>SPRG_15586
Length=163

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 59/136 (43%), Gaps = 8/136 (6%)

Query  13   GYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQV------IDD  66
            G LHK+ SG      + W+ RYF LT   L+Y   + R+ +  +SL  + V       +D
Sbjct  12   GVLHKKGSGAGLFGRRNWKPRYFELTATHLSYYDFASRQLKGAVSLDAIGVDAIECMPED  71

Query  67   QNQVRHPGNFVFVL--QTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPTVFGR  124
              +    G+ ++ +   TP+RRL LSA  E E   W+  L  ++A           V G 
Sbjct  72   AIKTGSSGSTIYRIGVTTPTRRLLLSAANENEMYDWIDALVEVVAANAKTKALAKVVLGS  131

Query  125  KLSDSVKTSTVGTTLH  140
             +  S + S      H
Sbjct  132  DVKASTEHSLASKAAH  147

>PHALS_00940
Length=756

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/183 (25%), Positives = 80/183 (44%), Gaps = 14/183 (8%)

Query  210  AEGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIAEMLVAHDLGYVQGMSYLAATLC  269
            A G +V  T  I +R+   + +A       + +A+  AE +      Y QGM+++AA   
Sbjct  110  AIGRDVTRTFSIFERSHQHQLAAHQNALFRVLNAIAKAENV------YCQGMNFIAALFL  163

Query  270  FH-MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGI  328
               +    A+   + ++    L  ++   +T    Y++ + Q+    LP L AH   QG 
Sbjct  164  VEGLSEADAYALFLYILKKRHLAGIYHRSSTFLDKYLQHFEQMFIQNLPELYAHLLAQGF  223

Query  329  DAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGD  381
               MY V+W       S   DLA  ++D++       F +A + +L L +  L+ M   D
Sbjct  224  VVSMYGVEWFTTLFSLSTKTDLACAIFDLFFAGLHDIFLRAGLAILKLLEAKLMCMTFED  283

Query  382  IMR  384
             +R
Sbjct  284  YLR  286

>PHYSO_529368
Length=583

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 72/160 (45%), Gaps = 29/160 (18%)

Query  255  LGYVQGMSYLAATLCFHM-----------DSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            +GY QGM Y+AA + + +           ++ + F  LV L     L DMF        H
Sbjct  379  VGYCQGMDYIAAHVLYKVKKSGSAADTKAEAESTFWLLVTLFERYGLHDMF----APGLH  434

Query  304  YIEVY----NQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDV  350
             + V+     ++LE   PALA HF  + +  +M+AV W          LP +   R+WD+
Sbjct  435  TLHVHCFQTQRLLELTEPALAEHFASEKMPIEMFAVGWFQTLYLYLNVLPAEALDRIWDI  494

Query  351  YVL-LGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
            ++         + ++ LL L  + +++    +IM+  + F
Sbjct  495  FLFERNWKIMLRVAVALLQLSNEFVMDKPIDEIMQFFNTF  534

>SPRG_12224
Length=163

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 8/105 (8%)

Query  13   GYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQV------IDD  66
            G LHK+ SG      + W+ RYF LT   L+Y   + R+ + ++SL  + V       +D
Sbjct  12   GVLHKKGSGAGLFGRRNWKPRYFELTATHLSYYDFASRQLKGVVSLDAIGVDAIECMPED  71

Query  67   QNQVRHPGNFVFVL--QTPSRRLFLSATTEQERRSWVSELRALLA  109
              +    G+ ++ +   TP+RRL LSA  E E   W+  L  ++A
Sbjct  72   AIKTGSSGSTIYRIGVTTPTRRLLLSAANENEMYDWIDALVEVVA  116

>HYAP_05086
Length=741

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 62/137 (45%), Gaps = 8/137 (6%)

Query  256  GYVQGMSYLAATLCFH-MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            GY QGM+++AA      +    A+   + ++    L  ++   +     Y   + ++   
Sbjct  149  GYCQGMNFIAALFLVEGLSEADAYALFLYMLKKRHLAGIYHNSSMFLDTYFHHFEKMFIR  208

Query  315  ELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLL  367
            +LP L AH  +QG    MY ++W       S   DLA  ++D++ +     F +A + +L
Sbjct  209  DLPILHAHLMKQGFVVAMYGIEWFTTLFSLSTKTDLACAIFDLFFVGVQDIFLRAGLAIL  268

Query  368  TLFQDSLLEMDAGDIMR  384
             L +  L+ M   D +R
Sbjct  269  KLLEAKLMCMTFEDFLR  285

>PHYCA_574174
Length=425

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 71/160 (44%), Gaps = 29/160 (18%)

Query  255  LGYVQGMSYLAATLCFHM-----------DSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            +GY QGM Y+AA +   +           ++ + F  LV L  +  L DMF        H
Sbjct  221  VGYCQGMDYIAAHVLNKVKKSGSAHDTKAEAESTFWLLVTLFENYGLHDMF----APGLH  276

Query  304  YIEVY----NQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDV  350
             + V+     ++LE   PALA HF  + +  +M+AV W          LP D   R+WDV
Sbjct  277  TLHVHCFQTQRLLELTEPALAEHFASEKVPIEMFAVGWFQTLYLYLNVLPQDSLNRIWDV  336

Query  351  YVL-LGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
            ++         + ++ LL L    +++    +IM+  + F
Sbjct  337  FLFEKNWKIMLRVALALLQLSHKYVMDKPIDEIMQFFNTF  376

>PHYCA_37957
Length=235

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 75/165 (45%), Gaps = 36/165 (22%)

Query  214  EVPLTTDINDRNRARRSSAVLPVQNMLKDAVG-IAEMLVAHDL-----GYVQGMSYLAAT  267
            ++P T  +  RN  R+S  +L       D+ G +  +L A+ L     GY Q M++LAA 
Sbjct  53   DLPRTFPLALRNSMRQSQELLEG----GDSFGELRRVLQAYSLRNPAVGYCQSMNFLAAV  108

Query  268  LCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHY---------IEVYNQILEHELPA  318
            L  +M    AF  L A++           E T  +H            V++ ++  +LP 
Sbjct  109  LLQNMGEEEAFWVLAAIVE----------ELTPQYHTRTMTGSRADQRVFSDLVTQKLPV  158

Query  319  LAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGT  356
            LA H Q  G+D + + + W       +LP +  +R+WDV+   G+
Sbjct  159  LANHLQMLGVDFEPFTLKWFLCLFLNTLPFEPVMRIWDVFFCEGS  203

>PHYRA_96136
Length=396

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 93/233 (40%), Gaps = 66/233 (28%)

Query  180  TLPSGGTRAEMPL----LDALCFAGIPKELRGRV--------------------------  209
            TL +  T AE+ L     DAL  AG+P +LRG+V                          
Sbjct  2    TLSTFATAAELMLHARQFDALLKAGVPPKLRGQVWWMCSGAAELRREALESYPALLHRLH  61

Query  210  --AEGSEVPLTTDINDRNRARRSSAVLPVQNMLKDAVGIAEM---LVAHDL-----GYVQ  259
              ++ +E+ +  D+         S++   Q M  +     E+   L A+ L     GY Q
Sbjct  62   TLSKCAEMDIEKDLPRTFPLALRSSMRCSQEMCAEEDNFGELRRVLQAYSLRNPAVGYCQ  121

Query  260  GMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHY---------IEVYNQ  310
             M++LAA L   M    AF  L A++           E T  +H            V++ 
Sbjct  122  SMNFLAAVLLQQMGEEEAFWVLAAIVE----------ELTPQYHTRTMTGSRADQRVFSD  171

Query  311  ILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGT  356
            ++  +LP LA H    G+D + + + W       +LP +  LRLWDV+   G+
Sbjct  172  LVTQKLPVLANHLHTLGVDFEPFTLKWFLCLFLNTLPFEPVLRLWDVFFCEGS  224

>PHYSO_354338
Length=401

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query  249  MLVAHDLGYVQGMSYLAATLC--FHMDSFTAFKALVALMSSSLLFDMFRLEATRT-FHYI  305
            M++   +GY QGM+ +AA L     M+S  AF+  +AL     L D++R +       Y 
Sbjct  198  MMLKPQIGYCQGMTSVAAVLVQESKMNSEIAFRLFLALTEKYRLDDVYRPDMKDVNLRYF  257

Query  306  EVYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLALRLW---------DVYVLLGT  356
            ++ ++ L   LP L AH  ++ I    YA  W L L    RL+         D++   G 
Sbjct  258  QL-DEALRLHLPRLHAHLSDRDIHPSTYASCWILTLFTECRLFPHRYVIAFLDLFFEFGW  316

Query  357  PFFFQASMGLLTLFQDSLLEMD-AGDIMRLL  386
              FFQ  + +L+  + +LL    +GDI   L
Sbjct  317  KVFFQTCLAILSTIEAALLRRSTSGDIFAYL  347

>PHALS_09643
Length=585

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 23/157 (15%)

Query  255  LGYVQGMSYLAATLCFHM-----------DSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            +GY QGM Y+AA +  ++           ++   F  +VAL  +  L +MF      T H
Sbjct  385  VGYCQGMDYIAANILNNVKLSGSTPDVKAEAERTFWLMVALFENYGLQEMFA-PGLPTLH  443

Query  304  -YIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDVYVL  353
             +     ++LE   P LA HF  + +  +M+AV W          LPLD   R+WD+++ 
Sbjct  444  VHCFQAQRLLELTKPELAHHFSSEKVPIEMFAVGWFQTMYLYLNVLPLDSLDRIWDIFIF  503

Query  354  -LGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
                    + ++ LL L +  ++     +IM+  + F
Sbjct  504  DHNWKIMLRVALALLQLSEKFVMNKPIDEIMQFFNTF  540

>CCI11615
Length=476

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 68/137 (50%), Gaps = 11/137 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL-LFDMFRLEATRTFHYIEVYNQILE  313
            +GY Q M+++ A L   +    +F  L  ++   +  F    +  +R      V + ++E
Sbjct  179  VGYCQSMNFIGAMLLQQLGEEESFWVLAVIVEDLIPQFHERNMRGSRVEQL--VLSDLVE  236

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
              LP L AHFQ  G++   +A+ W       +LPL++ +R+WDV+   G     + ++ L
Sbjct  237  QMLPNLYAHFQRLGVEFGPFAMKWFLCLFINTLPLEMVMRIWDVFFYEGGHVVLRVALTL  296

Query  367  LTLFQ-DSLLEMDAGDI  382
            L L + D +L  DA ++
Sbjct  297  LKLSEHDLILCEDAMEV  313

>PHYSO_509000
Length=840

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 63/148 (43%), Gaps = 11/148 (7%)

Query  255  LGYVQGMSYLAATLC-FHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            +GY QGM +L   L     D    F   V         +++         Y+  +  +  
Sbjct  665  VGYCQGMGFLVRLLTEVAEDEADIFWLFVGFSEPENDRNLYEPGMAVLQPYLSKFELLFS  724

Query  314  HELPALAAHFQEQGIDAQMYAVDWSLPL---------DLALRLWDVYVLLGTPFFFQASM  364
              +P L AHFQ +G+    +   W L           +L +RL D++++ G    F  S+
Sbjct  725  THMPELYAHFQAEGVHVATFCTRWFLTFFSSFETLAPNLVIRLLDIFIIDGWRVMFSVSL  784

Query  365  GLLTLFQDSLLEMDAGDIMRLLHNFPKT  392
             +L   Q+ L++ D   I+R+L  FP++
Sbjct  785  VILDELQEQLMKCDMEGILRVLQ-FPRS  811

>PHYRA_78650
Length=583

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 78/186 (42%), Gaps = 34/186 (18%)

Query  255  LGYVQGMSYLAATLCFHM-----------DSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            +GY QGM Y+AA +   +           ++   F  LV L     L +MF        H
Sbjct  380  VGYCQGMDYIAAHVLNKVKRSGAAADTKAEAENTFWLLVTLFEQYGLHEMF----APGLH  435

Query  304  YIEVY----NQILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDV  350
             + V+     ++LE   PALA HF  + +  +M+AV W          LP D   R+WDV
Sbjct  436  TLHVHCFQTQRLLELTEPALAEHFASEKVPIEMFAVGWFQTLYLYLNVLPADSLNRIWDV  495

Query  351  YVLLGT-PFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPLET  409
            ++         + ++ LL L +  +++    +IM+  + F          E ++  PL  
Sbjct  496  FLFEKNWKIMLRVAVALLQLSEQFVMDKPIDEIMQFFNTFADKAD-----ELLAETPLTE  550

Query  410  MAARGK  415
             A R K
Sbjct  551  RALRLK  556

>SPRG_15585
Length=146

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 9/126 (7%)

Query  5    PPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTY-STKSGRKPRLLLSLG----  59
            P  + V  G+L K+ +G      K W+ RYF LT + L Y S + G+K   L   G    
Sbjct  7    PALEFVKTGFLFKRGAGGLFGR-KNWKPRYFELTDSTLRYYSYQKGKKKGELRLDGIGRD  65

Query  60   --DVQVIDDQNQVRHPGN-FVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSH  116
              +V   D +         +   +QTP RRL L+A+TE E   W+  L  ++ GG    H
Sbjct  66   AIEVMPADSKKTGTSKSTIWRIAIQTPKRRLLLAASTEYEMNEWIYALSRVVKGGVKHRH  125

Query  117  SEPTVF  122
            S+ T +
Sbjct  126  SDMTNY  131

>H310_12135
Length=804

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 66/148 (45%), Gaps = 13/148 (9%)

Query  255  LGYVQGMSYLAATLC--FHMDSFTAFKALVALMSSSL--LFDMFRLEATRTFHYIEVYNQ  310
            LGY QGM++LAA L    H +   AF  L A+  S    L +++R               
Sbjct  555  LGYCQGMNFLAAFLLTNVHWNEAQAFWLLTAVAVSPQYQLMELYRPGVPLLNLRFYQLQA  614

Query  311  ILEHELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDVYVLLGTPFFFQ  361
            +++  LP L AHF+       M A  W         +LP D  +R+ D +++ G    FQ
Sbjct  615  LVQQLLPDLHAHFEAHDFHVSMCASGWFMTLFTNCDTLPADAVVRVLDCFLVYGWKCIFQ  674

Query  362  ASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
             ++ LL   Q  LL++D   I+ + +  
Sbjct  675  VALALLQFLQPDLLQVDFEAIVDVFYTL  702

>PHALS_09806
Length=537

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (51%), Gaps = 10/110 (9%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSS-SLLFDMFRLEATRTFHYIEVYNQILE  313
            +GY Q M++LAA L  HM     F  L A++   + L+    +  +R      V++ ++ 
Sbjct  250  VGYCQSMNFLAAVLLQHMGEEEVFWVLAAIVEELTPLYHTRTMTGSRADQ--RVFSDLVT  307

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGT  356
             +LP LA H Q  G+D + + + W       +LP +  +R+WD++   G+
Sbjct  308  QKLPVLANHLQMLGVDFEPFTLKWFLCLFLNTLPFEPVMRIWDLFFCEGS  357

>H257_06325
Length=210

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 70/141 (50%), Gaps = 18/141 (13%)

Query  8    QLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSL-----GDVQ  62
             LV  G L+K+         + W+ R+F+LT  +L+Y    G + +  + L      D+Q
Sbjct  28   NLVRTGILYKKGRKTGFFSRQNWKPRFFMLTWEKLSYYEFEGGELKGEVDLRSCTNKDIQ  87

Query  63   VI-DDQNQVRHPGNFVF--VLQTPSRRLFLSATTEQERRSWVSELRAL------LAGGYN  113
            V+ DD  +     + ++   + TP+RRLF++AT+E E   W+ +LR +      + GG +
Sbjct  88   VMPDDCKKTGQSASSIWRIAISTPARRLFIAATSEFEMIEWLEDLRDVTSRHERMGGGAS  147

Query  114  ----PSHSEPTVFGRKLSDSV  130
                PS   P+V    L DSV
Sbjct  148  DMVRPSVVRPSVVRPSLMDSV  168

>PHYSO_349570
Length=1133

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/186 (23%), Positives = 83/186 (45%), Gaps = 15/186 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            LGY QG++Y+ A    H+    AF  L+A++   L+ D +            V+  ++  
Sbjct  324  LGYCQGLNYIVARSLQHLSEEEAFYLLIAIV--RLVPDDYYTTMLGLAVDQHVFADLVRL  381

Query  315  ELPALAAHFQE---QGIDAQMYAVDWSLPL-------DLALRLWDVYVLLGTPFFFQASM  364
            + P ++ H  E    G++  +   +W L L        +  ++WD   L G    F+ ++
Sbjct  382  QYPEISEHLTELGGSGMELSLACTEWFLTLFASPCERGVTFQIWDAIFLQGEEVLFRVAL  441

Query  365  GLLTLFQDSLLEMDA-GDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQSVFAAFN  423
             LL   +  LL  +A GD+++ L+   +   +    E +  +  +    RG+   F A +
Sbjct  442  ALLQQAKAELLACNAYGDMLKHLNELGR--GNVDALELMKISKKQDCVIRGRIEDFRAHH  499

Query  424  KLQVIA  429
            +LQ+ +
Sbjct  500  RLQLAS  505

>PHYCA_569930
Length=143

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 31/132 (23%), Positives = 60/132 (45%), Gaps = 8/132 (6%)

Query  261  MSYLAATLCFH-MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPAL  319
            M+++AA      +    A+   + ++    L  ++   +T    Y++ + Q+   +LP L
Sbjct  1    MNFIAALFLVEGLSEADAYSLFLYMLRKRHLAGIYHRSSTFLDEYLQHFEQMFIRDLPKL  60

Query  320  AAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQD  372
             AH   QG    MY ++W       S   DLA  ++D++ +     F +A + +L L + 
Sbjct  61   HAHLLAQGFAIPMYGIEWFTTLFSLSTKTDLACAIFDLFFVGVQDVFLRAGLAILKLLEA  120

Query  373  SLLEMDAGDIMR  384
             L+ M   D +R
Sbjct  121  KLMCMTFEDFLR  132

>HYAP_00686
Length=569

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 55/119 (46%), Gaps = 26/119 (22%)

Query  254  DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYI--------  305
            D+GY Q M++LAA L  +M    AF  L A++           E T  +H          
Sbjct  259  DVGYCQSMNFLAAVLLQNMGEEEAFWVLAAIVE----------ELTPQYHTQTMTGSRAD  308

Query  306  -EVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGT  356
              V++ ++  +LP LA H    G+D + + + W       +LP +  +R+WDV+   G+
Sbjct  309  QRVFSDLVTEKLPVLAGHLHALGVDFEPFTLKWFLCLFLNTLPFEPVMRIWDVFFCEGS  367

>H310_11094
Length=606

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 69/150 (46%), Gaps = 11/150 (7%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLL-FDMFRLEATRTFHYIEVYNQILE  313
            +GY Q M++L A L  ++    AF  L  ++   +  +    +  +R   +  V+  ++E
Sbjct  313  VGYCQSMNFLGAMLLVYLGEEEAFWVLACIVEDLVPGYHTKSMVGSRVDQH--VFAALIE  370

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
             +LP +A H Q   +        W       +LPL+  LR+WDV+   G+    +  + L
Sbjct  371  QKLPHVAHHLQALHVHLAPVTFKWFLCLFVNTLPLETTLRVWDVFFSEGSKVIHRLGLTL  430

Query  367  LTLFQDSLLEMD-AGDIMRLLHNFPKTTSS  395
            + L    +L  D A D+  LL   P+T ++
Sbjct  431  IKLLAPDILAADEAFDVYELLKFSPRTLAT  460

>H310_05823
Length=591

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 81/186 (44%), Gaps = 29/186 (16%)

Query  255  LGYVQGMSYLAATL--CFHMDSFTAFKALVALMSSSLLFDMFRLE----ATRTFHYIEVY  308
            +GY  GM++L A+L  C   D    F+   A M    + D+F L      T+  H  +++
Sbjct  400  VGYCHGMTFLGASLLTCLEYDDEATFQVFAAAMQHYAMADLFHLPDLPGTTQRMH--QLH  457

Query  309  NQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDL---ALRLWDVYVLL------GTPFF  359
            N I  H LP++    +   I   M++  W + L L   +L    + +LL      G P  
Sbjct  458  NLIRAH-LPSVDKCLRSHRIHPHMFSSGWIMSLFLNEPSLSPCTIGILLDGFFQGGWPHM  516

Query  360  FQASMGLLTLFQDS-LLEMDAGDIMRLLHNFPKTTSS----------CQLFEAISSNPLE  408
            F+  MGLL++  D+ ++   A   +R L   PK   +           Q   A S + L+
Sbjct  517  FRIYMGLLSIHADAHIITPHANRTLRALVQLPKHLEASLSAVLDEGRVQFSLATSDDALD  576

Query  409  TMAARG  414
             MAA+ 
Sbjct  577  IMAAQN  582

>PYIW_15966
Length=619

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 69/168 (41%), Gaps = 28/168 (17%)

Query  252  AHDLGYVQGMSYLAATLCFHMDS---------------------FTAFKALVALMSSSLL  290
            A ++ Y QGM+Y+AA L   ++                       TAF  L AL+ +  +
Sbjct  144  APEVAYCQGMNYVAALLLMMLNEDNLELQDEGELSPESSNESPEETAFWILYALIRNQGM  203

Query  291  FDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDL  343
             D++R +       I +YNQ+L+     L  H +  G+     A  W        LP   
Sbjct  204  ADVWRSKMPGLSRCIYLYNQLLQIHFYDLHVHLRHIGMHPSFLATQWFVTLFARVLPAQS  263

Query  344  ALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPK  391
              R+WD+++L G    F+ ++ +    +  +L+MD  +        PK
Sbjct  264  VHRVWDLFLLDGWKMVFRVALAITAHLRPFMLKMDMEECSDFFRQNPK  311

>H310_13087
Length=282

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 52/109 (48%), Gaps = 8/109 (7%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLG-----DVQV  63
            ++  G LH++  G     ++ W   +F+L    L Y   SG K   LLSL       V+V
Sbjct  124  VITTGVLHRRRRG-KIGWMERWTSSHFVLCTQYLKYYNPSGEKLLGLLSLAGCTEKSVEV  182

Query  64   I--DDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAG  110
            +  D     +    + F L TP RR+ LSA TE E  SW+  LRA + G
Sbjct  183  MPKDSVPNGKQATIWRFALNTPQRRIVLSAATEYEMNSWLRHLRAAITG  231

>H310_09246
Length=211

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (54%), Gaps = 8/110 (7%)

Query  8    QLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSL-----GDVQ  62
             +V  G L+K+ S       + W+ RYF LT N+L+Y    G + +  + L      D+Q
Sbjct  26   NVVRTGILYKKGSKTGFFGRRNWKPRYFTLTWNKLSYYLHEGGELKGEIDLRQCTSKDIQ  85

Query  63   VI-DDQNQVRHPGNFVFVLQ--TPSRRLFLSATTEQERRSWVSELRALLA  109
            V+ +D  +  H  + ++ +   TP+RRLF++A +E E   W+ +L  +++
Sbjct  86   VMPEDCKKTGHSASSIWRISVSTPARRLFIAAVSEYEMNEWLEDLMDVIS  135

>PYIR_13971
Length=449

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 67/143 (47%), Gaps = 15/143 (10%)

Query  254  DLGYVQGMSYLAATLCFHM---DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQ  310
            D+ YVQGM+ L A L + M   D++  F  L+       +    +   +       + ++
Sbjct  230  DIRYVQGMNILCAPLLYVMPEADAYYTFCQLIVKHCPHYMAPKLKGVVSGCL----LVDK  285

Query  311  ILEHELPALAAHFQEQGIDAQMYAVDWSL-------PLDLALRLWDVYVLLGTPFFFQAS  363
             L+     L  H + +GI+AQ+YA+   L       PL   LR+WDV   +G  F    +
Sbjct  286  CLQTLDADLFNHLKSRGINAQIYALPLILSLFACAPPLHELLRVWDVLFAVGVHFVVVLA  345

Query  364  MGLLTLFQDSLLEMDAGDIMRLL  386
            +    L +D LL+ D  D+M++L
Sbjct  346  VAHTVLLRDQLLQKDM-DLMKIL  367

>PPTG_05282
Length=1105

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/197 (23%), Positives = 85/197 (43%), Gaps = 15/197 (8%)

Query  244  VGIAEMLVAHDLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFH  303
            V +A  +    LGY QG++Y+ A     +D   AF  LVA++   L+ D +         
Sbjct  315  VLVAYSIYNPGLGYCQGLNYIVARSLQFLDEEEAFYLLVAII--QLVPDDYYTTMLGLAV  372

Query  304  YIEVYNQILEHELPALAAHFQE---QGIDAQMYAVDWSLPL-------DLALRLWDVYVL  353
               V+  ++  + P ++ H  E    G++  +   +W L L        +  ++WD   L
Sbjct  373  DQHVFADLVRIQYPEISEHLSELGGSGMELSLACTEWFLTLFASPCERGVTFQIWDAIFL  432

Query  354  LGTPFFFQASMGLLTLFQDSLLEM-DAGDIMRLLHNFPKTTSSCQLFEAISSNPLETMAA  412
             G    F+ ++ LL   +  LL   + GD+++ L+   +          +S N  +    
Sbjct  433  QGDEVLFRVALALLQQAKADLLACKNYGDMLKHLNELGRGELDALTLMQVSKN--QDCVI  490

Query  413  RGKQSVFAAFNKLQVIA  429
            RG+   F A ++LQ+ +
Sbjct  491  RGRIEDFRAHHRLQLAS  507

>SDRG_01877
Length=456

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 29/181 (16%)

Query  255  LGYVQGMSYLAATLCF--HMDSFTAFKALVALMSSSLLFDMFRLEA------TRTFHYIE  306
            +GY QGM Y+AA L +  + +   AF+ LVALM     +D+  + A         F+ ++
Sbjct  245  IGYCQGMDYIAAILLYGSNWECHHAFRLLVALMDK---YDLGGVCAPGLPLLNLKFYQLD  301

Query  307  VYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPL---------DLALRLWDVYVLLGTP  357
               +++   LP +  H    GI    YA  W L L          L L  +D +   G  
Sbjct  302  ---ELVHFHLPDVHQHLSLHGIHPNTYASGWVLSLFANFKTLHPALVLSFFDGFFAKGWK  358

Query  358  FFFQASMGLLTLFQDSLLEMD-AGDIMRLLHN-----FPKTTSSCQLFEAISSNPLETMA  411
             +++ ++ +L   +  LL+   A  +M LL++     FP++   C+ F A++S+   T A
Sbjct  359  SWYRVALAILATARQRLLQTHTATALMELLNHDLASLFPESDDKCREFFALTSHFKVTNA  418

Query  412  A  412
            A
Sbjct  419  A  419

>PITG_05954
Length=516

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 56/118 (47%), Gaps = 26/118 (22%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHY---------I  305
            +GY Q M++LAA L  +M    AF  L A++           E T  +H           
Sbjct  250  VGYCQSMNFLAAVLLQNMGEAEAFWVLAAIVE----------ELTPQYHTRTMTGSRADQ  299

Query  306  EVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGT  356
             V++ ++  +LP +A+H Q  G+D + + + W       +LP +  +R+WDV+   G+
Sbjct  300  RVFSDLVTQKLPVVASHLQTLGVDFEPFTLKWFLCLFLNTLPFEPVMRIWDVFFCEGS  357

>SDRG_12208
Length=163

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 9/109 (8%)

Query  5    PPHQLVLQ-GYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQV  63
            P    +L+ G LHK+ SG      + W+ RYF LT   L+Y   + R+ + ++SL  + V
Sbjct  3    PTSSTILKAGVLHKKGSGAGLFGRRNWKPRYFELTGTLLSYYDFASRQLKGVVSLDAIGV  62

Query  64   ------IDDQNQVRHPGNFVFVL--QTPSRRLFLSATTEQERRSWVSEL  104
                   +D  +    G+ ++ +   TP+RRL LSA  E E   W+  L
Sbjct  63   DAIECMPEDAVKTGSSGSTIYRIGVTTPARRLLLSAANEIEMYDWIDAL  111

>H310_14220
Length=166

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 5/100 (5%)

Query  10   VLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLL----LSLGDVQVID  65
            V +G L KQ +G      K W++R+F LT +EL Y   +G     +     +   ++++ 
Sbjct  9    VKEGALFKQGAGGGLFKRKNWKLRFFELTLDELRYLNSAGEVKGSISMRYCTTDSIEIMP  68

Query  66   DQNQVRHPGN-FVFVLQTPSRRLFLSATTEQERRSWVSEL  104
            D ++  H G  +   + TP RRL ++  +E +  +WV  L
Sbjct  69   DSDRPIHGGTIWRIAISTPCRRLLVACASEDDMEAWVDAL  108

>SDRG_15786
Length=150

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 8/108 (7%)

Query  10   VLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRK-----PRLLLSLGDVQVI  64
            V  G L K+ SG      K W+ RYF LT + L+Y  + G K     P   L+  D++++
Sbjct  5    VKTGVLFKKGSGIGLFSRKNWKPRYFELTSSHLSYYDEQGGKLKGALPLASLAAHDIEIM  64

Query  65   --DDQNQVRHPG-NFVFVLQTPSRRLFLSATTEQERRSWVSELRALLA  109
              D +   +    N+   L T  RR F +A TE E   WV  L  ++A
Sbjct  65   PCDGRKTGKSASTNWRICLNTNGRRFFFAAATEDEMYEWVQALLFVIA  112

>PYVX_13738
Length=1283

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 72/190 (38%), Gaps = 53/190 (28%)

Query  254  DLGYVQGMSYLAATLCFHM-----------------------------------------  272
            D+GY QGM Y+AA +  H+                                         
Sbjct  361  DVGYCQGMDYIAAHVLDHVKKSNEAKLMARAGRSYRTSDEDDDGEEGAPSPTRTRASAAT  420

Query  273  --DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDA  330
              +  TAF  LV L  +  L  MF     R         ++ E  +PALA HF E+ +  
Sbjct  421  RVEVETAFWMLVGLFENYGLRQMFSPGLDRLHLNCFQCQRLFEIGMPALAEHFGEEKVMV  480

Query  331  QMYAVDWSLPLDLAL---------RLWDVYVLLGT-PFFFQASMGLLTLFQDSLLEMDAG  380
            +M+ V W   L L L         R+WD+++         + ++ LL L ++ ++     
Sbjct  481  EMFIVGWFQTLYLYLNVMPRETLDRIWDIFLFENNWKIMLRVALALLQLSEEHIIGKPID  540

Query  381  DIMRLLHNFP  390
            ++M+ L+ FP
Sbjct  541  EVMQFLNTFP  550

>PHALS_08442
Length=1349

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/187 (22%), Positives = 80/187 (43%), Gaps = 21/187 (11%)

Query  255  LGYVQGMSYLAATLCFHM---DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQI  311
            LGY QG++Y+ A    ++   +SF    A++ L+       M  L   +      V+  +
Sbjct  381  LGYCQGLNYIVARSLQYLSEEESFYLLIAIIRLVPDDYYTTMLGLAVDQ-----HVFADL  435

Query  312  LEHELPALAAHFQE---QGIDAQMYAVDWSLPL-------DLALRLWDVYVLLGTPFFFQ  361
            +  + P +  H  E    G++  +   +W L L       ++  ++WD   L G    F+
Sbjct  436  VRLQCPDITEHLAELGGSGMELSLACTEWFLTLFASPCAKEVTFKIWDAIFLQGDEILFK  495

Query  362  ASMGLLTLFQDSLLEMDA-GDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQSVFA  420
             ++ LL   +  LL     GD+++ L++  +          +S N  +    RG+   F 
Sbjct  496  VALALLQQEKTELLACKTYGDMLKRLNDLGRGEIDALALMRVSKN--QECVVRGRIEDFR  553

Query  421  AFNKLQV  427
            A ++LQ+
Sbjct  554  AHHRLQL  560

>SDRG_15783
Length=146

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 9/126 (7%)

Query  5    PPHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNEL-TYSTKSGRKP---RL-LLSLG  59
            P  + V  G+L K+ +G      K W+ RYF LT + L  YS + G+K    RL  +   
Sbjct  7    PTLEFVKTGFLFKRGAGGLFGR-KNWKPRYFELTDSTLRYYSYQKGKKKGEVRLDGIGRD  65

Query  60   DVQVID-DQNQVRHPGNFVF--VLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSH  116
             ++V+  D  +     + ++   +QTP RRL L+A+TE E   W+  L  ++ GG    H
Sbjct  66   AIEVMPADSKKTGTSKSTIWRIAVQTPKRRLLLAASTEYEMNEWIYALSRVVKGGLKHRH  125

Query  117  SEPTVF  122
            S+ T +
Sbjct  126  SDMTNY  131

>PYIR_18903
Length=597

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 18/128 (14%)

Query  276  TAFKALVALMSSSLLFDMFRLEATRTFHYIEVY----NQILEHELPALAAHFQEQGIDAQ  331
            TAF  LV L     L  MF    +   H ++V+     ++ E  LPALA HF+ + + A+
Sbjct  429  TAFWILVCLFEKYGLRQMF----SPGLHRLQVHCFQLQRLFELALPALAEHFEHEKVVAE  484

Query  332  MYAVDWSLPLDLAL---------RLWDVYVLLGT-PFFFQASMGLLTLFQDSLLEMDAGD  381
            M+ V W   L L L         R+WD+++L        + ++ +L L ++ +L     +
Sbjct  485  MFTVGWFQTLFLYLNVLPRESLDRIWDIFLLENNWKIMLRVAVAILQLSEEHVLGKPIDE  544

Query  382  IMRLLHNF  389
            +M+ L+ F
Sbjct  545  VMQFLNTF  552

>H310_00656
Length=553

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 68/153 (44%), Gaps = 12/153 (8%)

Query  246  IAEMLVAHDL-----GYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATR  300
            +  +LVA+ +     GY Q M++L   L        AF  L  +M+  L  + +      
Sbjct  289  LTNVLVAYSMHNTAVGYCQSMNFLVGILLLFHTEEEAFWLLCVMMAKCLPMENYSRSMLG  348

Query  301  TFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVL  353
                  V+ +++  +LPA+A  F   GI  ++  + W       +LPLD ALR+WD   L
Sbjct  349  AQVDQVVFKRLVALQLPAIAEAFDNAGIAIELVTLQWFLCVFVCTLPLDTALRVWDYMFL  408

Query  354  LGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLL  386
             G    F A++ ++   +  ++E     I  L+
Sbjct  409  QGEQVLFAAALAIIKAAESKIMEASPSHISLLM  441

>PITG_00385
Length=840

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 61/148 (41%), Gaps = 11/148 (7%)

Query  255  LGYVQGMSYLAATLC-FHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            +GY QGM +L   L     D    F   V         +++         Y+  + ++  
Sbjct  665  VGYCQGMGFLVRLLAEVAEDEADIFWLFVGFSEPENDRNLYEPGMAVLQPYLSKFEELFS  724

Query  314  HELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDVYVLLGTPFFFQASM  364
              +P L  HFQ++G+    +   W         +L   L  RL D++++ G    F  S+
Sbjct  725  THMPELHMHFQKEGVHVATFCTRWFLTFFSSFETLAPTLVTRLLDIFIIDGWRIMFSVSL  784

Query  365  GLLTLFQDSLLEMDAGDIMRLLHNFPKT  392
             +L   Q  LL+ D   I+R+L  FP+ 
Sbjct  785  VILDELQQQLLKADMEGILRVLQ-FPRC  811

>H310_13596
Length=147

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (54%), Gaps = 10/106 (9%)

Query  315  ELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLL  367
            ELP L  HF   G+   ++ ++W        LPL++A R++D ++L G  F F+ ++ +L
Sbjct  2    ELPQLFQHFNFIGVPTSLFLMNWLQTLFLQVLPLEVASRVFDNFLLDGVLFLFRTALAIL  61

Query  368  TLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNPL-ETMAA  412
            TL   +LLE D    + LL    +  S    FEA++ + L  T+AA
Sbjct  62   TLLGPTLLEYDLDVALPLLQRHYQHQSRW--FEALAEDKLFATIAA  105

>PPTG_10785
Length=873

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 59/148 (40%), Gaps = 11/148 (7%)

Query  255  LGYVQGMSYLAATLC-FHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            +GY QGM +L   L     D    F   V         +++         Y+  +  +  
Sbjct  698  VGYCQGMGFLVRLLAEVAEDEADIFWLFVGFSEPENDRNLYEPGMAVLQPYLSKFEVLFS  757

Query  314  HELPALAAHFQEQGIDAQMYAVDW---------SLPLDLALRLWDVYVLLGTPFFFQASM  364
              +P L  HFQ +G+    +   W         +L   L  RL D++++ G    F  S+
Sbjct  758  THMPELYTHFQNEGVHVATFCTRWFLTFFSSFETLAPTLVTRLLDIFIIDGWRIMFSVSL  817

Query  365  GLLTLFQDSLLEMDAGDIMRLLHNFPKT  392
             +L   Q  LL+ D   I+R+L  FP+ 
Sbjct  818  VILDELQQQLLKSDMEGILRVLQ-FPRC  844

>SPRG_04025
Length=535

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 11/141 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSL-LFDMFRLEATRTFHYIEVYNQILE  313
            +GY Q M++L A L  +M    AF  L  ++   +  +    +  +R   +  V++ ++ 
Sbjct  290  VGYCQSMNFLVAVLLVYMGEEEAFWVLACVIEDLVPEYHTTSMVGSRVDQH--VFHALVA  347

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGL  366
             +LP +A+H     +        W       SLPL+  LR+WDV+   G     +  + L
Sbjct  348  QKLPDVASHLSTLHVHLAPLTFKWFLCLFVNSLPLETTLRVWDVFFAEGAKVIHRIGLTL  407

Query  367  LTLFQDSLLEMD-AGDIMRLL  386
            L L  D++L  D A D+   L
Sbjct  408  LKLHADAILACDEAFDVYETL  428

>SPRG_12220
Length=151

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 8/108 (7%)

Query  10   VLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLG-----DVQVI  64
            V  G L K+ SG      K W+ RYF L+ + L+Y  + G K +  L L      D++++
Sbjct  6    VKTGVLFKKGSGIGLFSRKNWKPRYFELSSSHLSYYDEQGGKLKGALHLASLAAHDIEIM  65

Query  65   --DDQNQVRHPG-NFVFVLQTPSRRLFLSATTEQERRSWVSELRALLA  109
              D +   +    N+   L T  RR F++A TE E   WV  L  ++A
Sbjct  66   PCDGRKTGKSASTNWRICLNTNGRRFFIAAATEDEMYEWVQALLFVIA  113

>PHYCA_12885
Length=409

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 70/155 (45%), Gaps = 23/155 (15%)

Query  257  YVQGM---SYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHY-IEVYNQIL  312
            Y  GM     + +T     D+F +F+ L+ ++     FD    E+   FH    V  ++L
Sbjct  137  YCHGMVESCVVLSTFLVEEDAFWSFRMLLEVLLPKY-FD----ESVVDFHTDCLVLQELL  191

Query  313  EHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVL------LGTPFF  359
                PAL+ HF   G+  Q+    W       S+P ++  RL+D   +      LG+   
Sbjct  192  RVHDPALSEHFSVLGVSIQLLCTKWFFSFFAESMPFEVVCRLYDTMFVDICSRQLGSKII  251

Query  360  FQASMGLLTLFQDSLLEM-DAGDIMRLLHNFPKTT  393
            F  SM +L     +++E+ D   ++ +++ F +TT
Sbjct  252  FSTSMAVLLYLSSTVVEIQDVKVVLEIINEFCRTT  286

>PYIW_20175
Length=1062

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 73/173 (42%), Gaps = 28/173 (16%)

Query  246  IAEMLVAHD-----LGYVQGMSYLA---ATLCFHMDSFTAFKALVALMSSSLLFDMFRLE  297
            I  +LVA+        Y  GM  +    +T     D+F AF+ L+      +L   +  E
Sbjct  130  IKRILVAYTKSKDVFYYCHGMVEICVVLSTFLVEEDAFWAFRLLL-----EVLLPKYHEE  184

Query  298  ATRTFHY-IEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWD  349
            +   FH    V  ++L +  P L  HF   G+  Q+    W       S+P +L  RL+D
Sbjct  185  SIVDFHTDCLVLQELLSNYDPVLCEHFATMGVTIQLLCTKWFFSFFAESMPFELVCRLYD  244

Query  350  VYVL------LGTPFFFQASMGLLTLFQDSLLEM-DAGDIMRLLHNFPKTTSS  395
            V ++      L +   F  SM +      +L+E+ D   I+ ++  F  TT S
Sbjct  245  VLLVDICCLRLSSKIIFSTSMAIFLYLSATLVEVHDPSVIVEIICEFCWTTLS  297

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 77/171 (45%), Gaps = 34/171 (20%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHY-IEVYNQILE  313
            +GY QGM+ + A L  ++D   A  ALV L+   +L   + +++    H    V N +L+
Sbjct  639  VGYCQGMNEILAILLQYLDETEALLALVLLI--EVLLPAYHVDSMIGLHTDCAVMNTLLK  696

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVY------------VLL  354
               P L +H  E G++ ++    W       SLP    L++ D+             VLL
Sbjct  697  QNDPELHSHLTELGLNMEILCTKWLVTCFLTSLPSFCGLKVIDMLLARAQEKQRASRVLL  756

Query  355  GTPFFFQASMGLLTLFQDSLLEM-DAGDIMRLLHNF-----PKTTSSCQLF  399
            G        + +  + +D+LL+  DAG+++  ++ +      KTT+    F
Sbjct  757  GV------GISIFFVLRDALLDAKDAGEVLLAVNEYFAREMAKTTTEMDKF  801

>PYAR_15755
Length=606

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 19/144 (13%)

Query  254  DLGYVQGMSYLAATLCFHMDSF------------TAFKALVALMSSSLLFDMFRLEATRT  301
            D+GY QGM+Y+ A L     S              +F  +VAL+    L D++R +    
Sbjct  109  DVGYCQGMNYVVAALLMLFTSTRDQQQEQMAPQEASFWLVVALIRQFGLDDLWRPKMPGL  168

Query  302  FHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLL  354
               I +Y Q+L      L AH ++ G+   + A  W        L LD+  R+WD+ ++ 
Sbjct  169  SRCIHLYQQLLRRHFYDLHAHLKKIGMHPSLLATQWFATLFARVLSLDVLARVWDLVLVD  228

Query  355  GTPFFFQASMGLLTLFQDSLLEMD  378
            G    ++ ++ +    +  ++ +D
Sbjct  229  GWKMVYRVALAVTEHVRPHIINLD  252

>CCA14337
Length=606

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/175 (25%), Positives = 70/175 (40%), Gaps = 40/175 (23%)

Query  254  DLGYVQGMSYLAATLCFHMDSFT----------------------------AFKALVALM  285
            D+GY QGM Y+A  +  +M   T                            AF  LV L 
Sbjct  377  DVGYCQGMDYIAVHVLDYMKKQTSIESASTADSSGAIPTCRTAATPEEVERAFWLLVCLF  436

Query  286  SSSLLFDMFRLEATRTFH-YIEVYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLA  344
                L  M+ L   +  H       +I E  +PAL+ H ++  +  +MY V WS  L L 
Sbjct  437  EQYGLRQMY-LPGLQVLHSQCFQLKRITELTMPALSEHLEKNKVITEMYMVGWSQTLFLY  495

Query  345  L---------RLWDVYVL-LGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNF  389
            L         RLWD+++         + ++ LL + +  + + +  +IM+ L +F
Sbjct  496  LTVLPRQTLDRLWDIFIWEKNGKIIMRGALALLQIAEPYIRDQETDEIMQFLSSF  550

>PYAR_13799
Length=626

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 55/120 (46%), Gaps = 7/120 (6%)

Query  272  MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQ  331
            +D   A+   + L+    L  ++   +T    Y+  ++ +L+ ELP L AH   QG    
Sbjct  200  LDEADAYALFLYLLEKRQLARIYHHSSTFLDDYLLHFDAMLQRELPDLYAHLHAQGFAIP  259

Query  332  MYAVDWSLPL-------DLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMR  384
            MY ++W   L       DLA  ++D++ +     F +  + LL L +  L+ M   D +R
Sbjct  260  MYGIEWFTTLFSLSTKPDLACAIFDLFFVGVQDIFLRMGLALLKLLEAPLMCMHFEDFLR  319

>H257_08721
Length=382

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (46%), Gaps = 28/194 (14%)

Query  224  RNRARRSSAVLPVQNMLKDAVGIAEMLVAHD-----LGYVQGMSYLAATLC--FHMDSFT  276
            R +AR+    + V ++ +  + +A +L A       +GY QGM++L A +      +   
Sbjct  89   RKQARKVPLHVSVTDVDEKKLALARVLRAFTATHTTMGYCQGMNFLTAFMLSNVQWNEAQ  148

Query  277  AFKALVALMSSSL--LFDMFR--------LEATRTFHYIE--VYNQILEHELPALAAHFQ  324
            AF  + A+  S    L +++R          +TR F   +  V + +++  LP L AHF+
Sbjct  149  AFWLVTAIAVSPQYQLMELYRPGVPLLNLRASTRYFGDDDDVVLHSMVQQLLPDLHAHFE  208

Query  325  EQGIDAQMYAVDW---------SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLL  375
             +     M A  W         +LP D  +R+ D +++ G    FQ ++ LL   Q  +L
Sbjct  209  AEDFHVSMCASGWFMTLFTNCDTLPADAVVRVLDCFLVYGWKIIFQVALALLQFLQHDIL  268

Query  376  EMDAGDIMRLLHNF  389
            +++   I+ L ++ 
Sbjct  269  QVEFEAIVDLFYSL  282

>SPRG_13267
Length=151

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 8/108 (7%)

Query  10   VLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLG-----DVQVI  64
            V  G L K+ SG      K W+ RYF L+ + L+Y  + G K +  L L      D++++
Sbjct  6    VKTGVLFKKGSGIGLFSRKNWKPRYFELSSSHLSYYDEQGGKLKGALHLASLAAHDIEIM  65

Query  65   --DDQNQVRHPG-NFVFVLQTPSRRLFLSATTEQERRSWVSELRALLA  109
              D +   +    N+   L T  RR F++A TE E   WV  L  ++A
Sbjct  66   PCDGRKTGKSASTNWRICLNTNGRRFFIAAATEDEMYEWVQALLFVIA  113

>PYVX_18060
Length=948

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 62/144 (43%), Gaps = 10/144 (7%)

Query  255  LGYVQGMSYLAATLCFHMDS-FTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            +GY QGM++L   L    D     F   V         +++         ++  Y  +  
Sbjct  773  VGYCQGMNFLVRLLTEVADEEADIFWLFVGFSEPENDRNLYEPGLAVLQPFLSKYEILFS  832

Query  314  HELPALAAHFQEQGIDAQMYAVDWSLPL---------DLALRLWDVYVLLGTPFFFQASM  364
            + +P L AHFQ +G+ A  +   W L L          L LRL+DV+V+ G    F  ++
Sbjct  833  NHMPELHAHFQAEGVHAAAFCARWFLTLFSSFETLSPSLVLRLFDVFVVDGWRVIFSMAL  892

Query  365  GLLTLFQDSLLEMDAGDIMRLLHN  388
             +L   +  L+  D   I+R+L +
Sbjct  893  VVLDELRTPLMAADLEGILRILQS  916

>PHYSO_517537
Length=525

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (46%), Gaps = 26/118 (22%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHY---------I  305
            +GY Q M++LAA L   M    AF  L +++           E T  +H           
Sbjct  251  VGYCQSMNFLAAVLLQQMGEEEAFWVLASIVE----------ELTPQYHTRTMTGSRADQ  300

Query  306  EVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGT  356
             V++ ++  +LP LA H Q  G+D + + + W       +LP +  +R+WDV+   G+
Sbjct  301  RVFSDLVTQKLPVLANHLQTLGVDFEPFTLKWFLCLFLNTLPFEPVMRIWDVFFCEGS  358

>PYAR_13998
Length=343

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 61/137 (45%), Gaps = 9/137 (7%)

Query  257  YVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHEL  316
            YVQGM+ + A L + M    A+     L+       M   +     H   + +Q LE   
Sbjct  184  YVQGMNVICAPLLYVMPEEDAYHTFCQLLLKHCPKYMAP-QLCGVEHGCILVDQCLEIID  242

Query  317  PALAAHFQEQGIDAQMYAVDWSL-------PLDLALRLWDVYVLLGTPFFFQASMGLLTL  369
            P L  H   +GI A++YA+   L       PL   LR+WDV   +G  F    ++    L
Sbjct  243  PELYRHLSSRGITARIYALPLILSLFACVPPLQELLRVWDVLFAVGVHFVVLLAVAHTVL  302

Query  370  FQDSLLEMDAGDIMRLL  386
             +D LL  D  D+M++L
Sbjct  303  LRDQLLAKDM-DLMKIL  318

>SPRG_12218
Length=273

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 54/113 (48%), Gaps = 8/113 (7%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPR---LLLSLG-DVQVI  64
            +V  G L K+ SG      K W+ RYF LT+N L Y T    + +   +L + G DV  I
Sbjct  15   VVKAGVLFKKGSGGGLLKRKNWKPRYFELTQNALRYFTFQDGEVKGEIMLKTCGEDVLEI  74

Query  65   DDQNQVRHPGN----FVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYN  113
               + ++  G+    +   +  PSRRL ++A TE E   WV  L A+     N
Sbjct  75   MPADSMKTGGSASTIWRIAINAPSRRLLIAAGTEHEMNDWVDALLAVFHANTN  127

>H310_01413
Length=438

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 74/170 (44%), Gaps = 25/170 (15%)

Query  255  LGYVQGMSYLAATLCF--HMDSFTAFKALVALMSSSLLFDMFR----LEATRTFHYIEVY  308
            +GY QGM Y+A+ L F    D   AF+ L  LM +  L  ++     L   R +      
Sbjct  236  IGYCQGMDYVASILLFGSKWDCSYAFRLLCVLMETYDLKSIYSPGLPLLNARFYQ----L  291

Query  309  NQILEHELPALAAHFQEQGIDAQMYAVDWSLPL---------DLALRLWDVYVLLGTPFF  359
            ++++   L  L  H     I   +YA  W L L          + LR +D++   G   F
Sbjct  292  DELVHVHLRDLHDHLVHHQIHPNVYASGWFLTLFANFHSLAPRVVLRFFDLFFATGWKAF  351

Query  360  FQASMGLLTLFQDSLLEMDAGD-IMRLLHN-----FPKTTSSCQLFEAIS  403
            F+ ++ LL++ +  LL     D ++ LLH       P T SS   F A++
Sbjct  352  FRVALALLSMAKRMLLHAHHTDALLTLLHTRLFDLVPDTDSSIHTFFALA  401

>PPTG_00816
Length=410

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 84/191 (44%), Gaps = 29/191 (15%)

Query  249  MLVAHDLGYVQGMSYLAATLC--FHMDSFTAFKALVALMSSSLLFDMFRLEATRT-FHYI  305
            +++   +GY QGM+ +AA L     M+S  AF+  +AL     L D++R +       Y 
Sbjct  194  LMLKPQIGYCQGMTSVAAVLVQESKMNSEMAFRLFLALSEKYRLDDVYRPDMKDVNLRYF  253

Query  306  EVYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPLDLALRLW---------DVYVLLGT  356
            ++ ++ L   LP L AH  ++ I    YA  W L L    RL+         D++   G 
Sbjct  254  QL-DEALRLHLPRLHAHLSDRDIHPSTYASCWILTLFTECRLFPHRYVIAFLDLFFEFGW  312

Query  357  PFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSCQLFEAISSNP--LETMAARG  414
              FFQ  + + ++ +  +L      ++R L             E IS NP  L + A++ 
Sbjct  313  KVFFQTCLAVFSIIE--VLYALCNHLIRFLR------------ETISLNPCRLHSYASQH  358

Query  415  KQSVFAAFNKL  425
             ++    + KL
Sbjct  359  LKTSSPTYRKL  369

>H257_16760
Length=139

 Score = 47.0 bits (110),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 8/107 (7%)

Query  10   VLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTY-STKSG-RKPRLLLSLGD-VQVIDD  66
            V QG L+K+ +G   K  K W+ RYF L   EL Y  T SG +K  + LS  D V+++  
Sbjct  10   VKQGVLYKRGAGGFLKR-KNWKRRYFQLNDGELRYYDTTSGVQKGVVRLSTNDFVEIMPR  68

Query  67   ---QNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSEL-RALLA  109
               +        +   + TPSRR FLSA+TE +   W   + RAL A
Sbjct  69   DCYKTGTSASTEWRLAVNTPSRRFFLSASTEYDMYQWADAITRALPA  115

>CCI41145
Length=1048

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/175 (26%), Positives = 71/175 (41%), Gaps = 44/175 (25%)

Query  254  DLGYVQGMSYLAATLCFHMDSF---------------------------TAFKALVALMS  286
            ++GY QGM Y+AA   F +D                             +AF  LV L  
Sbjct  357  NVGYCQGMDYIAA---FVIDIVKESTSLASETTPSANVSLQAATDEEVESAFWILVCLFE  413

Query  287  SSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW---------  337
               L DMF     +   +  ++ ++ E  +P LA HF E+ I  +M+ V W         
Sbjct  414  QYGLQDMFSPGLHQLNSHCYIFKRLFELTMPTLAQHFDEENIMVEMFVVGWFQTIFLYLN  473

Query  338  SLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDS--LLEMDAGD-IMRLLHNF  389
             LP     R+WD++  L    +   S   L LFQ +   +E ++ D ++R  + F
Sbjct  474  VLPRKTLTRIWDIF--LWEKNWKVISRATLALFQVAAVFVEKESIDCVIRFFNTF  526

>PPTG_19631
Length=122

 Score = 46.6 bits (109),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 29/104 (28%), Positives = 46/104 (44%), Gaps = 10/104 (10%)

Query  14   YLHKQASGPS--------SKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVID  65
            Y H   SGP         S  LK WR RYF+L  N+L +    G     L+ L D   + 
Sbjct  5    YSHCDLSGPDFEGELTKRSVWLKEWRKRYFVLKGNKLYFCRAQGEPAHGLIDLADCLTVK  64

Query  66   DQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSEL-RALL  108
               + +    F F + TP    ++ A  E+++  W+  + RA++
Sbjct  65   SAEE-KTNKRFCFEVATPDSTFYMYAENEKQKDEWIGAIGRAIV  107

>PYU1_G014719
Length=145

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 8/106 (8%)

Query  7    HQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYST--KSGRKPRLLLSLGDVQVI  64
             Q++  G L K+ SG      K W+ RYF+LT ++L Y T      K  + LS  D  +I
Sbjct  4    QQILRTGVLFKKGSGMGPFGRKNWKPRYFVLTPSKLKYFTFEDGDLKGEVDLSGCDDNMI  63

Query  65   D----DQNQVRHPGNFVF--VLQTPSRRLFLSATTEQERRSWVSEL  104
            +    D  +     + ++   +  P RRL ++A TE E   WV +L
Sbjct  64   EVMPMDAMKTGSSASTIWRVAINAPERRLLVAAGTEMEMNDWVDKL  109

>H310_00199
Length=226

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 70/154 (45%), Gaps = 15/154 (10%)

Query  8    QLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLL---SLGDVQVI  64
            +++++G L K+  G    H K W++R+ +LT + L Y     RK  L L   S   +Q +
Sbjct  36   EVLMKGMLFKRGQG-GWFHRKTWKVRHVVLTSSVLRYYELDVRKGELDLRDCSPSSIQAL  94

Query  65   --DDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPS------H  116
              D      +   + F +QTP RR+  SA +E E   WV  L   LA   N         
Sbjct  95   PRDATFTGTYGTLWRFAVQTPKRRMLFSAPSEMEMNEWVRHLHLALAIQRNDFSTIQRLS  154

Query  117  SEPTVFGRKLSDSV---KTSTVGTTLHDRRKAAR  147
            S PT +  ++  S    K S  GT L +  KAA+
Sbjct  155  SIPTRYSVRVPTSPRGRKISIAGTPLPESPKAAQ  188

>H257_04622
Length=512

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 63/146 (43%), Gaps = 12/146 (8%)

Query  246  IAEMLVAH-----DLGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATR  300
            +  +LVA+     ++GY Q M++L   L        AF  L  LM   L  + +      
Sbjct  275  LTNVLVAYSIHNTEVGYCQSMNFLVGILLLFHSEADAFWLLCVLMDQYLPTENYSRSMLG  334

Query  301  TFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVL  353
            +     V+ +++   LP +A      G+  ++  + W       +LPLD ALR+WD   L
Sbjct  335  SQVDQVVFKRLVTLHLPDVARTLDAAGMSIELVTLQWFLCVFVCTLPLDTALRVWDYMFL  394

Query  354  LGTPFFFQASMGLLTLFQDSLLEMDA  379
             G    F  ++G+L   Q  ++   A
Sbjct  395  QGEEVLFAVALGILKAAQAKIMAASA  420

>H310_14230
Length=151

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 48/97 (49%), Gaps = 5/97 (5%)

Query  9   LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD-----VQV  63
           L+ +G ++KQ SG      K W+ RYF+LT+++L Y  +     +  L L +     ++ 
Sbjct  3   LLKRGCMYKQGSGAGFFQRKNWKKRYFVLTQDDLRYFDEEQGVLKGCLDLSECTKESLET  62

Query  64  IDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSW  100
           +        P ++   ++TPSRR  +S  TE +   W
Sbjct  63  LPSDVVNNTPTSWCLAIRTPSRRFIMSFATEADMHGW  99

>SDRG_05608
Length=121

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/83 (27%), Positives = 43/83 (52%), Gaps = 2/83 (2%)

Query  27   LKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRHPGNFVFVLQTPSRR  86
            LK WR RYF+L  N+L +    G  P  ++ L +   +    + +    F F + TP   
Sbjct  23   LKEWRARYFVLKGNKLYFCRAQGEAPHGMIDLSECLTVKSAEE-KTNKRFCFEIATPEST  81

Query  87   LFLSATTEQERRSWVSEL-RALL  108
             ++ A +E+++ +W+  + RA++
Sbjct  82   YYMHAESEEKKDAWIGAIGRAIV  104

>PHYSO_470533
Length=1084

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 74/353 (21%), Positives = 132/353 (37%), Gaps = 70/353 (20%)

Query  979   RTWALTRVEEWLDARF---------NVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLA  1029
             R W   R ++W+              + N  V  +VG  G+GK++    + Q     + A
Sbjct  472   REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTC-PEIAA  530

Query  1030  AHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFL----LAAK  1085
              H  + + +     R  +LS  +QL   LP + + L        LEE  P      L ++
Sbjct  531   FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVSQ  587

Query  1086  VFVDPLNAVEEP--IHATFMLVEGLD--------------QCSAGPNGRNELLEFLSQII  1129
             + + PLNA+  P    +  +L++G++                S G      L+  L  + 
Sbjct  588   LLIGPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALA  647

Query  1130  PQLPSWVGFMISSKP----FSKFAKRLPVSSVLD-FSAKNGAFVSDVSSL---------V  1175
              +LP WV  ++ S+      SK     P   ++D F  +N   +    +L         V
Sbjct  648   SRLPDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEV  707

Query  1176  D---------DIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAV  1226
             D         D+  N  +    +   ++ R+S G F Y     QA++         EG +
Sbjct  708   DFAKASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT---------EGRL  758

Query  1227  PLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPV  1279
              L  L +LP  +     + F   F         + +P+L+++  A    Y P+
Sbjct  759   RLHELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLEVLCAA----YEPL  806

>PYVX_15906
Length=123

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/104 (28%), Positives = 47/104 (45%), Gaps = 10/104 (10%)

Query  14   YLHKQASGPS--------SKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVID  65
            YL+   S P         S  LK WR RYF+L  N+L +    G     L+ L D   + 
Sbjct  5    YLNADISAPDYEGELTKRSVWLKEWRKRYFVLKGNKLYFCRARGEPAHGLIDLADCLTVK  64

Query  66   DQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSEL-RALL  108
               + +    F F + TP    ++ A T+Q++  W+  + RA++
Sbjct  65   SAEE-KTNKRFCFEVATPDSTYYMYAETDQQKDEWIGAIGRAIV  107

>SDRG_15788
Length=293

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 8/108 (7%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPR---LLLSLG-DVQVI  64
            +V  G L K+ SG      K W+ RYF LT+N L Y T    + +   +L + G DV  I
Sbjct  14   VVKAGVLFKKGSGGGLLKRKNWKPRYFELTQNALRYFTFQDGEVKGEIMLKTCGEDVLEI  73

Query  65   DDQNQVRHPGN----FVFVLQTPSRRLFLSATTEQERRSWVSELRALL  108
               + ++  G+    +   +  PSRRL ++A TE E   WV  L A+ 
Sbjct  74   MPADSMKTGGSASTIWRIAINAPSRRLLIAAGTEHEMNDWVDALLAVF  121

>SPRG_02502
Length=121

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/83 (27%), Positives = 43/83 (52%), Gaps = 2/83 (2%)

Query  27   LKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRHPGNFVFVLQTPSRR  86
            LK WR RYF+L  N+L +    G  P  ++ L +   +    + +    F F + TP   
Sbjct  23   LKEWRARYFVLKGNKLYFCRAQGEAPHGVIDLSECLTVKSAEE-KTNKRFCFEIATPEST  81

Query  87   LFLSATTEQERRSWVSEL-RALL  108
             ++ A +E+++ +W+  + RA++
Sbjct  82   YYMHAESEEKKDAWIGAIGRAIV  104

>SPRG_06232
Length=321

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 83/181 (46%), Gaps = 29/181 (16%)

Query  255  LGYVQGMSYLAATLCF--HMDSFTAFKALVALMSSSLLFDMFRLEA------TRTFHYIE  306
            +GY QGM Y+AA L +  + +   AF+ LVALM     +D+  + A         F+ ++
Sbjct  110  IGYCQGMDYIAAILLYGSNWECHHAFRLLVALMDK---YDLGGVCAPGLPLLNLKFYQLD  166

Query  307  VYNQILEHELPALAAHFQEQGIDAQMYAVDWSLPL---------DLALRLWDVYVLLGTP  357
               +++   LP +  H    GI    YA  W L L          L L  +D +   G  
Sbjct  167  ---ELVHFHLPDVHQHLSLHGIHPNTYASGWVLSLFANFKTLHPGLVLSFFDGFFAKGWK  223

Query  358  FFFQASMGLLTLFQDSLLEMDA-GDIMRLLHN-----FPKTTSSCQLFEAISSNPLETMA  411
             +++ ++ +L   +  LL+      +M LL++     FP++   C+ F A++S+   T A
Sbjct  224  SWYRVALAILATARQRLLQAHTPTALMELLNHDLASLFPESDDKCREFFALTSHFKVTNA  283

Query  412  A  412
            A
Sbjct  284  A  284

>HYAP_01151
Length=250

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/153 (25%), Positives = 65/153 (42%), Gaps = 21/153 (14%)

Query  255  LGYVQGMSYLAATLCF----HMDSFTAFKALVALMSSSLLFD--MFRLEATRTFHYIEVY  308
            +GY QGM +L   L        D F  F       ++  L++  M  L+      Y+  +
Sbjct  75   VGYCQGMGFLVRLLAEVADDEADIFWLFVGFSEPENNQNLYEPGMIVLQP-----YLSKF  129

Query  309  NQILEHELPALAAHFQEQGIDAQMYAVDWSLPL---------DLALRLWDVYVLLGTPFF  359
              +    +P L +HF  +G+    +   W L            L +RL D++++ G    
Sbjct  130  ELLFSTHMPKLYSHFMAEGVHVATFCTRWFLTFFSSFETLAPTLVIRLLDIFIIDGWRIM  189

Query  360  FQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKT  392
            F  S+ +L   Q  LL+ D   I+R+L  FP++
Sbjct  190  FSVSLVILDELQQQLLKHDMEGILRILQ-FPRS  221

>PYVX_22623
Length=779

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/194 (24%), Positives = 78/194 (40%), Gaps = 28/194 (14%)

Query  200  GIPKELRGR-------VAEGS---------EVPLTTDINDRNRARRSSAVLPVQNMLKDA  243
            G+P+E   R       +A G          +V  T  I +RN+            +L+  
Sbjct  89   GLPREFMARHREIYHLIAHGEYQRSGSIQRDVTRTFSIFERNKLPDYDLTAQHGALLRVL  148

Query  244  VGIAEMLVAHDLGYVQGMSYLAATLCFH-MDSFTAFKALVALMSSSLLFDMFRLEATRTF  302
              IAE   A D GY QGM+++AA      M+   A+   + L+       +F   +T   
Sbjct  149  TAIAE---AED-GYCQGMNFIAALFLVEGMEEADAYPLFLYLLRKRFFARIFHRSSTFLD  204

Query  303  HYIEVYNQILEHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLG  355
             Y+  +  +    LP L  H   QG    M+ ++W       S  LDLA  ++D++ +  
Sbjct  205  DYMHQFELMFRRTLPDLFEHMYAQGFSLPMFGIEWFTTMFSLSTRLDLACAVFDMFFVGI  264

Query  356  TPFFFQASMGLLTL  369
               F +  + +L +
Sbjct  265  QDIFLRVGLAILKV  278

>SPRG_10648
Length=4924

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 60/115 (52%), Gaps = 15/115 (13%)

Query  2    TIAPPHQLVL--QGYLHKQASGPSSKHLKLWRIRYFLLTKNELTY-STKSGRKPRLLLSL  58
            T+ P H  ++  +GYL K++ G  +K +  WR RYF L   EL Y  +     PR  + L
Sbjct  4    TMLPSHGTIILKEGYLIKRSKG--NKLVSNWRRRYFRLQPGELLYFESPQEVAPRRRIPL  61

Query  59   G---DVQVIDDQNQVRHPGNFVFVLQ-TP-SRRLFLSATTEQERRSWVSELRALL  108
            G    V + +DQ       N  F+LQ TP S + ++ A TE E+++WV  +  +L
Sbjct  62   GLDSTVSLTNDQGY-----NLCFMLQSTPTSDKFYVQAATETEKKAWVDAIFEVL  111

>PYIW_15717
Length=1121

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 91/438 (21%), Positives = 166/438 (38%), Gaps = 105/438 (24%)

Query  979   RTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  1038
             R W   ++E W+ +        V  V G  G+GK+A    + Q     + A H    + +
Sbjct  525   REWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMVQLIP-EIAAFHFALQEDE  580

Query  1039  SKSTPRNVLLSFVHQLVDNLPPFKNQL-ARLNLKYVLEESDPFLLAAKVFVDPLNAVEEP  1097
                  R  +LS  +QL   LP + + L +R  L+ ++  S+   L  ++ V+PLN +  P
Sbjct  581   QTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARP  640

Query  1098  IHAT---FMLVEGLDQC---------------------SAGPNGRNE---------LLEF  1124
               AT    +L++GL+                       S+G N  N          L+  
Sbjct  641   QTATKPLVLLIDGLEHLVSDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLVSA  700

Query  1125  LSQIIPQLPSWVGFMISSKP----FSKFAKRLPVSSVLD-FSAKNGAFVSDVSSLVDDI-  1178
             L  ++ +LP WV  ++ S+      +K     P + VLD F  +N     D+ S V+ I 
Sbjct  701   LPSLVARLPKWVRVVLLSRKDPAIIAKLQGHTP-NVVLDRFERENQ---QDIKSYVEKIL  756

Query  1179  -----------------------ARNFS------------------DEDSAEAKRVLKRK  1197
                                     RN S                   + S E   ++ ++
Sbjct  757   GEPSPQQVGVYGSPGQPPAPMLMPRNRSPSISTLPGSNAISAGVQTSKLSPEQVNLIVKR  816

Query  1198  SGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARI  1257
             S G F Y     Q++         +E  +P+  L+ LP  +   + + F+  F + + + 
Sbjct  817   SEGLFLYAVNIVQSI---------EERRLPVSQLESLPIGMGGYFRQFFDSHFDEQQYK-  866

Query  1258  WAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEV-KHGAYRLE  1316
                 +P+L+++  +    + P +         ++  D + +  SF  L+ V   G  R  
Sbjct  867   -DSIRPVLEVLCAS----FEPFSLATIASILSWSVYDQQEIAASFGSLLFVGADGNIRPF  921

Query  1317  SSALCSWLSDPARSEEQF  1334
              S++  W+ D A + E F
Sbjct  922   HSSVLDWVQDLATAGEYF  939

>SDRG_15787
Length=133

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 58/126 (46%), Gaps = 14/126 (11%)

Query  10   VLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQ-------  62
            +  G L K+ +G   +  K W+ RYF L+ + L Y T  G   +  + L D+        
Sbjct  3    IKSGVLFKRGAGGLFQR-KNWKPRYFELSDHALRYYTHQGGACKGQVCLDDLDSSALELM  61

Query  63   -VIDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEPTV  121
             V   +        +   +QTP+RR  L+A T +E   W++ L  +LA     SH++PT 
Sbjct  62   PVDLPKTGSSASTGWRIAIQTPTRRFVLAAATHREMTEWMAALLTILA-----SHAKPTK  116

Query  122  FGRKLS  127
              RK S
Sbjct  117  ATRKSS  122

>PYU1_G012858
Length=421

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 11/93 (12%)

Query  13   GYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRH  72
            G+L K+      +H K W+ RYF+L +N L+Y+ + G       SLG  +VI  +  +  
Sbjct  128  GWLEKEG-----QHFKTWKKRYFMLEENVLSYTAQIGSP-----SLGKARVIAARRDLSR  177

Query  73   PGNFVFVLQTPSRRLFLSATTEQERRSWVSELR  105
            P   V +++   R L +   TE E   W   +R
Sbjct  178  PNTLVVMMEG-GRELRIGGKTEAEIHEWHKAMR  209

>PPTG_01131
Length=430

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 65/140 (46%), Gaps = 15/140 (11%)

Query  257  YVQGMSYLAATLCFHM---DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            YVQGM+ L A L + +   D++  F  L+       +    +    +    ++   Q L+
Sbjct  181  YVQGMNVLCAPLLYVLPEPDAYHTFCQLIVRHCPHYMAPQLK-GVEKGCALVDKCLQTLD  239

Query  314  HELPALAAHFQEQGIDAQMYAVDWSL-------PLDLALRLWDVYVLLGTPFFFQASMGL  366
               P L  H   +GI A++YA+   L       PL   LR+WDV   +G  F    ++  
Sbjct  240  ---PDLYQHLSSRGITARIYALPLILSLFACVPPLHELLRVWDVLFAVGVHFVVVLAVAH  296

Query  367  LTLFQDSLLEMDAGDIMRLL  386
              L ++ LL+MD  D+M++L
Sbjct  297  TVLLREQLLKMDM-DLMKVL  315

>H257_18862
Length=151

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 45/98 (46%), Gaps = 5/98 (5%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD-----VQV  63
            L+ +G + KQ SG      + W+ RYF LT+ +L Y        +  L L       +++
Sbjct  3    LIKRGSMFKQGSGDGLFQRRNWKKRYFELTQEDLRYFQHEHGPMKGCLDLSSCTKDSLEM  62

Query  64   IDDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWV  101
            +  +     P  +   + TPSRR F+S  +E E  +W 
Sbjct  63   VPTKMSKDPPTTWCLAITTPSRRFFMSMASETEMHAWA  100

>H257_06670
Length=228

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 52/107 (49%), Gaps = 6/107 (6%)

Query  8    QLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLL---SLGDVQVI  64
            + +++G L K+  G    H K W++R+ +LT + L Y     RK  L L   S   +QV+
Sbjct  40   EALMKGMLFKRGQG-GLFHRKTWKLRHVVLTSSTLRYYELDVRKGELDLRDCSPKSIQVL  98

Query  65   D-DQNQVRHPGN-FVFVLQTPSRRLFLSATTEQERRSWVSELRALLA  109
              D       G  + F +QTP RR+  SA +E E   WV  L   LA
Sbjct  99   PRDATYTGTNGTLWRFAVQTPKRRMLFSAASEMEMNVWVRHLHLALA  145

>PYIW_15232
Length=500

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 63/128 (49%), Gaps = 18/128 (14%)

Query  276  TAFKALVALMSSSLLFDMFRLEATRTFHYIEVY----NQILEHELPALAAHFQEQGIDAQ  331
            TAF  LV+L  +  L  MF    +   H ++V+     ++ E  LPALA HF+ + + A+
Sbjct  325  TAFWILVSLFENYGLRQMF----SPGLHRLQVHCFQLQRLFELTLPALAEHFEREKVVAE  380

Query  332  MYAVDWSLPLDLAL---------RLWDVYVLLGT-PFFFQASMGLLTLFQDSLLEMDAGD  381
            M+ V W   L L L         R+WD+++L        + ++ +L L +  ++     +
Sbjct  381  MFTVGWFQTLFLYLNVLPRATLDRIWDIFLLENNWKIMLRVAVAILQLSEPHVVGKPIDE  440

Query  382  IMRLLHNF  389
            +M+ L+ F
Sbjct  441  MMQFLNTF  448

>PITG_02531
Length=1100

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 81/186 (44%), Gaps = 15/186 (8%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            LGY QG++Y+ A    ++    AF  LV ++   L+ D +            V+  ++  
Sbjct  321  LGYCQGLNYIVARSLQYLGEEEAFYLLVVIV--RLVPDDYYTTMLGLAVDQHVFADLVRL  378

Query  315  ELPALAAHFQE---QGIDAQMYAVDWSLPL-------DLALRLWDVYVLLGTPFFFQASM  364
            + P ++ H  E    G++  +   +W L L        +  ++WD   L G    F+ ++
Sbjct  379  QYPEISEHLSELGGSGMELSLACTEWFLTLFASPCERGVTFQIWDAIFLQGDEVLFRVAL  438

Query  365  GLLTLFQDSLLEMDA-GDIMRLLHNFPKTTSSCQLFEAISSNPLETMAARGKQSVFAAFN  423
             LL   + +LL  +  GD+++ L+   +          +S N  +    RG+   F A +
Sbjct  439  ALLQPAKTALLACNNYGDMLKHLNELGRGELDALELMQVSKN--QDCVIRGRIEDFRAHH  496

Query  424  KLQVIA  429
            +LQ+ +
Sbjct  497  RLQLAS  502

>PYVX_17141
Length=304

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 60/135 (44%), Gaps = 12/135 (9%)

Query  255  LGYVQGMSYLAATLCFH--MDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQIL  312
            +GY QGM+YLAATL +   +++ TAF+  V L     +  +F  E           ++ L
Sbjct  136  IGYCQGMTYLAATLVYESKLNNETAFRLFVGLTEKYKMDHVFGPEMKDINLRFFQLDEAL  195

Query  313  EHELPALAAHFQEQGIDAQMYAVDWS---------LPLDLALRLWDVYVLLGTPFFFQAS  363
               LP L AH  +  +    YA  W          LP    L   D++  +G   FFQ  
Sbjct  196  RLHLPRLHAHLSDHDVHPATYASSWILTLFTDGKLLPHRTVLVFLDMFFDVGWKAFFQIC  255

Query  364  MGLLTLFQDSLLEMD  378
            + + ++ +   LE+D
Sbjct  256  LAIFSILEGK-LEVD  269

>PHALS_01288
Length=386

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 65/140 (46%), Gaps = 15/140 (11%)

Query  257  YVQGMSYLAATLCFHM---DSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            YVQGM+ L A L + +   D++  F  L+       +    +    +    ++   Q L+
Sbjct  146  YVQGMNVLCAPLLYVLPEPDAYHMFCQLIVRHCPHYMAPQLK-GVEKGCALVDKCLQTLD  204

Query  314  HELPALAAHFQEQGIDAQMYAVDWSL-------PLDLALRLWDVYVLLGTPFFFQASMGL  366
               P L  H   +GI AQ+YA+   L       PL   LR+WDV   +G  F    ++  
Sbjct  205  ---PDLYRHLASRGITAQIYALPLILSLFACVPPLHELLRVWDVLFAVGVHFVVILAVAH  261

Query  367  LTLFQDSLLEMDAGDIMRLL  386
              L ++ LL++D  D+M++L
Sbjct  262  TVLLREQLLKLDM-DLMKVL  280

>SDRG_15784
Length=160

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 53/120 (44%), Gaps = 16/120 (13%)

Query  9    LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYST-KSGRKPRLLLSLGDVQVIDDQ  67
             V  GYL K+ SG      K W+ RYF LT + L YS  +   K R  ++L  +     +
Sbjct  3    FVKSGYLLKEGSGQGLFQKKNWKRRYFELTSSTLRYSVLEQDAKARGQINLDGLSGKAIE  62

Query  68   NQVRHPG--------NFVFVLQTPSRRLFLSATTEQERRSWVSELRALLAGGYNPSHSEP  119
                  G         + FV+ T  RRL ++ ++EQE R WV  L  +L       H EP
Sbjct  63   TLAPETGADASLPTSQWRFVVATHDRRLVIATSSEQEMRDWVDALLRVL-------HQEP  115

>CCA19118
Length=125

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 8/89 (9%)

Query  24   SKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD---VQVIDDQNQVRHPGNFVFVL  80
            S  +K WR RYF+L  N+L +S      P   + L D   V+  +D+   R    F F +
Sbjct  27   SMWMKEWRKRYFILKGNKLYFSKSKNDAPHGFIDLADCLTVKSAEDKTNKR----FCFEV  82

Query  81   QTPSRRLFLSATTEQERRSWVSEL-RALL  108
             TP    ++ A  E+++  W+  + RA++
Sbjct  83   ATPDTTYYMYAQNEEQKDEWIGAIGRAIV  111

>SDRG_15911
Length=567

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 74/168 (44%), Gaps = 9/168 (5%)

Query  256  GYVQGMSYLAAT-LCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            GY QGM+++AA  L   +    A+   V L+    +   ++  +     Y++ +   +  
Sbjct  105  GYCQGMNFIAAVFLEAGLPEADAYATFVYLLQHKHMSQFYKDSSVFLNEYLQRFQARVAE  164

Query  315  ELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLL  367
             LP LAA     G D  +Y ++W       S  ++L+  + D+ +   T   F+  + LL
Sbjct  165  LLPELAAKLDAVGFDVYLYGIEWFTTMFACSSKIELSHAVLDLVLADVTDVMFRIGIALL  224

Query  368  TLFQDSLLEMDAGDIMRLLHNFPKTTSSCQL-FEAISSNPLETMAARG  414
               +  LL M   D++R   +  K   + Q+   A+S  P+ +  A G
Sbjct  225  QSVEAQLLSMSFDDLLRDFKSVTKHVDTYQIVMAALSVPPVPSAVAYG  272

>PYIR_21523
Length=152

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 50/101 (50%), Gaps = 13/101 (13%)

Query  11   LQGYLHKQASGPSSKHL--KLWRIRYFLLTKNELTY----STKSGRKPRLLLSLGDVQVI  64
            + GYLHK  S   ++ L    W  RYF L   EL Y    ++    K   LLS+  ++  
Sbjct  13   ISGYLHKMKS---TERLLASQWNKRYFTLEGKELKYYQHEASSEASKVIDLLSIESIRRF  69

Query  65   DDQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELR  105
            ++ +     G F FVL+TP R  FL A ++ + + WV  L+
Sbjct  70   ENGDH----GVFSFVLKTPDRSYFLRAESKGDMKRWVRGLK  106

>PYAP_16997
Length=1018

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 51/110 (46%), Gaps = 17/110 (15%)

Query  6    PHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTY----STKSGRKPRLLLSLGDV  61
            P  +   GYL KQ         K W+ RYF+L  N +TY     T +  K +   +L +V
Sbjct  397  PEPIACSGYLTKQG-----HKRKSWKKRYFVLRGNSITYFTDFDTANSNKGK---ALAEV  448

Query  62   QVIDDQNQVRHPGNFVFVL--QTPSRRLFLSATTEQERRSWVSELRALLA  109
             V D Q     P  F+F+   Q P    ++ A  E+ER  W++ LR L A
Sbjct  449  IVEDVQRWDGEPFGFMFMTSEQVP---YYVYADNERERGKWMNALRKLTA  495

 Score = 36.6 bits (83),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 45/103 (44%), Gaps = 10/103 (10%)

Query  6    PHQLVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVID  65
            P ++  +G+L K+           W++RYF+L  N L Y +   +  R    +  V+ + 
Sbjct  202  PGEIACEGFLTKRG-----HVFTNWKMRYFVLRGNVLEYFSGDDKSKRYGSVI--VEKVA  254

Query  66   DQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELRALL  108
              +   H   F    Q P    ++ A++E ER  W+  LR  +
Sbjct  255  PWSGEAHGFMFYTTKQVP---YYVYASSEAERAKWLRALRDFM  294

>PHYCA_510506
Length=121

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query  27   LKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRHPGNFVFVLQTPSRR  86
            LK WR RYF+L  N+L +    G     L+ L D   +    + +    F F + TP   
Sbjct  26   LKEWRKRYFVLKGNKLYFCRAQGEPAHGLIDLADCLTVKSAEE-KTNKRFCFEVATPDST  84

Query  87   LFLSATTEQERRSWVSEL-RALL  108
             ++ A  E+++  W+  + RA++
Sbjct  85   FYMYAENEKQKDEWIGAIGRAIV  107

>PHYSO_289146
Length=122

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query  27   LKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRHPGNFVFVLQTPSRR  86
            LK WR RYF+L  N+L +    G     L+ L D   +    + +    F F + TP   
Sbjct  26   LKEWRKRYFVLKGNKLYFCRAQGEPAHGLIDLADCLTVKSAEE-KTNKRFCFEVATPDST  84

Query  87   LFLSATTEQERRSWVSEL-RALL  108
             ++ A  E+++  W+  + RA++
Sbjct  85   FYMYAENEKQKDEWIGAIGRAIV  107

>PHALS_07062
Length=122

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query  27   LKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRHPGNFVFVLQTPSRR  86
            LK WR RYF+L  N+L +    G     L+ L D   +    + +    F F + TP   
Sbjct  26   LKEWRKRYFVLKGNKLYFCRAKGEPAHGLIDLADCLTVKSAEE-KTNKRFCFEVATPDST  84

Query  87   LFLSATTEQERRSWVSEL-RALL  108
             ++ A  E+++  W+  + RA++
Sbjct  85   FYMYAENEKQKDEWIGAIGRAIV  107

>PYAR_21254
Length=1035

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 65/157 (41%), Gaps = 23/157 (15%)

Query  257  YVQGMSYLAATLCFHM---DSFTAFKALVALMSSSLLFDMFRLEATRTFHY-IEVYNQIL  312
            Y  GM  + A L   +   D+F AF+ L+      +L   +  E+   F     V  ++L
Sbjct  159  YCHGMVEICAVLSTFLSEEDAFWAFRLLL-----EVLLPKYHEESIVDFQIDCLVLQELL  213

Query  313  EHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVL------LGTPFF  359
            E    ALA H    G+  Q+    W       S+P DL  RL+DV ++      L     
Sbjct  214  EQHDRALADHLATTGVTIQVLCTKWFFSFFAESMPFDLVCRLYDVLLVDICSRKLSAKII  273

Query  360  FQASMGLLTLFQDSLLEM-DAGDIMRLLHNFPKTTSS  395
            F  +  +     + LLEM D   I+ ++  F  TT S
Sbjct  274  FSTATAVFLYLSEMLLEMHDPSVIVDVMCEFCLTTLS  310

 Score = 42.4 bits (98),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 75/176 (43%), Gaps = 22/176 (13%)

Query  255  LGYVQGMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHY-IEVYNQILE  313
            +GY QGM+ + A L  ++D  TA  AL  L+ S L    + +++    H    V + +L 
Sbjct  618  VGYCQGMNEILAVLLQYLDERTALLALSLLIESVL--PAYHVDSMIGLHTDCAVMDTLLR  675

Query  314  HELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLL------GTPFFF  360
               P L A  Q  G++ ++    W       SLP    L++ D+ +        G+    
Sbjct  676  QNDPELHAQIQNTGLNMEILCTKWLVTCFLTSLPPFAGLKVMDMLLARVNEKQSGSRVLL  735

Query  361  QASMGLLTLFQDSLLEM-DAGDIMRLLHNF-----PKTTSSCQLFEAISSNPLETM  410
               M +    + +LL   DAG+++  ++ +      KTT     F A   + ++ +
Sbjct  736  GVGMAIFFTLRGALLNAKDAGEVLMAINEYFAQEMTKTTVEMDAFLAFGHHVIDQL  791

>PITG_13665
Length=122

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query  27   LKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRHPGNFVFVLQTPSRR  86
            LK WR RYF+L  N+L +    G     L+ L D   +    + +    F F + TP   
Sbjct  26   LKEWRKRYFVLKGNKLYFCRAQGEPAHGLIDLADCLTVKSAEE-KTNKRFCFEVATPDST  84

Query  87   LFLSATTEQERRSWVSEL-RALL  108
             ++ A  E+++  W+  + RA++
Sbjct  85   FYMYAENEKQKDEWIGAIGRAIV  107

>PITG_17250
Length=1046

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 79/348 (23%), Positives = 135/348 (39%), Gaps = 68/348 (20%)

Query  979   RTWALTRVEEWLDARF----NVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQ  1034
             R W     + W+         + N  V  V+G  G+GKS+    + Q     + A H   
Sbjct  450   REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQAC-PEIAAFHFAT  508

Query  1035  FDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFL----LAAKVFVDP  1090
              + +     R  +LS  +QL   LP + + L        LEE  P      L   + + P
Sbjct  509   QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLIGP  565

Query  1091  LNAVEEP--IHATFMLVEGLD-----QCSAGPNG-----RNE--LLEFLSQIIPQLPSWV  1136
             LNA+  P    +  +L++G++      C+    G     ++E  L+  L  ++ +LP WV
Sbjct  566   LNAIARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWV  625

Query  1137  GFMISSKP----FSKFAKRLPVSSVLD-FSAKNGA----FVSDVSSLVDDIARNF-----  1182
               ++ S+      SK     P   +++ F  +N      F+S   S ++    +F     
Sbjct  626   RIVLLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASA  685

Query  1183  ---SDEDSAE-----AKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDL  1234
                S  D+ E        ++ R+S G F Y     QA+S         EG + L  L +L
Sbjct  686   QIGSGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS---------EGRLRLHELAEL  736

Query  1235  PQSLFDIYTEIFEDKFGQG---RARIWAKAKPLLQLIVGAAAGPYSPV  1279
             P  +     + F   F      + RI    +P+L++   A    Y P+
Sbjct  737   PVGMGAYLHQFFASHFADHDVYKHRI----RPVLEVCCAA----YEPL  776

>PHYKE_7347
Length=122

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query  27   LKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRHPGNFVFVLQTPSRR  86
            LK WR RYF+L  N+L +    G     L+ L D   +    + +    F F + TP   
Sbjct  26   LKEWRKRYFVLKGNKLYFCRAQGEPAHGLIDLADCLTVKSAEE-KTNKRFCFEVATPDST  84

Query  87   LFLSATTEQERRSWVSEL-RALL  108
             ++ A  E+++  W+  + RA++
Sbjct  85   FYMYAENEKQKDEWIGAIGRAIV  107

>PYAR_23932
Length=161

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query  11   LQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTK--SGRKPRL--LLSLGDVQVIDD  66
            + GYL K  S      +  W  R+F L   EL Y T   SG   ++  LL +  ++  ++
Sbjct  13   ISGYLFKMKSSEPRLLMSQWNKRFFALEGRELKYYTSESSGEASKVIDLLRVESIRRFEN  72

Query  67   QNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSELR  105
             +     G + FVL+TP R  FL A ++ + + WV  LR
Sbjct  73   GDH----GVYSFVLKTPERSYFLRAESKGDMKRWVRGLR  107

>PHYRA_86211
Length=303

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/157 (25%), Positives = 70/157 (45%), Gaps = 23/157 (15%)

Query  257  YVQGM---SYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHY-IEVYNQIL  312
            Y  GM     + +T     D+F +F+ ++ ++     FD    E+   FH    V  ++L
Sbjct  135  YCHGMVESCVVISTFLVEEDAFWSFRMMLEVLLPKY-FD----ESVVDFHTDCLVLQELL  189

Query  313  EHELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVL------LGTPFF  359
                PAL+ HF   G+  Q+    W       S+P D+  RL+D+  +      L +   
Sbjct  190  RVHDPALSEHFAVLGVSIQLLCTKWFFSFFAESMPFDVVCRLYDILFVDICSRQLSSKII  249

Query  360  FQASMGLLTLFQDSLLEM-DAGDIMRLLHNFPKTTSS  395
            F  S+ +L     +L+E+ D   ++ +++ F  TT S
Sbjct  250  FSTSLAVLLYLSSALVEIQDVTVVLEVINEFCWTTLS  286

>PYAP_15024
Length=170

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 46/95 (48%), Gaps = 2/95 (2%)

Query  11   LQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYST-KSGRKPRLLLSLGDVQVIDDQNQ  69
            + GYL K  S      +  W  R+F L   +L Y T ++  +P  ++ L  ++ I     
Sbjct  26   ISGYLFKMKSTERRMLMPQWNKRFFALEGRDLKYYTNENSAEPSKVIDLLSIESIRRFEN  85

Query  70   VRHPGNFVFVLQTPSRRLFLSATTEQERRSWVSEL  104
              H G F FVL+TP R  FL A ++ + + WV  L
Sbjct  86   GDH-GVFSFVLKTPERSYFLRAESKGDMKRWVRGL  119

>PYIW_15943
Length=935

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 70/150 (47%), Gaps = 15/150 (10%)

Query  255  LGYVQGMSYLAATLC-FHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            +GY QGM++L   L     +    F   V L    +  +++    T     +  +  ++ 
Sbjct  760  VGYCQGMNFLVRILLEVTENEADVFWLFVGLSEPEINRNLYEPGLTVLQPLLAKFELLVS  819

Query  314  HELPALAAHFQEQGIDAQMYAVDWSLPL---------DLALRLWDVYVLLGTPFFFQASM  364
            + +P L  HFQ +G+    ++  W + +          L LR+ D++V+ G       SM
Sbjct  820  YHMPELFVHFQREGVHVAAFSTRWFMTMFASFETFGPTLVLRVLDLFVIDGWRVLL--SM  877

Query  365  GLLTL--FQDSLLEMDAGDIMRLLHNFPKT  392
            GL+ L   +++L++ D   I+R+L  FP++
Sbjct  878  GLVVLDELRETLVKADLETILRILQ-FPRS  906

>PYU1_G004045
Length=380

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/149 (25%), Positives = 67/149 (45%), Gaps = 15/149 (10%)

Query  255  LGYVQGMSYLAATLC-FHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILE  313
            +GY QGM++L   L     +    F   V L    +  +++          +  +  ++ 
Sbjct  205  VGYCQGMNFLVRVLIEVTENEADVFWLFVGLSEPEINRNLYEPGLVVLQPLLAKFELLVS  264

Query  314  HELPALAAHFQEQGIDAQMYAVDWSLPL---------DLALRLWDVYVLLGTPFFFQASM  364
            + +P L  HFQ +G+ A  +   W + +          L LR+ D++V+ G       SM
Sbjct  265  YHMPELYVHFQREGVHAAAFTTRWFMTMFSSFETFGPTLVLRVLDMFVIDGWRSLL--SM  322

Query  365  GLLTL--FQDSLLEMDAGDIMRLLHNFPK  391
            GL+ L   ++ LL  D  +I+R+L  FP+
Sbjct  323  GLVVLDELREVLLHADLENILRILQ-FPR  350

>H310_01094
Length=121

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 42/83 (51%), Gaps = 2/83 (2%)

Query  27   LKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVIDDQNQVRHPGNFVFVLQTPSRR  86
            LK WR RYF+L  N+L +    G  P  ++ L +   +    + +    + F + TP   
Sbjct  23   LKEWRARYFVLKGNKLYFCRVKGESPHGVIDLSECLTVKSAEE-KTNKRYCFEVATPEST  81

Query  87   LFLSATTEQERRSWVSEL-RALL  108
             ++ A +E+++  W+  + RA++
Sbjct  82   YYMHAESEKQKEEWIGAIGRAIV  104

>SPRG_12221
Length=128

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 46/98 (47%), Gaps = 6/98 (6%)

Query  9   LVLQGYLHKQASGPSSKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGDVQVID---  65
           L+  G L K+ SG        W+ RYF LT+  L+Y +  G   R  + +  V  I+   
Sbjct  2   LIHNGVLFKRGSGHGLFQRTNWKPRYFELTETHLSYYSHQGGALRGHIDVAAVDSIEMMP  61

Query  66  ---DQNQVRHPGNFVFVLQTPSRRLFLSATTEQERRSW  100
               +       N+   + TP+RRL L+A +E + R+W
Sbjct  62  VDAVKTGSSASTNWRLGVCTPTRRLLLAANSEADMRAW  99

>SPRG_01803
Length=570

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 73/168 (43%), Gaps = 9/168 (5%)

Query  256  GYVQGMSYLAAT-LCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEH  314
            GY QGM+++AA  L   +    A+   V L+    +   ++  +     Y++ +   +  
Sbjct  105  GYCQGMNFIAAVFLEAGLPEADAYATFVYLLQHKHMSQFYKDSSVFLNEYLQRFQVRVAE  164

Query  315  ELPALAAHFQEQGIDAQMYAVDW-------SLPLDLALRLWDVYVLLGTPFFFQASMGLL  367
             LP LAA     G D  +Y ++W       S  ++L+  + D+ +   T   F+  + LL
Sbjct  165  LLPELAAKLDAVGFDVYLYGIEWFTTMFACSSKIELSHAVLDLVLADVTDVMFRIGIALL  224

Query  368  TLFQDSLLEMDAGDIMRLLHNFPKTTSSCQL-FEAISSNPLETMAARG  414
               +  LL M   D++R      K   + Q+   A+S  P+ +  A G
Sbjct  225  QNVEAQLLSMSFDDLLRDFKTVTKHVDTYQIVMAALSVPPVPSAVAHG  272

>CCI43456
Length=126

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 8/89 (9%)

Query  24   SKHLKLWRIRYFLLTKNELTYSTKSGRKPRLLLSLGD---VQVIDDQNQVRHPGNFVFVL  80
            S  +K WR RYF+L  N+L +S      P   + L D   V+  +D+   R    + F +
Sbjct  28   SMWMKEWRKRYFILKGNKLYFSKSKNDAPHGFIDLADCLTVKSAEDKTNKR----YCFEV  83

Query  81   QTPSRRLFLSATTEQERRSWVSEL-RALL  108
             TP    ++ A  E+++  W+  + RA++
Sbjct  84   ATPDTTYYMYAQNEEQKDEWIGAIGRAIV  112

Lambda      K        H        a         alpha
   0.317    0.131    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 122307067596

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40