Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_83941475742842819670.0
PHYRA_959011475710752228846e-108
PHYSO_3211571475711802228897e-108
PHYCA_34475147576922318485e-106
PITG_184571475711702228493e-102
PPTG_171281475711772228461e-101
PHALS_064771475711662227898e-94
PYU1_G001734147578002226392e-74
PYIW_18793147579972596287e-72
PYIR_134531475711862226124e-69
PYAP_177461475711692235903e-66
H310_092121475711132674581e-48
SDRG_017641475710922654535e-48
CCI451221475711052194511e-47
SPRG_06354147578842684492e-47
CCA188981475711472194465e-47
H257_063051475710992674361e-45
PYAR_1358114757730701565e-10
HYAP_0818410581342169771.7
SPRG_1298712902450958762.3
SDRG_0645912902450958752.5
SPRG_1381812957828366742.6
PHYCA_201531356220126732.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_8394

Length=428
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_8394                                                            762        0.0   
PHYRA_95901                                                           345        6e-108
PHYSO_321157                                                          347        7e-108
PHYCA_34475                                                           331        5e-106
PITG_18457                                                            331        3e-102
PPTG_17128                                                            330        1e-101
PHALS_06477                                                           308        8e-94 
PYU1_G001734                                                          250        2e-74 
PYIW_18793                                                            246        7e-72 
PYIR_13453                                                            240        4e-69 
PYAP_17746                                                            231        3e-66 
H310_09212                                                            181        1e-48 
SDRG_01764                                                            179        5e-48 
CCI45122                                                              178        1e-47 
SPRG_06354                                                            177        2e-47 
CCA18898                                                              176        5e-47 
H257_06305                                                            172        1e-45 
PYAR_13581                                                            64.7       5e-10 
HYAP_08184                                                            34.3       1.7   
SPRG_12987                                                            33.9       2.3   
SDRG_06459                                                            33.5       2.5   
SPRG_13818                                                            33.1       2.6   
PHYCA_20153                                                           32.7       2.8   

>PHYKE_8394
Length=428

 Score = 762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/428 (100%), Positives = 428/428 (100%), Gaps = 0/428 (0%)

Query  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTVKTEMELRAKA  60
            MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTVKTEMELRAKA
Sbjct  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTVKTEMELRAKA  60

Query  61   ELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVGKPKMTTRKDGGSIP  120
            ELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVGKPKMTTRKDGGSIP
Sbjct  61   ELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVGKPKMTTRKDGGSIP  120

Query  121  MEFFRERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYTENF  180
            MEFFRERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYTENF
Sbjct  121  MEFFRERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYTENF  180

Query  181  AVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFP  240
            AVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFP
Sbjct  181  AVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFP  240

Query  241  EQALRFPTGKDAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIRADV  300
            EQALRFPTGKDAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRLLIRADV
Sbjct  241  EQALRFPTGKDAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRLLIRADV  300

Query  301  NVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMRELR  360
            NVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMRELR
Sbjct  301  NVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMRELR  360

Query  361  REKRAPEYWRQPGPRDaaaklllaelekPVHVTSTQNVLASGSGLNRKTVAYTFPQTAAP  420
            REKRAPEYWRQPGPRDAAAKLLLAELEKPVHVTSTQNVLASGSGLNRKTVAYTFPQTAAP
Sbjct  361  REKRAPEYWRQPGPRDAAAKLLLAELEKPVHVTSTQNVLASGSGLNRKTVAYTFPQTAAP  420

Query  421  HEAVKHWK  428
            HEAVKHWK
Sbjct  421  HEAVKHWK  428

>PHYRA_95901
Length=1075

 Score = 345 bits (884),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 186/222 (84%), Positives = 195/222 (88%), Gaps = 23/222 (10%)

Query  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
            ENFAVQQNLQLTRICAAALDS+VDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL
Sbjct  513  ENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  572

Query  238  VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIALDlpi  274
            VFPEQA RFP                        GK+AYLVMGLPGAEDQRLA+ALDLPI
Sbjct  573  VFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPI  632

Query  275  lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
            LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYD+HELFAALAKLAV HM+QP+WLL
Sbjct  633  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLL  692

Query  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            KLDYDPLG+GEA++DLSGMQAMRELRREKR PEYWRQPGPRD
Sbjct  693  KLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRD  734

 Score = 147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 109/148 (74%), Gaps = 25/148 (17%)

Query  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
            MEK+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS V          
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  51   ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                +TE+ELRAKAELVL GMVNSSS+ Q+NQ+Q GTLLP VTV APPS R R GY    
Sbjct  61   AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGYG---  117

Query  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134
                    D  SIP+EFFRE+F NS+VE
Sbjct  118  --------DASSIPIEFFREQFHNSSVE  137

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 48/67 (72%), Gaps = 6/67 (9%)

Query  111  TTRKDGGSIPMEFFRERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYN  170
            T + D  +  ME  RE        D ++SDEDQG A ND+DE+AEMEELGANVDKIRGYN
Sbjct  253  TGKNDRSNDDMEGNREHI------DGEISDEDQGGADNDKDEEAEMEELGANVDKIRGYN  306

Query  171  ELLDAYT  177
            +LLDAY+
Sbjct  307  DLLDAYS  313

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 1/31 (3%)

Query  396  QNVLAS-GSGLNRKTVAYTFPQTAAPHEAVK  425
            +NVLAS G GLNRKTVA+TFPQTAAPHEAV+
Sbjct  814  KNVLASSGGGLNRKTVAFTFPQTAAPHEAVQ  844

>PHYSO_321157
Length=1180

 Score = 347 bits (889),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 192/222 (86%), Gaps = 23/222 (10%)

Query  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
            ENFAVQQNLQLTRICAAALDSNVDLLVYV+PFELTADVS YFLKLLQLGGLADSRPRVKL
Sbjct  602  ENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKL  661

Query  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
            VFPEQA RFP                        GKDAYLVMGLPG EDQRLAIALDLPI
Sbjct  662  VFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLPI  721

Query  275  lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
            LGAPP QALPLLTRSGGKRLLIRADVNVPTGTYELYD+HELFAALAKLAV HMDQPRWLL
Sbjct  722  LGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLL  781

Query  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            KLDYDPLGVGEA++DLSGMQAMRELRREK+ PEYWRQPGPRD
Sbjct  782  KLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRD  823

 Score = 161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 115/148 (78%), Gaps = 17/148 (11%)

Query  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
            MEK+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS V          
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  51   ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                +TE ELRAKAELVLNGMVNSSS+ Q+NQ+Q GTLLPAVTV APPS R R GY    
Sbjct  61   AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGY---A  117

Query  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134
            KP++    D  SIPMEFFRE+FRNS+VE
Sbjct  118  KPRVAKSMDASSIPMEFFREQFRNSSVE  145

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)

Query  390  VHVTSTQNVLASGSGLNRKTVAYTFPQTAAPHEAVK  425
            VH+TSTQNVLASG GLNRKTVA+TFPQT APHEAVK
Sbjct  904  VHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVK  939

 Score = 42.7 bits (99),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)

Query  159  LGANVDKIRGYNELLDAYT  177
            LGANVDKIRGYNELLDAY+
Sbjct  384  LGANVDKIRGYNELLDAYS  402

>PHYCA_34475
Length=692

 Score = 331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 193/231 (84%), Gaps = 27/231 (12%)

Query  173  LDAYT----ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGL  228
            LD Y+    EN AV+QNLQLTRICAAALDS VDLLVYVSPFELT DVSQYF+KLLQLGGL
Sbjct  202  LDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVSPFELTTDVSQYFIKLLQLGGL  261

Query  229  ADSRPRVKLVFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQR  265
            ADSRPRVKL+FPEQA RFP                        GK+AYLVMGLPGAEDQR
Sbjct  262  ADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQR  321

Query  266  LAIALDlpilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVT  325
            LA+ LDLPILGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYD+HELF+ALAKLAV 
Sbjct  322  LAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPAGTYELYDEHELFSALAKLAVA  381

Query  326  HMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            HMDQP+WL KLDYDPLGVGEA++DLSGMQAMRELRREKR PEYWRQPGPRD
Sbjct  382  HMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRD  432

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 1/37 (3%)

Query  390  VHVTSTQNVLASGSG-LNRKTVAYTFPQTAAPHEAVK  425
            VHVTST N+LA+G G LNR+TVA+TFPQTAAPHEAVK
Sbjct  513  VHVTSTLNMLATGGGGLNRRTVAFTFPQTAAPHEAVK  549

>PITG_18457
Length=1170

 Score = 331 bits (849),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 177/222 (80%), Positives = 190/222 (86%), Gaps = 23/222 (10%)

Query  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
            ENFA+QQNLQLTR+CAAALDSNV+LL+YVSPFELT+DVSQYFLKLLQLGGL DSRPRVKL
Sbjct  592  ENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKL  651

Query  238  VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIALDlpi  274
            VFPEQ  RFP                       TGK+AYLVMGLPGAEDQRLA+ALDLPI
Sbjct  652  VFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPI  711

Query  275  lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
            LGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYD+HE+ AALAKLA+ HMDQPRWL+
Sbjct  712  LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLI  771

Query  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            KLDYDPL VGEA++DLS MQAMRELRREKR PEYWRQPGPRD
Sbjct  772  KLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRD  813

 Score = 155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 114/148 (77%), Gaps = 17/148 (11%)

Query  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
            M+K+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRH+ +          
Sbjct  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  51   ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                +TE ELRAKAELVLNGMVNSSS+ ++NQ Q GTLLPAVTV A PSI  R GYD   
Sbjct  61   AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134
            KP+   + D  SIP+EFFRE+FRN++VE
Sbjct  121  KPR---QMDASSIPVEFFREQFRNNSVE  145

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 5/53 (9%)

Query  125  RERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
            R+RF      DDD+SDE+Q +  ND+DE AEME+LGANVDKIRGYNELLD Y+
Sbjct  345  RDRF-----SDDDISDEEQESDENDKDEYAEMEKLGANVDKIRGYNELLDVYS  392

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 1/37 (3%)

Query  390  VHVTSTQNVLASGSG-LNRKTVAYTFPQTAAPHEAVK  425
            VH++STQNVLA+G G LNRKTVA+TFPQTAAP+EA+K
Sbjct  894  VHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIK  930

>PPTG_17128
Length=1177

 Score = 330 bits (846),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 178/222 (80%), Positives = 188/222 (85%), Gaps = 23/222 (10%)

Query  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
            ENFAVQQNLQLTR+CA ALDSNVDLLVYVSPFELTADV QYFLKLLQLGGL DS PRVK 
Sbjct  601  ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF  660

Query  238  VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIALDlpi  274
            VFPEQ+ RFP                       TGK+AYLVMGLPGAEDQRLAIALDLPI
Sbjct  661  VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDLPI  720

Query  275  lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
            LGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYD+HEL AALAKLA+ HMDQP+WL+
Sbjct  721  LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI  780

Query  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            KLDYDPLGVGEA++DLS +QAMRELRREKR PEYWRQPGPRD
Sbjct  781  KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRD  822

 Score = 149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 111/148 (75%), Gaps = 17/148 (11%)

Query  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
            MEK+QQQ HVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS +          
Sbjct  1    MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  51   ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                +TE ELR+KAELVLNGMVNSS+N Q+NQ Q G  LPAVTV A PS + R GY+   
Sbjct  61   AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134
            KP+   + D  SIPMEFFRE+FRNS+VE
Sbjct  121  KPR---QMDASSIPMEFFREQFRNSSVE  145

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 43/57 (75%), Gaps = 5/57 (9%)

Query  121  MEFFRERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
            M+  R RF      DDD+SDEDQ    N +DEDAEMEELGANVDKIRGYNELLDAY+
Sbjct  350  MDNNRGRF-----SDDDVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDAYS  401

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 1/37 (3%)

Query  390  VHVTSTQNVLASGSG-LNRKTVAYTFPQTAAPHEAVK  425
            VHVTSTQNVLA+G G LNRKTVA+TFPQTAAPHEA+K
Sbjct  903  VHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIK  939

>PHALS_06477
Length=1166

 Score = 308 bits (789),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 179/222 (81%), Gaps = 23/222 (10%)

Query  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
            ENFAVQQNLQLTRICAAALD  VDLLVYVSP+ELTADVSQYF KLLQL G ADSRPRVK 
Sbjct  595  ENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKF  654

Query  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
            V+PEQA RFP                        G +AYLVMGLPG EDQRLAI LDLPI
Sbjct  655  VYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPI  714

Query  275  lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
            LGA P+QALPLLTRSGGKRLLI+AD+NVPTGTYELYD+HE+  ALAKLAV H+DQ +WL+
Sbjct  715  LGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLI  774

Query  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            KLDYDPLGVGEA++DLS MQAMREL REKR PEYWRQPG RD
Sbjct  775  KLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRD  816

 Score = 127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 101/148 (68%), Gaps = 14/148 (9%)

Query  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
            MEK+QQ +HVEDVGRLLL+TQEQLR MREQMTAAA ++EAN SP RHS+V          
Sbjct  16   MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  51   ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                +TE ELRAKAELVLNG++NSS++  ++Q Q  T LPAV+V AP  I+ R G     
Sbjct  76   ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRRGDSRAD  135

Query  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134
            +     R D  S  MEFFR++FRN+ VE
Sbjct  136  EFGHINRIDNNSTSMEFFRQQFRNNRVE  163

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 1/37 (3%)

Query  390  VHVTSTQNVLASG-SGLNRKTVAYTFPQTAAPHEAVK  425
            VH+TSTQNVL +   GL+RK+  + FPQT APH A+K
Sbjct  891  VHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIK  927

 Score = 36.2 bits (82),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 7/58 (12%)

Query  127  RFRNSNVEDDDL-SDEDQ----GAAGND--RDEDAEMEELGANVDKIRGYNELLDAYT  177
            R +N ++E++   S EDQ    G+  +D  +DE    ++L  NV KIR YN+L+DAY+
Sbjct  338  RNQNEDIENNCTHSFEDQEDEEGSDDSDIIKDEGFSTKDLAVNVAKIREYNDLVDAYS  395

>PYU1_G001734
Length=800

 Score = 250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 166/222 (75%), Gaps = 25/222 (11%)

Query  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
            +NFAV+QNLQL+R+C   +D+NVD+ VYVSPFELT++V QYF+KLLQLGG+AD   RVKL
Sbjct  222  DNFAVKQNLQLSRLCGI-IDANVDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKL  279

Query  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
            VFPEQA RFP                        GK+AYLV G+PG ED+RLA+AL++PI
Sbjct  280  VFPEQATRFPAHFSLTTVLLYSPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPI  339

Query  275  lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
            LG  P   LPL+T+SG KR  +RADVNVPTGTY++YD+ EL  +LAKL V+H++Q  WLL
Sbjct  340  LGMDPLATLPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLL  399

Query  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            K+DYDP G G AI+D S + A+RE+RREK++PEYWRQPG RD
Sbjct  400  KIDYDPFGTGTAIVDASVVTALREIRREKKSPEYWRQPGTRD  441

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 30/37 (81%), Gaps = 1/37 (3%)

Query  390  VHVTSTQNVLASGSGLNRKTVA-YTFPQTAAPHEAVK  425
            VHV+STQ+V+ S + ++++ VA Y FPQT AP+EA++
Sbjct  507  VHVSSTQDVILSTASIHKRKVAGYAFPQTTAPYEAIR  543

 Score = 37.0 bits (84),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)

Query  156  MEELGANVDKIRGYNELLDAYT  177
            M++L  NV+KIRGYNELLD Y+
Sbjct  1    MDDLRKNVEKIRGYNELLDTYS  22

>PYIW_18793
Length=997

 Score = 246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 179/259 (69%), Gaps = 37/259 (14%)

Query  153  DAEMEELGANVDKIRG------------YNELLDAYTENFAVQQNLQLTRICAAALDSNV  200
            +A+M+ L  +  +I+G             +E L    +NF+V+QNLQL+R+C   +DSNV
Sbjct  383  EAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGL-VDSNV  441

Query  201  DLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT------------  248
            D+ VYVSPFELT DV QY +KLLQLGG+AD   RVKLVFPE A RFPT            
Sbjct  442  DI-VYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSP  500

Query  249  -----------GKDAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIR  297
                        K+AYLV G+PG ED+RLA+AL++PILG  P  ALPL+T+SGGKR  +R
Sbjct  501  HCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMR  560

Query  298  ADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMR  357
            ADVNVPTGTY++YD+ EL  +LAKL V+H++Q  W+LK+DYDP   G A++D+S M A+R
Sbjct  561  ADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALR  620

Query  358  ELRREKRAPEYWRQPGPRD  376
            E+RREKR+PEYWRQPG RD
Sbjct  621  EIRREKRSPEYWRQPGTRD  639

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 9/48 (19%)

Query  131  SNVEDDDLSDEDQGAAGNDRDEDAE-MEELGANVDKIRGYNELLDAYT  177
            +NV++D + DE        +D+DA  M+EL  NV+KIRGYNELLD Y+
Sbjct  181  TNVDEDLMYDE--------KDDDANAMDELRKNVEKIRGYNELLDTYS  220

 Score = 39.3 bits (90),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 9/45 (20%)

Query  390  VHVTSTQNVL---------ASGSGLNRKTVAYTFPQTAAPHEAVK  425
            VHV+STQ++L           G     K+V Y FPQTAAP+EA++
Sbjct  705  VHVSSTQDILLSSSGGCGGKPGGAYRHKSVGYAFPQTAAPYEAIR  749

>PYIR_13453
Length=1186

 Score = 240 bits (612),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 164/222 (74%), Gaps = 25/222 (11%)

Query  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
            +NF+V+QN+QL+R+C   +D NVD+ VYVSPFELTADV+QY +KLLQLGG+AD   RVKL
Sbjct  600  DNFSVKQNIQLSRLCGL-IDPNVDI-VYVSPFELTADVAQYSMKLLQLGGIADPVARVKL  657

Query  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
            V+PEQA RFP                         K+AYLV G+PG ED+RLA+AL++PI
Sbjct  658  VYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPI  717

Query  275  lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
            LG  P  ALPL+T+SG KR  +RADVNVPTGTY++YD+ EL  +LAKL ++H++Q  W+L
Sbjct  718  LGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVL  777

Query  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            K+DYDP G G A++D+S M  +RE+RREK++PEYW+QP  RD
Sbjct  778  KIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRD  819

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 79/153 (52%), Gaps = 30/153 (20%)

Query  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
            M++ QQQHHVEDVGR+LLQTQEQLR+MREQM          +S MR ++           
Sbjct  1    MDQFQQQHHVEDVGRILLQTQEQLRLMREQMA---ATSTTPSSSMRFASSGASQPDVLAF  57

Query  51   -----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVG----APPSIRLRGG  101
                 + E+E+RAKAELVLNG V        N +   + LP V+      A P  RLR  
Sbjct  58   QEILQRAEVEIRAKAELVLNGFV--------NTSSQASALPTVSSSANGNASPKARLRQN  109

Query  102  YDSVGKPKMTTRKDGGSIPMEFFRERFRNSNVE  134
              S+   +  +R       +++FR RF N  VE
Sbjct  110  VTSLTAARRNSRLASDEPDLDYFRARFHNPAVE  142

 Score = 39.3 bits (90),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)

Query  135  DDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
            DD+++      A +D D+ + M+EL  NV+KIRGYNELLD Y+
Sbjct  358  DDEVNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYS  400

 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 14/50 (28%)

Query  390  VHVTSTQNVLASGSG--------------LNRKTVAYTFPQTAAPHEAVK  425
            VHV+STQ+++ + S                  KTV Y FPQTAAP+EA++
Sbjct  885  VHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSKTVGYAFPQTAAPYEAIR  934

>PYAP_17746
Length=1169

 Score = 231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 161/223 (72%), Gaps = 26/223 (12%)

Query  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
            ENF+V+QNLQL+R+ A  +D NV++ VYV+PFEL+ +VSQYF+KLLQL G+A++  RV+L
Sbjct  570  ENFSVKQNLQLSRL-AGLVDQNVEI-VYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRL  627

Query  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
            VFPE A +FP                        GK+AYLVMG+PG EDQRLA+AL +PI
Sbjct  628  VFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPI  687

Query  275  lgappaqalp-llTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWL  333
            LG     ++  L+TRSG KR  I+ADVNVPTGTY++YD  EL  +LAKL ++H++Q  WL
Sbjct  688  LGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWL  747

Query  334  LKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            LKLD DPLG G AI+D+S M  +R++RREKR PEYW+QPG RD
Sbjct  748  LKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRD  790

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 17/144 (12%)

Query  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT-------aaaeaveanaSPMRHSTVKTE  53
            ME++QQ+HHVEDVGR+LLQTQ+QLR +REQ+         +  A     + +     + E
Sbjct  1    MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSVIASNNAGAEIEEILQRAE  60

Query  54   MELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVGKPKMTTR  113
             ELR KAELVL+ +V +        ++ G L+P  TV                K ++   
Sbjct  61   DELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRR-----PPIARRRRRKAEL---  112

Query  114  KDGGS--IPMEFFRERFRNSNVED  135
             DGGS  + +E+FR+RF+ + V+D
Sbjct  113  HDGGSYDLDIEYFRQRFKRTAVDD  136

 Score = 40.4 bits (93),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 1/28 (4%)

Query  151  DEDA-EMEELGANVDKIRGYNELLDAYT  177
            DE A  ME+L  NV+KIRGYNELLDAY+
Sbjct  343  DEAANSMEDLRNNVEKIRGYNELLDAYS  370

 Score = 37.4 bits (85),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 6/40 (15%)

Query  390  VHVTSTQNVLASGSGLN-----RKTVAYTFPQTAAPHEAV  424
            VHV ST +VL SG+G       R+  A+ FPQT  PHEA+
Sbjct  856  VHVMSTNDVL-SGNGTTLSQRQRRPAAFVFPQTLVPHEAI  894

>H310_09212
Length=1113

 Score = 181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/267 (42%), Positives = 157/267 (59%), Gaps = 42/267 (16%)

Query  150  RDEDAEMEELGANVDKIR------------GYNELLDAYTENFAVQQNLQLTRICAAALD  197
            R  DA+M+   AN D I+               E      ENF++QQNLQ+ R+CA A D
Sbjct  505  RIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-D  563

Query  198  SNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT---------  248
             NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+AD + R++++ PE   RFP          
Sbjct  564  PNVDI-IYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLL  622

Query  249  --------------GKDAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRL  294
                          GKDAY+V G  G ED+RLAIAL LP+LG  P +AL   TRSGGKR+
Sbjct  623  YSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRI  682

Query  295  LIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQ  354
             + ADVN+P G +++YD+ EL  +L+KL    +DQ  WL+K+D D    G A +++  MQ
Sbjct  683  FMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQ  742

Query  355  AMRELRREKR-----APEYWRQPGPRD  376
            ++ + R EKR     A EY++QP  RD
Sbjct  743  SVAKFRAEKREMKHGAAEYFQQPDVRD  769

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 5/69 (7%)

Query  1   MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV-KTEMELRAK  59
           MEK+ QQ+H EDVGR+LLQ Q++LR MRE++               H+ + + E +LRAK
Sbjct  1   MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQI----HAILERAEADLRAK  56

Query  60  AELVLNGMV  68
           AE+VLNG+V
Sbjct  57  AEIVLNGVV  65

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (61%), Gaps = 3/41 (7%)

Query  137  DLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
            D +  D GA GND      +  L  NV+KIRGYNELLD Y+
Sbjct  309  DCASADDGAGGND---STSIHNLRRNVEKIRGYNELLDTYS  346

>SDRG_01764
Length=1092

 Score = 179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/265 (42%), Positives = 155/265 (58%), Gaps = 40/265 (15%)

Query  150  RDEDAEMEELGANVDKIR------------GYNELLDAYTENFAVQQNLQLTRICAAALD  197
            R  + +M    AN DKI+               E      +NFA++QNLQ+ R+CA A D
Sbjct  489  RTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-D  547

Query  198  SNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT---------  248
             NVD+ +Y+SPFEL+AD+ +Y ++LLQLGG+AD   RV+++ PE A RFP          
Sbjct  548  PNVDV-IYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILL  606

Query  249  --------------GKDAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRL  294
                          GK+AY+V G  G ED+RLAI L LP+LG  P +AL   TRSG KRL
Sbjct  607  YSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRL  666

Query  295  LIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQ  354
              +ADVN+P G +++YD+ EL  +LAKL   ++ Q  WL+KLD DP   G A ID+  ++
Sbjct  667  FTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALE  726

Query  355  AMRELRREKRA---PEYWRQPGPRD  376
             + ++R EKRA    EY+ QP  ++
Sbjct  727  CVNKVRTEKRAMKNDEYYSQPNIKE  751

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query  1   MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTVKTEMELRAKA  60
           M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +          +     + E++LR+KA
Sbjct  1   MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILE---RAELDLRSKA  57

Query  61  ELVLNGMV  68
           E+VLNG+V
Sbjct  58  EIVLNGVV  65

 Score = 35.0 bits (79),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)

Query  156  MEELGANVDKIRGYNELLDAYT  177
            ++EL  NV+KIRGYN+LLD Y+
Sbjct  309  IDELRNNVEKIRGYNDLLDTYS  330

>CCI45122
Length=1105

 Score = 178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 138/219 (63%), Gaps = 25/219 (11%)

Query  177  TENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVK  236
            TE F++QQNLQL R+CA  +D NV+L +Y+ PFELT D+ QY++KLLQLGG++D+  R+K
Sbjct  535  TEQFSIQQNLQLQRLCAV-IDENVEL-IYICPFELTDDIVQYYMKLLQLGGISDAAARIK  592

Query  237  LVFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlp  273
            L+ PE A RFP+                       G++AY+V G PG ED+R+A  L +P
Sbjct  593  LICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVP  652

Query  274  ilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWL  333
            ILG    ++L   T SG KR   +A+VN      +LYD++EL  +LAKL  +H  Q   +
Sbjct  653  ILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVV  712

Query  334  LKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQP  372
            L+LDYDP G G A++D+S +Q+++E+R   +  E W QP
Sbjct  713  LRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQP  751

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 28/32 (88%), Gaps = 0/32 (0%)

Query  1   MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
           M+ ++Q+HH ED+GR+LLQTQ++LR +R +++
Sbjct  1   MDHLEQKHHTEDIGRILLQTQQELREIRAEIS  32

>SPRG_06354
Length=884

 Score = 177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 155/268 (58%), Gaps = 40/268 (15%)

Query  147  GNDRDEDAEMEELGANVDKIR------------GYNELLDAYTENFAVQQNLQLTRICAA  194
             + R  + +M    AN DKI+               E      +NFA++QNLQ+ R+CA 
Sbjct  274  ADARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAI  333

Query  195  ALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT------  248
            A D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+AD   RV+++ PE A RFP       
Sbjct  334  A-DPNVDV-IYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLAT  391

Query  249  -----------------GKDAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGG  291
                             GK+AY+V G  G ED+RLAI L LP+LG  P +AL   TRSG 
Sbjct  392  ILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGA  451

Query  292  KRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLS  351
            KRL  +ADVN+P G +++YD+ EL  +LAKL   ++ Q  WL+KLD DP   G A ID+ 
Sbjct  452  KRLFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMH  511

Query  352  GMQAMRELRREKRA---PEYWRQPGPRD  376
             ++ + ++R EKRA    EY+ QP  ++
Sbjct  512  ALECVNKVRAEKRAMKNDEYYSQPNIKE  539

 Score = 35.4 bits (80),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 1/35 (3%)

Query  156  MEELGANVDKIRGYNELLDAYT-ENFAVQQNLQLT  189
            ++EL  NV+KIRGYN+LLD Y+   F +++   L+
Sbjct  97   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLS  131

>CCA18898
Length=1147

 Score = 176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 137/219 (63%), Gaps = 25/219 (11%)

Query  177  TENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVK  236
            TE F++QQNLQL R+CA  +D NV+L +Y+ PFELT D+ QY++KLLQL G++D+  R+K
Sbjct  575  TEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIVQYYMKLLQLAGISDAAARIK  632

Query  237  LVFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlp  273
            L+ PE A RFP+                       G++AYLV G PG ED+RLA  L +P
Sbjct  633  LMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIP  692

Query  274  ilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWL  333
            ILG  PA+   + T SG KR   + + N   G+ +LYD++EL  +LAKL   +  Q   +
Sbjct  693  ILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMV  752

Query  334  LKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQP  372
            LKLDYDP   G A++D+S +Q+++ LR   R  +YWRQP
Sbjct  753  LKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQP  791

 Score = 43.1 bits (100),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 29/32 (91%), Gaps = 0/32 (0%)

Query  1   MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
           ME+++Q++H EDVGR+LLQTQ++LR +R +++
Sbjct  26  MEQVEQKYHKEDVGRILLQTQQELRDIRAEIS  57

>H257_06305
Length=1099

 Score = 172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 160/267 (60%), Gaps = 42/267 (16%)

Query  150  RDEDAEMEELGANVDKIRGYNELL--------DAYT----ENFAVQQNLQLTRICAAALD  197
            R  DA+M+   AN D ++    ++        D  T    +NF+++QNLQ+ R+CA A D
Sbjct  491  RIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-D  549

Query  198  SNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT---------  248
             NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+ D + R++++ PE   RFP          
Sbjct  550  PNVDI-IYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLL  608

Query  249  --------------GKDAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRL  294
                          GK+AY+V G  G ED+RLAIAL +P+LG  P +AL   TRSGGKR+
Sbjct  609  YSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRI  668

Query  295  LIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQ  354
             + ADVN+P G +++YD+ EL  +L+KL    +DQ  WL+K+D D    G A I++  MQ
Sbjct  669  FMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQ  728

Query  355  AMRELRREKR-----APEYWRQPGPRD  376
            ++ ++R EKR     A EY++QP  RD
Sbjct  729  SVAKVRAEKRDMKHMAAEYFQQPDVRD  755

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query  1   MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTVKTEMELRAKA  60
           M+K+ QQ+H EDVGR+LLQ Q++LR MRE++           + +     + E +LRAKA
Sbjct  1   MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEKNNVDVNEINAILE---RAEADLRAKA  57

Query  61  ELVLNGMV  68
           E+VLNG+V
Sbjct  58  EIVLNGVV  65

 Score = 36.6 bits (83),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query  144  GAAGNDRD---EDAEMEELGANVDKIRGYNELLDAYT-ENFAVQQNLQLT  189
            GA G D     + + +  L  NV+KIRGYNELLD Y+   F +++   L+
Sbjct  296  GATGGDDTNGGDSSTIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLS  345

>PYAR_13581
Length=730

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 10/70 (14%)

Query  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
            ++FAVQQNLQL R+ AA +D+ V+ +VYVSPFEL  D+S          G+A++  RVK+
Sbjct  284  DHFAVQQNLQLARL-AAVVDATVEYVVYVSPFELPTDLSH---------GVANAAHRVKI  333

Query  238  VFPEQALRFP  247
            V PE A  FP
Sbjct  334  VVPEHAATFP  343

 Score = 42.7 bits (99),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 0/31 (0%)

Query  346  AIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
            A++D+S +  +RE+RR  + P YW+QPG RD
Sbjct  389  ALLDVSALTTLREIRRAHKPPAYWKQPGIRD  419

 Score = 40.8 bits (94),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 10/46 (22%)

Query  132  NVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
            +++D D S+ D  A          M++L  NV+KIRGYNELLD Y+
Sbjct  67   HIDDADASESDANA----------MDDLRKNVEKIRGYNELLDTYS  102

>HYAP_08184
Length=3421

 Score = 34.3 bits (77),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 35/69 (51%), Gaps = 6/69 (9%)

Query  112  TRKDGGSIPMEFFRERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNE  171
            + KDG  +  E    +F  S     D++D  QG AG  +++D E   +G+ V  I G+ +
Sbjct  838  SEKDGHLVVTETLATKFTAS-----DIADSSQGTAGEQKNDDVERIHVGSYVMFINGH-D  891

Query  172  LLDAYTENF  180
            +  A  ENF
Sbjct  892  VRQASLENF  900

>SPRG_12987
Length=509

 Score = 33.9 bits (76),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 29/58 (50%), Gaps = 0/58 (0%)

Query  157  EELGANVDKIRGYNELLDAYTENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTAD  214
            E+L  + D++ G+NE+      NF    +     + A  LD+NV +L+Y    +L  +
Sbjct  375  EKLNVHTDRVHGWNEIAQHVFRNFMGDFSKTFDGMVANILDANVPVLIYAGDADLVCN  432

>SDRG_06459
Length=509

 Score = 33.5 bits (75),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 29/58 (50%), Gaps = 0/58 (0%)

Query  157  EELGANVDKIRGYNELLDAYTENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTAD  214
            E+L  + D++ G+NE+      NF    +     + A  LD+NV +L+Y    +L  +
Sbjct  375  EKLNVHTDRVHGWNEIAQHVFRNFMGDFSKTFDGMVANILDANVPVLIYAGDADLVCN  432

>SPRG_13818
Length=283

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 9/66 (14%)

Query  108  PKMTTRKDGGSIPMEFFRERFRNSNVEDDDLSDEDQGAAGNDRDEDAEM-----EELGAN  162
            P+ T+RKD   +     R R R+   ED+D+ D+   A  +D DED +M     +    N
Sbjct  214  PRYTSRKDCRDVT----RLRVRDWATEDNDIDDDVANAFCHDEDEDEDMRCWQCDTDAEN  269

Query  163  VDKIRG  168
             D+I G
Sbjct  270  TDRIDG  275

>PHYCA_20153
Length=220

 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 53/126 (42%), Gaps = 4/126 (3%)

Query  110  MTTRKDGGSIPME-FFRERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRG  168
            +T  +D   +PM+    +R +   +E     + D+   G+ ++++ +M  L     ++  
Sbjct  91   VTQIQDWAIVPMKRLLEDREKAIKIEAKLQKEYDEIKRGSSKEKEKKMRMLSDQKRRVEN  150

Query  169  YNELLDAYTENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGL  228
             N LLD + ENF   +  ++ +I +    S      Y    EL A   Q   K LQL   
Sbjct  151  VNTLLDTHMENFERYRIQKMKKIVSELARSQA--FYYAKGLELFAVPCQNIAK-LQLSDT  207

Query  229  ADSRPR  234
                P+
Sbjct  208  TKGTPK  213

Lambda      K        H        a         alpha
   0.317    0.134    0.388    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 30337754130

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40