Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_83931475632632614680.0
PPTG_171271475635135111171e-152
PITG_184561475635135111126e-152
PHYRA_811001475634935111126e-152
PHYSO_4715231475634835111092e-151
PHYCA_5561621475635135110735e-146
PHALS_06478147563453519902e-133
PYU1_G001735147563423556427e-81
PYIR_13451147563593696272e-78
PYAP_17762147563483576028e-75
PYIW_19971147563483566011e-74
PYVX_18171147562943335812e-72
PYAR_13570147563222985269e-64
CCA18899147563433434086e-46
CCI45123147563012903925e-44
SPRG_06336147563353293047e-31
SDRG_01781147563353292951e-29
H257_06294147563583542723e-26
H310_09223147563333342564e-24
CCI451271609872022071731e-13
PPTG_192362461214272810.13
SPRG_060591251091312104830.26
PHYRA_837687189273531810.42
PHYRA_770336023137231810.47
SPRG_0605816128125816761.9
PHYCA_5560816023136332742.8
PPTG_042996023136531725.6
PITG_071346023136631715.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_8393

Length=326
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_8393                                                            570        0.0   
PPTG_17127                                                            434        1e-152
PITG_18456                                                            432        6e-152
PHYRA_81100                                                           432        6e-152
PHYSO_471523                                                          431        2e-151
PHYCA_556162                                                          417        5e-146
PHALS_06478                                                           385        2e-133
PYU1_G001735                                                          251        7e-81 
PYIR_13451                                                            246        2e-78 
PYAP_17762                                                            236        8e-75 
PYIW_19971                                                            236        1e-74 
PYVX_18171                                                            228        2e-72 
PYAR_13570                                                            207        9e-64 
CCA18899                                                              161        6e-46 
CCI45123                                                              155        5e-44 
SPRG_06336                                                            121        7e-31 
SDRG_01781                                                            118        1e-29 
H257_06294                                                            109        3e-26 
H310_09223                                                            103        4e-24 
CCI45127                                                              71.2       1e-13 
PPTG_19236                                                            35.8       0.13  
SPRG_06059                                                            36.6       0.26  
PHYRA_83768                                                           35.8       0.42  
PHYRA_77033                                                           35.8       0.47  
SPRG_06058                                                            33.9       1.9   
PHYCA_556081                                                          33.1       2.8   
PPTG_04299                                                            32.3       5.6   
PITG_07134                                                            32.0       5.8   

>PHYKE_8393
Length=326

 Score = 570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/326 (100%), Positives = 326/326 (100%), Gaps = 0/326 (0%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFPCHPPHGETPAHKGSFYLSNIAPHEYV  60
            MNILRVPEVGATASGDKARPTSCEGYVTKRGHFPCHPPHGETPAHKGSFYLSNIAPHEYV
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFPCHPPHGETPAHKGSFYLSNIAPHEYV  60

Query  61   VGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQIMRQAID  120
            VGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQIMRQAID
Sbjct  61   VGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQIMRQAID  120

Query  121  QSVSPTKKGMFGFGlslspqplvppqKQIQALTHNKeellaealreleaaKMVGREACNE  180
            QSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHNKEELLAEALRELEAAKMVGREACNE
Sbjct  121  QSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHNKEELLAEALRELEAAKMVGREACNE  180

Query  181  IVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSNESSPQRT  240
            IVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSNESSPQRT
Sbjct  181  IVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSNESSPQRT  240

Query  241  HQSAGSNPIHLPFSMGSANDADASDLERlahalgelelqaellngeagRSTQQIARIEQQ  300
            HQSAGSNPIHLPFSMGSANDADASDLERLAHALGELELQAELLNGEAGRSTQQIARIEQQ
Sbjct  241  HQSAGSNPIHLPFSMGSANDADASDLERLAHALGELELQAELLNGEAGRSTQQIARIEQQ  300

Query  301  LSNVTARVEKQTKQASATLSAGPRLF  326
            LSNVTARVEKQTKQASATLSAGPRLF
Sbjct  301  LSNVTARVEKQTKQASATLSAGPRLF  326

>PPTG_17127
Length=351

 Score = 434 bits (1117),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 256/351 (73%), Positives = 284/351 (81%), Gaps = 25/351 (7%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35
            MNILRVPE G TASGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95
            HPP GE  A KGSFYLS+I PHEYVVGVMGAADKPFGFKMVGHAP+KGYVELDVFV+TL+
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHN  155
            DRNKWLEVARNAL  KRQ+ RQAIDQSVSP KK +FGF ++LSPQP + PQKQ+Q L  +
Sbjct  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180

Query  156  KeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215
            K+ELL+EALRELEAAK+VGREACNEIV+QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  181  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERlahalge  275
            TLHLFSDD+RPKS   S  SSPQR HQS GS+P  LP +  +++DA  SDLERLA ALGE
Sbjct  241  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300

Query  276  lelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326
            LE+QAE+LNGEA  S+QQI RIE  L+NVT RVEKQTKQASATLSAGPRLF
Sbjct  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PITG_18456
Length=351

 Score = 432 bits (1112),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 262/351 (75%), Positives = 291/351 (83%), Gaps = 25/351 (7%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35
            MNILRVPE GATASGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95
            HPP G+  A KG FYLS+I PHEYVVGVMGAADKPFGFKMVGHAP+KGYVELDVFV+TL+
Sbjct  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHN  155
            DRNKWLEVARNALGAKRQ+ RQAIDQSVSP KK +FGF +SLSPQP + PQKQIQ L+ +
Sbjct  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180

Query  156  KeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215
            K+ELL++ALRELEAAK+VGREACNEIVVQGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERlahalge  275
            TLHLFSDD+RPKS  +S  SSPQR+HQS GS+P  LP ++  ++DA  SDLERLA ALGE
Sbjct  241  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300

Query  276  lelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326
            LE+QAELLNGEAGRS+QQI RIE  L+NVT RVEKQTKQASATLSAGPRLF
Sbjct  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHYRA_81100
Length=349

 Score = 432 bits (1112),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 260/351 (74%), Positives = 286/351 (81%), Gaps = 27/351 (8%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35
            MNILRVPE+GATASGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60

Query  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95
            HPP  E  A KGSFYLS+I PHEYVVGVMGAA KPFGFKM+GHAP+KGYVELDVFVET  
Sbjct  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120

Query  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHN  155
            DRNKWLEVARNAL AKRQ+ RQAIDQSVS  KK +FGFG+SLSPQPL+ PQKQ+Q LT N
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180

Query  156  KeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215
            K+ELL+ ALR++EAAK+VGREACNEIV+QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240

Query  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERlahalge  275
            TLHLFSDD+RPKS A S   SPQR+ QS GS P  LP +M + NDA  SDLERLA ALGE
Sbjct  241  TLHLFSDDSRPKSTA-SKGHSPQRSQQSGGS-PSRLPPAMETINDAGVSDLERLAQALGE  298

Query  276  lelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326
            LE+QAE+LNGEAGRSTQQI R+E QLSNVTARVEKQTKQASATL AGP+LF
Sbjct  299  LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349

>PHYSO_471523
Length=348

 Score = 431 bits (1109),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 260/351 (74%), Positives = 285/351 (81%), Gaps = 28/351 (8%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35
            MNILRVPEVGATASGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60

Query  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95
            HPP GE  A KGSFYLS+I PHEYVVGVMGAA+KPFGFKMVGHAPRKGYVELDVFVETL+
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120

Query  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHN  155
            DRNKWLEVARNAL AKRQ+ RQAIDQSVSP +K +FGF +SLSPQP + PQKQ+Q LT +
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180

Query  156  KeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215
            ++ELL++ALR++EAAK VGREACNEIV QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERlahalge  275
            TLHLFSDD+RPK+ A S  SSPQR+ QS    P  LP +M S NDA  SDLERLA ALGE
Sbjct  241  TLHLFSDDSRPKASA-SKASSPQRSQQSG--RPPRLPPAMDSINDAGVSDLERLAQALGE  297

Query  276  lelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326
            LE+QAELLNGEAGR TQQI RIE QLSNVTARVEKQTKQASA L +GPRLF
Sbjct  298  LEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348

>PHYCA_556162
Length=351

 Score = 417 bits (1073),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 249/351 (71%), Positives = 277/351 (79%), Gaps = 25/351 (7%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35
            MNILRVPEVGA  SGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60

Query  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95
            HP  GE    KGSFYLS+I PHEYVVGVMGAA KPFGFKMVGHAP+KGYVELDVFVET+ 
Sbjct  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120

Query  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHN  155
            DRNKWLEVARNAL AKRQ+ RQAIDQSVSP KK +FGF +SLSPQP + PQKQ+Q LT N
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180

Query  156  KeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215
            K++LL++ALR++EAAK +GREACNEIV+QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERlahalge  275
            TLH+FS+D+RPKS ++S  +SPQR+ QS GS+P  L  +  S  D  ASDLERLA ALGE
Sbjct  241  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  300

Query  276  lelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326
            LELQAELLN EAG STQQI  IE  LS VT RVEKQTKQASATL AGPRLF
Sbjct  301  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351

>PHALS_06478
Length=345

 Score = 385 bits (990),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 236/351 (67%), Positives = 265/351 (75%), Gaps = 31/351 (9%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35
            MNILR+PE GATASGDKA+PTSCEGYVTKRGHF                          C
Sbjct  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60

Query  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95
            HPP+GE+   KGSFYLSNI PHEYV+GVMGAAD+PFGFKMVGHAPRKG+VELDVFVET +
Sbjct  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120

Query  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHN  155
            DRNKWLEVA NAL AKRQ+ RQAIDQSVSP KK +FGF +  S QP++ PQKQ+Q L  +
Sbjct  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180

Query  156  KeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215
            KE LL EALRE+EAAK+VGREACNEIV QGEKLD +E DL AIDRDLDFGDKLL RLK+P
Sbjct  181  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240

Query  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERlahalge  275
            TLH FSDDTRPK     +       H S  ++P  L  ++    DA  SDL+RLA ALGE
Sbjct  241  TLHFFSDDTRPKVPLGDH------PHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294

Query  276  lelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326
            LE+QAELLN E+G S+QQI RIE  LS+VT RVEKQTKQA ATLSAGPRLF
Sbjct  295  LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345

>PYU1_G001735
Length=342

 Score = 251 bits (642),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 178/355 (50%), Positives = 226/355 (64%), Gaps = 49/355 (14%)

Query  1    MNILRVPEVGATASG-DKARPTSCEGYVTKRGHF-------------------------P  34
            MNILRVP+     SG +  +PTSCEGYVTKRGHF                          
Sbjct  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60

Query  35   CHPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETL  94
             H P G  P  KGSFY+S++  HEY +GVMG  +KPFGFK+VGHAP KGY+ELD+FVE+L
Sbjct  61   AHAP-GTVP--KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117

Query  95   SDRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTH  154
             D NKWLEV +NAL A +++ R+ +  S     K MFGFG S+SPQ       Q++ L  
Sbjct  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVKKLAA  167

Query  155  NKeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKN  214
             KEELL EALRE+E AK++GREA NEIV QGEKLD VE+DL  ++ DLD  DKLLR LK+
Sbjct  168  TKEELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227

Query  215  PTLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPI-------HLPFSMGSANDADASDLE  267
            P LH+FS+D R K  A +  ++      SA ++P+       H   + G       +DLE
Sbjct  228  PVLHVFSNDNRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGT---LNDLE  284

Query  268  RlahalgelelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAG  322
             LA AL ELE QA L+N EA RST+QIARIE++L++V  RV+ QTK+A+AT+ AG
Sbjct  285  MLALALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339

>PYIR_13451
Length=359

 Score = 246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 183/369 (50%), Positives = 224/369 (61%), Gaps = 60/369 (16%)

Query  1    MNILRVPEVGATASG------DKARPTSCEGYVTKRGHF--------------PCHPPHG  40
            MNILRVP+     SG      DK +PTSCEGYVTKRGHF                   + 
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  41   ET---------------PAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYV  85
            E+               P  KGSFY+S++  HEY VGVMG  +KPFGFK+VGHAP+KGY+
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  86   ELDVFVETLSDRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvpp  145
            ELD+FVE+L D NKW+EV +NAL A ++  R    Q  S TK  MFGF  S SPQ     
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKT-MFGFSASASPQL----  175

Query  146  qKQIQALTHNKeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFG  205
              Q++ L   KE+LL +ALRE+E AK++GREA NEIVVQGEKLD VE DL  ++ DLD  
Sbjct  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233

Query  206  DKLLRRLKNPTLHLFSDDTRPKSHANSNESSPQRTHQS------------AGSNPIHLPF  253
            DKLLR +K P LHLFS D R K   ++  +S      S            AG   IH   
Sbjct  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIH---  290

Query  254  SMGSANDADASDLERlahalgelelqaellngeagRSTQQIARIEQQLSNVTARVEKQTK  313
              G  NDA  SDLE+LA ALGELE QA L+N EA +ST+QIAR+EQ+L+ V  RV+ QTK
Sbjct  291  --GQRNDA-LSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTK  347

Query  314  QASATLSAG  322
            +A+AT+ AG
Sbjct  348  KANATMKAG  356

>PYAP_17762
Length=348

 Score = 236 bits (602),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 161/357 (45%), Positives = 217/357 (61%), Gaps = 48/357 (13%)

Query  1    MNILRVPEVGATA----------SGDKARPTSCEGYVTKRGHF-----------------  33
            MNILR+P +GAT+               +PTSCEGYVTKRGHF                 
Sbjct  1    MNILRLP-LGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLL  59

Query  34   -------PCHPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVE  86
                         G  P  KGSFYLS++  HEY VGV+GA +KPFGFKMVGHAPRKGYVE
Sbjct  60   VSYYDSKEVARTAGAVP--KGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVE  117

Query  87   LDVFVETLSDRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppq  146
            LD+FVETL D NKWLEV +NAL A +++ R    ++++P  K +FGF       P   PQ
Sbjct  118  LDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGF------SPATSPQ  169

Query  147  KQIQALTHNKeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGD  206
            +Q++ +T  KE++L +A+ E+E+AK++GR AC EI +QGE+LD +  +L  ++ DLD+ D
Sbjct  170  QQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYAD  229

Query  207  KLLRRLKNPTLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIH---LPFSMGSANDADA  263
            KLLR +KNP LH+FS D R ++          R   SA S       L  S  +   A  
Sbjct  230  KLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPL  289

Query  264  SDLERlahalgelelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLS  320
            SD+ERLA  LGELE QA LLN EA + T Q+ R+ +QL++V  RV+ QT++A+A+++
Sbjct  290  SDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASIA  346

>PYIW_19971
Length=348

 Score = 236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 220/356 (62%), Gaps = 45/356 (13%)

Query  1    MNILRVPEVGATAS----GDKARPTSCEGYVTKRGHF-------------------PCHP  37
            MNILRVP++    S    GDK + TSCEGYVTKRGHF                       
Sbjct  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGG  60

Query  38   PHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDR  97
                TP  KGSF++S++  HEY VGVMG  +KPFGFK+VGHAP+KGY+ELD+FVETL D 
Sbjct  61   ASPATP--KGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDL  118

Query  98   NKWLEVARNALGAKRQIMRQ--AIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHN  155
            NKW+EV +NAL A ++  R   A D   S T K MFGF  ++SPQ       Q++ L   
Sbjct  119  NKWVEVVQNALDAAKKHTRTPGAAD---SSTTKNMFGFSATVSPQL------QVKKLAAT  169

Query  156  KeellaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215
            KEELL +ALRE+E AK++GREA ++I  QG KL+ +E DL  ++ DLD G KLL  +K P
Sbjct  170  KEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRP  229

Query  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDAD---------ASDL  266
             LHLFS+D R K +A+ + S        +G++P     S  +A  A           SDL
Sbjct  230  MLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVMSDL  289

Query  267  ERlahalgelelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAG  322
            ERL  ALGELE QA  +N EA +ST+QIAR+EQ+L+ V  RV+ QTK+A+AT+ AG
Sbjct  290  ERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMKAG  345

>PYVX_18171
Length=294

 Score = 228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 192/333 (58%), Gaps = 73/333 (22%)

Query  19   RPTSCEGYVTKRGHF---------------------PCHPPHGETPAHKGSFYLSNIAPH  57
            RPTSCEGYVTKRGHF                               A KG FYLS+I  H
Sbjct  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKH  69

Query  58   EYVVGVMGAA---DKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQI  114
             YV G MGA    +KPFGFKMVGHAP+KGY ELD+FVETL+D  KWLEVA NAL +   +
Sbjct  70   AYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAM  129

Query  115  MRQAI-DQSVSPTKKGMFGFGlslspqplvppqKQIQALTHNKeellaealreleaaKMV  173
             R+A  D   S T K +FGF           PQ+Q++A++ +K+ELL +ALRELE AK++
Sbjct  130  SRKAAGDGGGSATTKSLFGF------STTTSPQQQLKAMSVSKDELLKDALRELEGAKLI  183

Query  174  GREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSN  233
            GREAC E+VVQGEKLD +E +L  I+ DLD+GDKLLRRLK+P LHL + D R        
Sbjct  184  GREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR-------R  236

Query  234  ESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERlahalgelelqaellngeagRSTQQ  293
              SP +T  +AG              D  A+ LE+L                    STQQ
Sbjct  237  PPSPTKTLSNAG--------------DGRAA-LEQL--------------------STQQ  261

Query  294  IARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326
            IARIE++L+ V  RV++QTKQA++ +  G  +F
Sbjct  262  IARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYAR_13570
Length=322

 Score = 207 bits (526),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 148/298 (50%), Positives = 194/298 (65%), Gaps = 30/298 (10%)

Query  40   GETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNK  99
            G +P  KGSFYLS++  HEYVVGV+GA  KPFGFKMVGHAPRKGYVELD+FVE+  D  K
Sbjct  36   GASP--KGSFYLSSVEKHEYVVGVLGAQKKPFGFKMVGHAPRKGYVELDIFVESRGDLAK  93

Query  100  WLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHNKeel  159
            WLEV ++AL A +++ R  +  + S   K +FGF       P   PQKQIQ L+ +KEEL
Sbjct  94   WLEVCQHALAAAKKLTRSGLSDAAST--KSLFGFS------PATSPQKQIQKLSASKEEL  145

Query  160  laealreleaaKMVGREACNEIVVQG---------------EKLDSVEHDLHAIDRDLDF  204
            L +A+ E+E+AK++GREAC EIVVQG               EKLD +E +L  +D DLD+
Sbjct  146  LKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHAEKLDHIESELQRVDADLDY  205

Query  205  GDKLLRRLKNPTLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSAND---A  261
            GDKLL  LK+P L+LFS D R K+ A S   SP ++ QSA S+      ++G   +    
Sbjct  206  GDKLLSHLKSPLLYLFSSDARDKNSA-SPAHSPVKSKQSALSSAARAD-ALGQGVERASG  263

Query  262  DASDLERlahalgelelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATL  319
            + SD+ERLA  LGELE QA LLN EA R T Q+ R+   L+++  RV+ QTK+A + +
Sbjct  264  EMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVGDALAHINERVQNQTKKADSAV  321

>CCA18899
Length=343

 Score = 161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 131/343 (38%), Positives = 182/343 (53%), Gaps = 50/343 (15%)

Query  20   PTSCEGYVTKRGHF------------------------PCHPPHGETPAHKGSFYLSNIA  55
            PTSCEGYVTKRGHF                                TP  KGSF L +  
Sbjct  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATP--KGSFILQSAE  72

Query  56   PHEYVVGVM---GAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKR  112
             HEY +  M      +KPFGFKMVGHAP++GY+ELDVFV++ SD ++WL+V  N L A +
Sbjct  73   KHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASK  132

Query  113  QIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHNKeellaealreleaaKM  172
             + R+A    +  T K + GF            ++QIQ L   K + + EAL+++E AK 
Sbjct  133  CMAREAFMAEMDTT-KSVLGFS-----YIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKS  186

Query  173  VGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHAN-  231
             G  AC+EIV QGE+L  VE +L  I  DL+  +KL++ +++P  + FS  +RP   A  
Sbjct  187  AGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-RSRPHDRATI  245

Query  232  -------SNESSPQRTHQSAGS-NPIHLPFSMGSANDADASDLERlahalgelelqaell  283
                    +   P   H++    N  HL   +        +D+E+LA AL +LE+QA+L+
Sbjct  246  SKSSSIHRSHHHPGILHKTKKDRNVDHLAEEI----RVPTNDIEKLAMALKDLEVQAQLI  301

Query  284  ngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326
            N EA +S +QIARIE QLS +  R++ QT Q   T S    LF
Sbjct  302  NSEAVKSNEQIARIEGQLSGINDRIQAQTSQV-ITSSGKQNLF  343

>CCI45123
Length=301

 Score = 155 bits (392),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 171/290 (59%), Gaps = 17/290 (6%)

Query  46   KGSFYLSNIAPHEYVVGVM---GAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLE  102
            KGSF L N+  HEY +  M      ++PFGFKMVGHAP++GYVELDVFV++LS+ ++WL+
Sbjct  20   KGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQGYVELDVFVDSLSNMDQWLD  79

Query  103  VARNALGAKRQIMRQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHNKeellae  162
            V  N L A +++ R+A    +  T KG+ GF            ++Q++ L   K + + E
Sbjct  80   VINNGLKANKRMAREAFMAEMDTT-KGVLGFS-----FAGTTSKQQVKELKSRKSDYIHE  133

Query  163  alreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSD  222
            AL+++E AK  G  AC+EIV QGE+L  VE +L  I+ DL+  +KL++ +++P  + FS 
Sbjct  134  ALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSK  193

Query  223  DTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDAD------ASDLERlahalgel  276
                +  A S  ++  R+H    +  +H+  + G             +DLE+LA AL EL
Sbjct  194  THHHEKDAMSKNNTNHRSHHHQ-TGILHMRKNDGKIEHVAEEICVPTNDLEKLAMALKEL  252

Query  277  elqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326
            E+QA+L+N EA +S  QI RIE QLS +  R++ QT Q  A+ S    LF
Sbjct  253  EVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVAS-SGKKNLF  301

>SPRG_06336
Length=335

 Score = 121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 164/329 (50%), Gaps = 39/329 (12%)

Query  19   RPTSCEGYVTKRGHFP------CHPPHGET----------------PAHKGSFYLSNIAP  56
            + TSCEGYVTKRGH             G+T                P  KGSF L+ I  
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68

Query  57   HEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQIMR  116
            H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NALG K    +
Sbjct  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG-KNVTPQ  125

Query  117  QAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHNKeellaealreleaaKMVGRE  176
             ++DQ  S         G       L     Q++ +   KEELL +A+  LE A+ VG  
Sbjct  126  ASVDQRASAL------LGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDN  179

Query  177  ACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSNESS  236
              +E+    E LD  E ++  ++ +LD GD +++++ +P  + FS     K    S +S 
Sbjct  180  TVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTGSPKSK  239

Query  237  PQRTH--QSAGSNPIHLPFS------MGSANDADASDLERlahalgelelqaellngeag  288
              R+H  Q+  ++P H   S       G+  DA   +L++L+  L  LE+ A  ++ E  
Sbjct  240  SARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVE  299

Query  289  RSTQQIARIEQQLSNVTARVEKQTKQASA  317
            R+T+QI RI++++     R+ +Q+ +  A
Sbjct  300  RTTEQIDRIQKKMVEADERIVEQSAKVHA  328

>SDRG_01781
Length=335

 Score = 118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 165/329 (50%), Gaps = 39/329 (12%)

Query  19   RPTSCEGYVTKRGH---------------------FPCHPPH-GETPAHKGSFYLSNIAP  56
            + TSCEGYVTKRGH                     F     +  + P  KGSF L+ I  
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68

Query  57   HEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQIMR  116
            H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NALG  + +  
Sbjct  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KNVAP  124

Query  117  QAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHNKeellaealreleaaKMVGRE  176
            QA     S  ++     G   +   L     Q++ +   KEELL +A+  LE A+ VG  
Sbjct  125  QA-----SADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDN  179

Query  177  ACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSNESS  236
              +E+    E LD  E ++  +  +LD GD +++++ +P  + FS     K  A S +S 
Sbjct  180  TVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSK  239

Query  237  PQRTH--QSAGSNPIHL----PFSM--GSANDADASDLERlahalgelelqaellngeag  288
              R+H  Q+  ++P +     P S   G   DA   +L++L+  L  LE+ A  ++ E  
Sbjct  240  SARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTISTEVE  299

Query  289  RSTQQIARIEQQLSNVTARVEKQTKQASA  317
            R+T+QI RI++++     RV +Q+ +  A
Sbjct  300  RTTEQIDRIQKKMVEADERVVEQSAKVHA  328

>H257_06294
Length=358

 Score = 109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 108/354 (31%), Positives = 166/354 (47%), Gaps = 54/354 (15%)

Query  17   KARPTSCEGYVTKRGHFPCHPP------HGET--------------PAH-KGSFYLSNIA  55
            K   TSCEGYVTKRGH            +G+T                H KGSF LS   
Sbjct  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66

Query  56   PHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALG---AKR  112
              +  +   GA+ KPFGFK +GH P +GY E  V+VE+  D+ KWL VA NALG   + +
Sbjct  67   KQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQ  124

Query  113  QIMRQAIDQSVSPT-----------KKGMF---GFGlslspqplvppqKQIQALTHNKee  158
            + M Q I++   P            ++ M      G   S   +   + Q++ +    +E
Sbjct  125  KSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTSQE  184

Query  159  llaealreleaaKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTL-  217
            LL +A+ + + A  +G    NE+V Q + L+  E  +  + R +D  + L R LK+P L 
Sbjct  185  LLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKHPILY  244

Query  218  ---HLFSDDTRPKSHANSNESSPQRTHQSAGSNP-------IHLPFSMGSANDADASDLE  267
               HLF   TR KS+      S  R   +  S         +  P    +A   +   L+
Sbjct  245  KLTHLF---TRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQLD  301

Query  268  RlahalgelelqaellngeagRSTQQIARIEQQLSNVTARVEKQTKQASATLSA  321
            +L+  L +L   A+ ++    R+T+Q+ RI+Q++++V  RV+K+ K   A L A
Sbjct  302  QLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355

>H310_09223
Length=333

 Score = 103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 100/334 (30%), Positives = 158/334 (47%), Gaps = 39/334 (12%)

Query  17   KARPTSCEGYVTKRGHFP------CHPPHGET--PAH-------------KGSFYLSNIA  55
            K   TSCEGYVTKRGH            HG+T   A+             KGSF LS   
Sbjct  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66

Query  56   PHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQIM  115
              +  +   G + KPFGFK +GH P +GY E  VFVET  D+ KWL VA NALG    I 
Sbjct  67   KQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYI-  123

Query  116  RQAIDQSVSPTKKGMFGFGlslspqplvppqKQIQALTHNKeellaealreleaaKMVGR  175
                    SP+ +   G G   S   ++  + QI+ +     ELL +A+ + + A  +G 
Sbjct  124  -------PSPSMESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGD  176

Query  176  EACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDD-TRPKSHANSNE  234
               +E+  Q E L+  E+ + A+ + +D  + L + +K+P L+ F+   +R KS      
Sbjct  177  ATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKRGKRG  236

Query  235  SSPQRTHQSAGSNPIHLPFSMGSA-------NDADASDLERlahalgelelqaellngea  287
            +S ++      +    +P  +             +   L+ L+  L +L   A+ ++   
Sbjct  237  ASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTISDIT  296

Query  288  gRSTQQIARIEQQLSNVTARVEKQTKQASATLSA  321
             R+T+Q+ RI+Q++++V  RV K+ K   + L A
Sbjct  297  TRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330

>CCI45127
Length=202

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 115/207 (56%), Gaps = 13/207 (6%)

Query  126  TKKGMFGFGlslspqplvppqKQIQALTHNKeellaealreleaaKMVGREACNEIVVQG  185
            T KG+ GF  + +        +Q++ L   K + + EAL+++E AK  G  AC+EIV QG
Sbjct  3    TTKGVLGFSFAGTTSK-----QQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQG  57

Query  186  EKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSNESSPQRTHQSAG  245
            E+L  VE +L  I+ DL+  +KL++ +++P  + FS     +  A S  ++  R+H    
Sbjct  58   EQLGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQ-  116

Query  246  SNPIHLPFSMGSANDAD------ASDLERlahalgelelqaellngeagRSTQQIARIEQ  299
            +  +H+  + G             +DLE+LA AL ELE+QA+L+N EA +S  QI RIE 
Sbjct  117  TGILHMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEG  176

Query  300  QLSNVTARVEKQTKQASATLSAGPRLF  326
            QLS +  R++ QT Q  A+ S    LF
Sbjct  177  QLSGINDRIQSQTTQVVAS-SGKKNLF  202

>PPTG_19236
Length=142

 Score = 35.8 bits (81),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 13/72 (18%)

Query  181  IVVQGEKLDSVEHDLHA-IDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSNESSPQR  239
            + +Q E+L S   +L A + R  +F    L+RL N + H+F++D     H++SN++  +R
Sbjct  39   LALQRERLSSQNTELRAALARHFEF----LKRLSNTSFHVFNED-----HSDSNDTGQER  89

Query  240  THQSA---GSNP  248
            +H  A   G+NP
Sbjct  90   SHLGAMHSGNNP  101

>SPRG_06059
Length=1312

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 42/104 (40%), Gaps = 29/104 (28%)

Query  23   CEGYVTKRGH--------FPCHPPHG-------ETPAHK-GSFYLSNIAPHEYVVGVM--  64
            C GY+TKRGH        F    PH        E+ A K G  +L  +AP EYV      
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADESMAKKLGQVHLVKVAPWEYVSATTAN  71

Query  65   -------GAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWL  101
                   G+ +  FGF M     R  Y    V+    ++R KWL
Sbjct  72   SILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWL  111

>PHYRA_83768
Length=735

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGA  66
            +PP  E P+  G  +L NI PH Y +G+MGA
Sbjct  619  NPPATEIPS--GYKWLYNITPHRYTIGIMGA  647

>PHYRA_77033
Length=1372

 Score = 35.8 bits (81),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  36    HPPHGETPAHKGSFYLSNIAPHEYVVGVMGA  66
             +PP  E P+  G  +L NI PH Y +G+MGA
Sbjct  1256  NPPATEIPS--GYKWLYNITPHRYTIGIMGA  1284

>SPRG_06058
Length=1258

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)

Query  18  ARPTSCEGYVTKRGHF  33
           ARP  CEGY+TKRGH 
Sbjct  42  ARPVDCEGYLTKRGHL  57

>PHYCA_556081
Length=1363

 Score = 33.1 bits (74),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 4/32 (13%)

Query  36    HPPHGETPA-HKGSFYLSNIAPHEYVVGVMGA  66
             +PP  E P+ +K  +YL+   PH Y VG+MGA
Sbjct  1247  NPPATEVPSGYKWVYYLT---PHTYTVGIMGA  1275

>PPTG_04299
Length=1365

 Score = 32.3 bits (72),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  36    HPPHGETPAHKGSFYLSNIAPHEYVVGVMGA  66
             +PP  E P+  G  +L  I PH Y VG+MGA
Sbjct  1249  NPPATEIPS--GYKWLYAITPHTYSVGIMGA  1277

>PITG_07134
Length=1366

 Score = 32.0 bits (71),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  36    HPPHGETPAHKGSFYLSNIAPHEYVVGVMGA  66
             +PP  E P+  G  +L  I PH Y VG+MGA
Sbjct  1250  NPPATEIPS--GYKWLYAITPHTYSVGIMGA  1278

Lambda      K        H        a         alpha
   0.316    0.131    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 20685731850

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40