Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_8392147551381386374e-86
PHYSO_321155147551361385393e-71
PPTG_17126147551361385264e-69
PHYRA_95903147551341355091e-66
PHYCA_11834147551341355082e-66
PHALS_06479147551361385031e-65
PITG_18455147551321324882e-63
HYAP_07103147551641644582e-58
PYVX_18180147551351383798e-47
PYAP_17747147551341363321e-39
PYIW_19970147551301242851e-32
PYU1_G001736147551231272815e-32
CCA17542147551201232711e-30
PYIR_13454147551291292651e-29
CCI44820147551231262493e-27
SDRG_01782147551231232362e-25
H257_06293147551231252285e-24
SPRG_06335147551231232268e-24
H310_09224147551231252214e-23
HYAP_084991114710850943e-04
HYAP_085006526017250954e-04
PITG_137391114710550820.011
PHYSO_3150171114710950830.011
PPTG_092521114710550800.020
PHYKE_58411114712150810.024
SDRG_149121114710547790.030
SPRG_128831114710547790.034
PYIW_147431114710550770.054
PHALS_115641114710750770.055
H310_07567111479840750.11
PYVX_208541114710444750.11
PYU1_G0059631114710346750.12
CCA175211114710435740.18
PYIR_151861114710950720.33
CCI442321114710540720.34
PHYRA_816751114710650700.63
H257_07358111479840680.97
PHYCA_5353801114710850681.0
PYAR_232071114711246643.9
PYAP_228461114710450619.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_8392

Length=138
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_8392                                                            249        4e-86
PHYSO_321155                                                          212        3e-71
PPTG_17126                                                            207        4e-69
PHYRA_95903                                                           200        1e-66
PHYCA_11834                                                           200        2e-66
PHALS_06479                                                           198        1e-65
PITG_18455                                                            192        2e-63
HYAP_07103                                                            181        2e-58
PYVX_18180                                                            150        8e-47
PYAP_17747                                                            132        1e-39
PYIW_19970                                                            114        1e-32
PYU1_G001736                                                          112        5e-32
CCA17542                                                              108        1e-30
PYIR_13454                                                            106        1e-29
CCI44820                                                              100        3e-27
SDRG_01782                                                            95.5       2e-25
H257_06293                                                            92.4       5e-24
SPRG_06335                                                            91.7       8e-24
H310_09224                                                            89.7       4e-23
HYAP_08499                                                            40.8       3e-04
HYAP_08500                                                            41.2       4e-04
PITG_13739                                                            36.2       0.011
PHYSO_315017                                                          36.6       0.011
PPTG_09252                                                            35.4       0.020
PHYKE_5841                                                            35.8       0.024
SDRG_14912                                                            35.0       0.030
SPRG_12883                                                            35.0       0.034
PYIW_14743                                                            34.3       0.054
PHALS_11564                                                           34.3       0.055
H310_07567                                                            33.5       0.11 
PYVX_20854                                                            33.5       0.11 
PYU1_G005963                                                          33.5       0.12 
CCA17521                                                              33.1       0.18 
PYIR_15186                                                            32.3       0.33 
CCI44232                                                              32.3       0.34 
PHYRA_81675                                                           31.6       0.63 
H257_07358                                                            30.8       0.97 
PHYCA_535380                                                          30.8       1.0  
PYAR_23207                                                            29.3       3.9  
PYAP_22846                                                            28.1       9.7  

>PHYKE_8392
Length=138

 Score = 249 bits (637),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/138 (100%), Positives = 138/138 (100%), Gaps = 0/138 (0%)

Query  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqss  60
            MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSS
Sbjct  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSS  60

Query  61   lsylkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120
            LSYLKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL
Sbjct  61   LSYLKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120

Query  121  MRRQHFMDRKSGPPRPMF  138
            MRRQHFMDRKSGPPRPMF
Sbjct  121  MRRQHFMDRKSGPPRPMF  138

>PHYSO_321155
Length=136

 Score = 212 bits (539),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 2/138 (1%)

Query  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqss  60
            MAEAARELRPLYKKLLR+AQ+LPEPKR QSL QIRREFR+HGDL+DP+ VS L+Q AQSS
Sbjct  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60

Query  61   lsylkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120
            LSYLKIVTPR E  SN+GVQR+IYRNGQRVNAAE E KGEENARYKTQD+EAGLKRHHQL
Sbjct  61   LSYLKIVTPRGE--SNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQL  118

Query  121  MRRQHFMDRKSGPPRPMF  138
            +RRQ+FMDRKSGPPRP+F
Sbjct  119  LRRQYFMDRKSGPPRPIF  136

>PPTG_17126
Length=136

 Score = 207 bits (526),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 2/138 (1%)

Query  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqss  60
            MAEA RELRPLYKKLLR+AQ+LPEPKR  S+ QIRR+FRNHGDL+DP+EVS L+Q AQSS
Sbjct  1    MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60

Query  61   lsylkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120
            LSYLKIVTPR   ESN GVQRYIYRNGQRVNA E EEKGEENAR+KTQDME GL+RHHQL
Sbjct  61   LSYLKIVTPR--AESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQL  118

Query  121  MRRQHFMDRKSGPPRPMF  138
            +RRQ+F+DRKSGPPRP+F
Sbjct  119  LRRQYFLDRKSGPPRPIF  136

>PHYRA_95903
Length=134

 Score = 200 bits (509),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 2/135 (1%)

Query  4    AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsy  63
            AARELRPLYKKLLR+AQ+LPEPKR QSL QIRREFR+H +L+DPKEVS L+Q AQSSL Y
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61

Query  64   lkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRR  123
            LKIVTPR   ESN G+QRYIYRNGQRVNA E+E  GEENARYKTQD+E GLKRHHQL+RR
Sbjct  62   LKIVTPR--AESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRR  119

Query  124  QHFMDRKSGPPRPMF  138
            QHFMDRKSGPPRP+F
Sbjct  120  QHFMDRKSGPPRPIF  134

>PHYCA_11834
Length=134

 Score = 200 bits (508),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 2/135 (1%)

Query  4    AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsy  63
            AARELRPLYKKLLR+AQ+LPEPKR  S+ QIRREFR+H DL+DPKEVSKLLQ AQSSL Y
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61

Query  64   lkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRR  123
            LKIVTPR   ESN+GVQR+IYR+G+RVNA ELE KGEENAR+KTQDMEAGLKRHHQL+RR
Sbjct  62   LKIVTPR--AESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRR  119

Query  124  QHFMDRKSGPPRPMF  138
            Q+FMDRKSGPPRP+F
Sbjct  120  QYFMDRKSGPPRPIF  134

>PHALS_06479
Length=136

 Score = 198 bits (503),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 122/138 (88%), Gaps = 2/138 (1%)

Query  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqss  60
            M+ A RELRPLYKKLLR+AQ LP+ KR  S+ QIRREFR H DL+DPKEVS+ +Q AQSS
Sbjct  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60

Query  61   lsylkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120
            LSYLKI+TPR  TESN+GVQR+IYRNGQRVNAA+ E+KG ENAR+KTQDMEAG KRHHQL
Sbjct  61   LSYLKIITPR--TESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQL  118

Query  121  MRRQHFMDRKSGPPRPMF  138
            +RRQ+FMDRKSGPPRP+F
Sbjct  119  LRRQYFMDRKSGPPRPIF  136

>PITG_18455
Length=132

 Score = 192 bits (488),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 119/132 (90%), Gaps = 2/132 (2%)

Query  7    ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsylkI  66
            ELRPLYKKLLR+AQ+LPEPKR  S+ QIRR+FR+HGD +DPKEVS L+Q AQSSLSYLKI
Sbjct  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62

Query  67   VTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHF  126
            VTPR   ESN+GVQRYIYRNGQRVNAAE EEKG ENAR+K QDME GLKRHHQL++RQ+F
Sbjct  63   VTPR--AESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120

Query  127  MDRKSGPPRPMF  138
            M+RKSGPPRP+F
Sbjct  121  MNRKSGPPRPIF  132

>HYAP_07103
Length=164

 Score = 181 bits (458),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 123/164 (75%), Gaps = 33/164 (20%)

Query  8    LRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsylkIV  67
            +RPLYKKLLR+AQ+LPEPKR +SL QIRREFR HGDL+DPKEVS LLQ AQSS+ +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  68   TPRDETE---------------------------------SNSGVQRYIYRNGQRVNAAE  94
            TPR E+                                  S++G+QR++YR+G+R++AAE
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  95   LEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPRPMF  138
            L++KGEENARYKTQD+EAG+KRHHQL+RRQHFMDRKSGPPRP+F
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PYVX_18180
Length=135

 Score = 150 bits (379),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 109/138 (79%), Gaps = 3/138 (2%)

Query  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqss  60
            MA  A ELRPLYKKLLR+AQ+LPEPKR  +++QIR EFR+H +++D  EV+KLLQ AQS 
Sbjct  1    MASPA-ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQ  59

Query  61   lsylkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120
            L YLKIVTPR    S SGV+RYIYRNGQRV+A   E  GE+ ARYKT DME  LKRHHQL
Sbjct  60   LGYLKIVTPRGP--SASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQL  117

Query  121  MRRQHFMDRKSGPPRPMF  138
            +RRQHFMDR   PPRP+F
Sbjct  118  LRRQHFMDRGVAPPRPIF  135

>PYAP_17747
Length=134

 Score = 132 bits (332),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 105/136 (77%), Gaps = 4/136 (3%)

Query  4    AARELRPLYKKLLRMAQALP-EPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqssls  62
            A  ELRPLYK+LLR+A++LP E KR  ++ QIR EFR+  D  DPKEV+ L+Q AQ+ + 
Sbjct  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61

Query  63   ylkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMR  122
            YLKIVTPR  + +++GV+ ++Y NG+RV++++++ + EE ARYKT D E  ++RH+QL+R
Sbjct  62   YLKIVTPR--STADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLR  118

Query  123  RQHFMDRKSGPPRPMF  138
            RQHFMDR   PP+P+F
Sbjct  119  RQHFMDRGVAPPKPIF  134

>PYIW_19970
Length=130

 Score = 114 bits (285),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 5/124 (4%)

Query  7    ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsylkI  66
            +LRP+YKKLL++A+ LPE KR  +  QIR EFR+  +LSDPKE++ LL  AQSS+SYLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  67   VTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHF  126
            VTPR    S++GV+ YIY+NGQRV AA + E G   A+Y+  D    + RH +L+RRQHF
Sbjct  72   VTPR--KSSDAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHF  126

Query  127  MDRK  130
            MDRK
Sbjct  127  MDRK  130

>PYU1_G001736
Length=123

 Score = 112 bits (281),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 90/127 (71%), Gaps = 5/127 (4%)

Query  4    AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsy  63
            A+ +LRP+YKKLL++AQ LP  KR  ++ QIRREFR H    DPKE++ LL  AQSS+ Y
Sbjct  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61

Query  64   lkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRR  123
            LKIVTPR    S++GV+ Y+Y  G+RV A       E+ ARYKT D  A ++RH QL+RR
Sbjct  62   LKIVTPR--ATSDAGVKNYVYIKGKRVEA---AGAAEDGARYKTADYNAQMQRHVQLLRR  116

Query  124  QHFMDRK  130
            QHFMDRK
Sbjct  117  QHFMDRK  123

>CCA17542
Length=120

 Score = 108 bits (271),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 92/123 (75%), Gaps = 5/123 (4%)

Query  7    ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsylkI  66
            + R +YK+L+R+A++LP  K+  +L  IR EFR H D+SDP ++S+LL+ AQS++ YLKI
Sbjct  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62

Query  67   VTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHF  126
            VTP     S+SGV+R+++++G+R+   E   K  E AR+K QD+  GLKRHHQL+RRQHF
Sbjct  63   VTP--HKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHF  117

Query  127  MDR  129
            MDR
Sbjct  118  MDR  120

>PYIR_13454
Length=129

 Score = 106 bits (265),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 94/129 (73%), Gaps = 5/129 (4%)

Query  2    AEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqssl  61
            A A  +LRP+YKKLL++A+ LPE KR  +L+QIR EFR   D+SDPKE++ LL  AQSS+
Sbjct  6    AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65

Query  62   sylkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLM  121
             YLKIVTPR    S++GV+ YIY+NGQRV A  + E G   A+Y   D  A ++RH +L+
Sbjct  66   GYLKIVTPR--KSSDAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNAQMQRHQKLL  120

Query  122  RRQHFMDRK  130
            RRQHFMDRK
Sbjct  121  RRQHFMDRK  129

>CCI44820
Length=123

 Score = 100 bits (249),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 92/126 (73%), Gaps = 5/126 (4%)

Query  4    AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsy  63
            A  E R ++KK++++A++LP  K+  +L  IR EFR H D+ DP ++++LL+ AQS++ Y
Sbjct  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62

Query  64   lkIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRR  123
            LKIVTP     S+SGV+ ++Y++G+R+   E   +  E A++K QDME GLKRH+QL+RR
Sbjct  63   LKIVTP--HKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRR  117

Query  124  QHFMDR  129
            Q+FMDR
Sbjct  118  QYFMDR  123

>SDRG_01782
Length=123

 Score = 95.5 bits (236),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 86/123 (70%), Gaps = 4/123 (3%)

Query  8    LRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsylkIV  67
            +R  YKKLL++A+++P+ +R Q+L ++R EFR H   + P+E+ +LL+ AQS +SYLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIV  64

Query  68   TPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFM  127
            TP+  + S  G   ++Y+NGQR++  EL     ++A  KT D  A + +H QL+RRQHFM
Sbjct  65   TPKKSSSSTQG-SHFVYKNGQRIDGREL---SADSATIKTHDYNAMMTKHVQLVRRQHFM  120

Query  128  DRK  130
            DRK
Sbjct  121  DRK  123

>H257_06293
Length=123

 Score = 92.4 bits (228),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 90/125 (72%), Gaps = 4/125 (3%)

Query  6    RELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsylk  65
            + +R  YKKL+++AQ+LP  ++  +L +IR +FR+ G +S  +E+ KL+  AQS +SYLK
Sbjct  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62

Query  66   IVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQH  125
            IVTP+   +  SG QR+IY++G+R+++  L++ G  N   KT D+ A ++RH +L+RRQH
Sbjct  63   IVTPKRTPQ--SGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQH  118

Query  126  FMDRK  130
            FMDRK
Sbjct  119  FMDRK  123

>SPRG_06335
Length=123

 Score = 91.7 bits (226),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 84/123 (68%), Gaps = 4/123 (3%)

Query  8    LRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsylkIV  67
            +R  YKKLL++A+++P+ +R Q+L ++R EFR H   + P+E+ +LL+ AQS +SYLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIV  64

Query  68   TPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFM  127
            TP+       G   ++Y+NGQR++  EL     ++A  KT D  A + +H QL+RRQHFM
Sbjct  65   TPKKSPSPGQG-NHFVYKNGQRIDGREL---SADSATIKTADYNAMMTKHVQLVRRQHFM  120

Query  128  DRK  130
            DRK
Sbjct  121  DRK  123

>H310_09224
Length=123

 Score = 89.7 bits (221),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 88/125 (70%), Gaps = 4/125 (3%)

Query  6    RELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVskllqlaqsslsylk  65
            + +R  YKKL+++AQ+LP  ++  +L ++R EFR+HG ++   ++ K++  AQS +SYLK
Sbjct  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62

Query  66   IVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQH  125
            IVTP+   +++   QRYIY++G+R++   +++    NA  KT D  A ++RH +L+RRQH
Sbjct  63   IVTPKRAPQTSP--QRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQH  118

Query  126  FMDRK  130
            FMDRK
Sbjct  119  FMDRK  123

>HYAP_08499
Length=108

 Score = 40.8 bits (94),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAEA   LR +Y+++L++AQ  P  KR   +  I+ EFR + +LSD ++V
Sbjct  1   MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKV  49

>HYAP_08500
Length=172

 Score = 41.2 bits (95),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
            MAEA   LR +Y+++L++AQ  P  KR   +  I+ EFR + +LSD ++V
Sbjct  65   MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKV  113

>PITG_13739
Length=105

 Score = 36.2 bits (82),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAE  RE+  +Y+++L++AQ  P  KR   +  I+ EF  + DL+D +++
Sbjct  1   MAET-REVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKI  49

>PHYSO_315017
Length=109

 Score = 36.6 bits (83),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAE    LR +Y+++L++AQ  P  KR   +  I+ EF  + DL+D +++
Sbjct  1   MAETKEVLR-MYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKI  49

>PPTG_09252
Length=105

 Score = 35.4 bits (80),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAE    LR LY+++L++AQ  P  KR   +  I+ EF  + +L+D +++
Sbjct  1   MAETKEVLR-LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKI  49

>PHYKE_5841
Length=121

 Score = 35.8 bits (81),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAE  +E+  +Y+++L++AQ  P  KR   +  I+ EF  H  L+D +++
Sbjct  1   MAEV-KEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKI  49

>SDRG_14912
Length=105

 Score = 35.0 bits (79),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 14/47 (30%), Positives = 29/47 (62%), Gaps = 0/47 (0%)

Query  4   AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           A R +  +Y+++L++AQ  P  K+ Q ++ I+ EF  +  L+D  ++
Sbjct  2   AGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKI  48

>SPRG_12883
Length=105

 Score = 35.0 bits (79),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 14/47 (30%), Positives = 29/47 (62%), Gaps = 0/47 (0%)

Query  4   AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           A R +  +Y+++L++AQ  P  K+ Q ++ I+ EF  +  L+D  ++
Sbjct  2   AGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKI  48

>PYIW_14743
Length=105

 Score = 34.3 bits (77),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAEA +E+  LY+++L++A   P  KR   + +I+ EF  +  L+D  ++
Sbjct  1   MAEA-KEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKI  49

>PHALS_11564
Length=107

 Score = 34.3 bits (77),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAE  + LR +Y++LL++AQ  P  KR   +  I+ EF  +  ++D +++
Sbjct  1   MAETKQVLR-VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKI  49

>H310_07567
Length=98

 Score = 33.5 bits (75),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 27/40 (68%), Gaps = 0/40 (0%)

Query  11  LYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           +Y+++L++A+  P  KR Q +  I+ EF ++  L+DP ++
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKI  49

>PYVX_20854
Length=104

 Score = 33.5 bits (75),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 0/44 (0%)

Query  7   ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           E+  LY+++L++AQ  P  KR   +  I+ EF  +  LSD ++V
Sbjct  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQV  49

>PYU1_G005963
Length=103

 Score = 33.5 bits (75),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 28/46 (61%), Gaps = 0/46 (0%)

Query  5   ARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           A+E+  +Y+++L++A   P  KR+  +  I+ EFR +  L+D   +
Sbjct  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAI  49

>CCA17521
Length=104

 Score = 33.1 bits (74),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (66%), Gaps = 0/35 (0%)

Query  11  LYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLS  45
           LY+++LR+A+  P  KR   ++ IR EFR   D++
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDIT  43

>PYIR_15186
Length=109

 Score = 32.3 bits (72),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAEA +E+  +Y+++L++A   P  KR+  + +I+ EF  +  L+D  ++
Sbjct  1   MAEA-KEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKI  49

>CCI44232
Length=105

 Score = 32.3 bits (72),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 0/40 (0%)

Query  11  LYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           LY+++LR+A+  P  KR   +  IR EFR   +++ P  +
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAI  48

>PHYRA_81675
Length=106

 Score = 31.6 bits (70),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAE    +R +Y+++L++AQ  P  KR   +  I+ EF  +  L+D +++
Sbjct  1   MAETKEVVR-MYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKI  49

>H257_07358
Length=98

 Score = 30.8 bits (68),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 25/40 (63%), Gaps = 0/40 (0%)

Query  11  LYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           +Y+++L++A   P  K+ Q +  I+ EF  +  L+DP ++
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKI  49

>PHYCA_535380
Length=108

 Score = 30.8 bits (68),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MAE    LR +Y+++L++A   P  KR   +  I+ EF  +  L+D + +
Sbjct  1   MAETKEVLR-MYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRI  49

>PYAR_23207
Length=112

 Score = 29.3 bits (64),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  5   ARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           +RE+  LY+++L++A+  P  KR   +  I+ EF     L+D   +
Sbjct  7   SREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAI  52

>PYAP_22846
Length=104

 Score = 28.1 bits (61),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
           MA+  + LR LY+ +L++A+  P  KR   +  I+ EF      +D + +
Sbjct  1   MADKQKVLR-LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTI  49

Lambda      K        H        a         alpha
   0.317    0.132    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3593167830

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40