Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_83911475377876539450.0
PHYCA_5561601475364963028030.0
PITG_184521475385663527250.0
HYAP_070951475361359925040.0
PHALS_064811475364462024220.0
PHYSO_3489011475352648823490.0
PHYRA_508551475348947723060.0
PYAP_177619907562263023000.0
PYIR_134521475364565022970.0
PYIW_199721475360963221540.0
PYAR_135699907549448219620.0
PYVX_181701475351055218910.0
H310_085901475364063018910.0
H257_084361475364261818840.0
SDRG_167201475362863017870.0
SPRG_141031475362863017860.0
SPRG_0407412408750949610663e-136
SDRG_1440812408752849610562e-134
SDRG_150451241574944796443e-74
SDRG_111311368074944796391e-73
SDRG_038221356704944756373e-73
PHYSO_254571109044894996364e-73
PYAP_21882109045024856365e-73
SDRG_03823114284974836356e-73
PHALS_08068109044975036312e-72
PPTG_18033109045005016304e-72
PHYCA_504517114284934756285e-72
PYAR_17512109045335076272e-71
PYAP_234351008029514796502e-71
PPTG_09787114284934796223e-71
PHYKE_103271090612004916502e-70
PYIR_17506109045094846182e-70
SPRG_11769109044534766123e-70
SDRG_12187109044624756134e-70
PHYSO_550665114284914796093e-69
PITG_14083114284934766066e-69
H257_09722114285184856087e-69
PHYRA_72037114284934756032e-68
SPRG_05609114284964756023e-68
PHYRA_71927109044854886004e-68
CCI11048114284964646015e-68
CCA23647114284964675997e-68
H310_144471462305014835953e-67
H310_11259114285194895921e-66
PYIW_25301109045124925851e-65
PITG_13427109044634755811e-65
PHYRA_81103712622521405612e-65
H257_170371462304984645804e-65
PHALS_09136114284934795795e-65
PHYCA_7619109044624735766e-65
HYAP_08763114284734635751e-64
PHYKE_6836114284934755542e-61
PYVX_21517109044824985444e-60
PYIR_23431114284684615012e-54
HYAP_04843109044304204974e-54
PYAR_177141008024444834967e-54
PHYKE_4541759501471434611e-52
PHYRA_81102147542511444665e-52
PHYRA_72504695162511444665e-52
PPTG_17125147542831414601e-50
PITG_18453147542521414525e-50
PHYCA_129485147542511444519e-50
PHYKE_6286599492501414464e-49
PHYCA_12149480282481374439e-49
PHYCA_10034368662741374422e-48
PPTG_06973368661651384297e-48
PHYRA_7182580282541414291e-46
PYVX_16175114284464824272e-44
PPTG_16851236932491384095e-44
PPTG_0889380282511393963e-42
PPTG_07667422181431403793e-41
PITG_0971680282501393866e-41
PITG_19936157132491403841e-40
PHYSO_26126580282471373805e-40
PPTG_07668205111361403652e-39
PHYSO_526774157132491383743e-39
PHYCA_118548170262461413734e-39
PYIR_20273124015054863896e-39
CCA22989124014944843888e-39
CCI10477124014944823879e-39
PPTG_07664170262451383672e-38
PYAP_226451707615654793929e-38
PHYRA_74307422182491413576e-37
PHYCA_132252157132491403551e-36
PHYSO_254108170262461373532e-36
PHYCA_9298368522481403532e-36
PHYSO_526623599492491383532e-36
PITG_04208205112451423513e-36
PHYSO_52607137012491403514e-36
PYIR_13252817012361393461e-35
PITG_22053170262451383461e-35
PYIR_13251817002361373452e-35
PITG_19938353892451423452e-35
PYU1_G001737147531331133334e-35
PYU1_G014259109042442333425e-35
PHYRA_74310599492491403426e-35
PHYRA_52440170262431393401e-34
PHYSO_526832353892491403391e-34
SPRG_199431356703432583462e-34
PITG_0426737012791413402e-34
PHYRA_74343698872491403382e-34
HYAP_12621124015014803542e-34
PYU1_G011237817002351393311e-33
PYVX_22467135312361393302e-33
PHYKE_7568608783721383367e-33
PHYCA_11951135312341393257e-33
PHYCA_118674205112811403281e-32
PYU1_G011231459142381393241e-32
PHYSO_507736135312361393241e-32
PITG_0424836902451393232e-32
PHYSO_249751459202381393223e-32
PPTG_07661600202231473203e-32
PHYKE_7566459142601373233e-32
PHYCA_11855136902451393223e-32
PYIR_13275135312371393203e-32
PYU1_G011230817012381393213e-32
PHYRA_72438135312361393204e-32
PPTG_17245238632571473224e-32
PPTG_15233231122351393204e-32
PYU1_G011235963762381393196e-32
PPTG_15231135312581333207e-32
PHYRA_71308231122361393188e-32
PHYRA_72385694602371393188e-32
PPTG_19506247322231473161e-31
PPTG_0766037012161413123e-31
PHYRA_74306205112451393126e-31
PHYKE_5753763302381373118e-31
PPTG_17049237772551443119e-31
PHYRA_71310459142371393091e-30
PYVX_21248124015024373241e-30
PHYRA_74356698952441393072e-30
PYIW_25259817002461393063e-30
PITG_16866135312381333054e-30
PHYCA_122048693172361393054e-30
PHYRA_72386459152451373046e-30
PHYRA_72344817002451373046e-30
PHYSO_249691459142251393028e-30
PHYKE_9680124014984993189e-30
PHYRA_76249246513261393099e-30
PHYRA_4287689222131373001e-29
PITG_0420036612471383021e-29
PHYSO_527352600202451403012e-29
PHALS_09942124014964873152e-29
PHYCA_129784817002461373002e-29
PPTG_0767136902461403002e-29
PHYCA_108039563202151372972e-29
PITG_1083989221341442903e-29
SPRG_09825124014924913143e-29
PHYSO_329843510942391412966e-29
PHYSO_556052124015004803126e-29
PHYRA_72215124014994823118e-29
PYU1_G011236135312371392959e-29
PITG_15359124014964853091e-28
SDRG_06945124014924913072e-28
PHYRA_71477693172381402922e-28
PHYSO_254223422182271382903e-28
PYIW_24350135311901392873e-28
PPTG_13736226162361412895e-28
PHYCA_107869246513421372966e-28
PPTG_15230817002521372906e-28
PYAR_20075170764694753018e-28
PHYSO_47716589221321392771e-27
PHYKE_2376459153221392903e-27
PHYCA_683589222101392813e-27
PHYCA_123621124014954852983e-27
PPTG_19331246513681392915e-27
PHYSO_249692459152481372825e-27
PHYKE_7564459204731372956e-27
PHYRA_71931510942391472817e-27
PHYCA_9358368552521372827e-27
PHYCA_123779173642771392839e-27
PHYRA_71404563202451392809e-27
PHYRA_72433694822451392809e-27
PHYKE_7565817001981402752e-26
PPTG_08017207076161372925e-26
PHYSO_25411236902241372735e-26
PYU1_G011233694602391402746e-26
PPTG_15224963762461402747e-26
PPTG_17409743732351392738e-26
PHYSO_406265173642321392729e-26
PHYSO_259736247322311182729e-26
PPTG_2217436987711342882e-25
PPTG_08005173647591392864e-25
PHYCA_11835636612521402676e-25
CCI50816151568074872821e-24
PHYKE_4438758943391392692e-24
PHYRA_45462517581811372582e-24
PHYKE_494670892631402642e-24
PYIW_24688114282592882633e-24
PPTG_19330563203161392673e-24
CCA16670151565204892753e-24
PITG_22668173645191392745e-24
PITG_22916720282481402606e-24
PITG_23094176762371372596e-24
PPTG_18464243182471422597e-24
PHYRA_72345517562401452589e-24
PHYRA_5242336901931132549e-24
PHYSO_414520550602131372522e-23
PHYSO_254099368522351142533e-23
PPTG_15220176762361382533e-23
PHYRA_75425176762371432533e-23
PPTG_15234608782351382533e-23
PHYKE_1224746861321372443e-23
PHYCA_129892608782341432524e-23
PHYSO_490000575402411392491e-22
PHYRA_7388315665515152631e-22
PHYSO_468315563202551392491e-22
H257_16541124014944712612e-22
PHALS_06162173644881372593e-22
PHYCA_18373353892461402473e-22
PPTG_07089202542551122473e-22
PHYRA_71307608782371382463e-22
PHYSO_334500517582351392453e-22
PHYCA_1246236916177762414e-22
PHYRA_46230550602121402434e-22
PHYCA_12320542568177762404e-22
PHYSO_397673703072241392444e-22
PHYSO_329114510052361022437e-22
PITG_18935150674804842557e-22
PHYSO_334487517562581392441e-21
PHYSO_560790608782371352421e-21
PYAR_16840151565365122551e-21
PHYCA_69457511262131372391e-21
PHYRA_52960691982231392392e-21
PHYRA_52955691972231392392e-21
PHYCA_133455437571751392352e-21
PHYSO_334498517572291232392e-21
H310_02523124014944602513e-21
PHYCA_50444515665485342523e-21
PYVX_20512151565284972514e-21
PHYCA_69479391932131372364e-21
PHYCA_576423176762341392375e-21
HYAP_0924370892661262385e-21
PYU1_G011605151565244852487e-21
H310_0764115665485192488e-21
PHYCA_10840970892821392389e-21
PYAP_19280151565124932471e-20
PPTG_0093815665505342471e-20
PHYCA_69480391942131392321e-20
PHYCA_69477391922131392321e-20
HYAP_05562637062071562311e-20
PHYRA_41766511262091382311e-20
H257_01186151564964842451e-20
PHYCA_507156763301321392242e-20
PHYRA_5432770892191122312e-20
PHALS_13513157132401102322e-20
PPTG_13769592663491372382e-20
PHALS_0608470892601392314e-20
PYIW_251901648732061852275e-20
PHALS_1202815665795192425e-20
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_8391

Length=778
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_8391                                                            1524       0.0   
PHYCA_556160                                                          1084       0.0   
PITG_18452                                                            1054       0.0   
HYAP_07095                                                            969        0.0   
PHALS_06481                                                           937        0.0   
PHYSO_348901                                                          909        0.0   
PHYRA_50855                                                           892        0.0   
PYAP_17761                                                            890        0.0   
PYIR_13452                                                            889        0.0   
PYIW_19972                                                            834        0.0   
PYAR_13569                                                            760        0.0   
PYVX_18170                                                            733        0.0   
H310_08590                                                            733        0.0   
H257_08436                                                            730        0.0   
SDRG_16720                                                            692        0.0   
SPRG_14103                                                            692        0.0   
SPRG_04074                                                            415        3e-136
SDRG_14408                                                            411        2e-134
SDRG_15045                                                            252        3e-74 
SDRG_11131                                                            250        1e-73 
SDRG_03822                                                            249        3e-73 
PHYSO_254571                                                          249        4e-73 
PYAP_21882                                                            249        5e-73 
SDRG_03823                                                            249        6e-73 
PHALS_08068                                                           247        2e-72 
PPTG_18033                                                            247        4e-72 
PHYCA_504517                                                          246        5e-72 
PYAR_17512                                                            246        2e-71 
PYAP_23435                                                            254        2e-71 
PPTG_09787                                                            244        3e-71 
PHYKE_10327                                                           254        2e-70 
PYIR_17506                                                            242        2e-70 
SPRG_11769                                                            240        3e-70 
SDRG_12187                                                            240        4e-70 
PHYSO_550665                                                          239        3e-69 
PITG_14083                                                            238        6e-69 
H257_09722                                                            238        7e-69 
PHYRA_72037                                                           236        2e-68 
SPRG_05609                                                            236        3e-68 
PHYRA_71927                                                           235        4e-68 
CCI11048                                                              236        5e-68 
CCA23647                                                              235        7e-68 
H310_14447                                                            233        3e-67 
H310_11259                                                            232        1e-66 
PYIW_25301                                                            229        1e-65 
PITG_13427                                                            228        1e-65 
PHYRA_81103                                                           220        2e-65 
H257_17037                                                            228        4e-65 
PHALS_09136                                                           227        5e-65 
PHYCA_7619                                                            226        6e-65 
HYAP_08763                                                            226        1e-64 
PHYKE_6836                                                            218        2e-61 
PYVX_21517                                                            214        4e-60 
PYIR_23431                                                            197        2e-54 
HYAP_04843                                                            196        4e-54 
PYAR_17714                                                            195        7e-54 
PHYKE_4541                                                            182        1e-52 
PHYRA_81102                                                           184        5e-52 
PHYRA_72504                                                           184        5e-52 
PPTG_17125                                                            181        1e-50 
PITG_18453                                                            178        5e-50 
PHYCA_129485                                                          178        9e-50 
PHYKE_6286                                                            176        4e-49 
PHYCA_121494                                                          175        9e-49 
PHYCA_10034                                                           174        2e-48 
PPTG_06973                                                            169        7e-48 
PHYRA_71825                                                           169        1e-46 
PYVX_16175                                                            169        2e-44 
PPTG_16851                                                            162        5e-44 
PPTG_08893                                                            157        3e-42 
PPTG_07667                                                            150        3e-41 
PITG_09716                                                            153        6e-41 
PITG_19936                                                            152        1e-40 
PHYSO_261265                                                          150        5e-40 
PPTG_07668                                                            145        2e-39 
PHYSO_526774                                                          148        3e-39 
PHYCA_118548                                                          148        4e-39 
PYIR_20273                                                            154        6e-39 
CCA22989                                                              154        8e-39 
CCI10477                                                              153        9e-39 
PPTG_07664                                                            145        2e-38 
PYAP_22645                                                            155        9e-38 
PHYRA_74307                                                           142        6e-37 
PHYCA_132252                                                          141        1e-36 
PHYSO_254108                                                          140        2e-36 
PHYCA_9298                                                            140        2e-36 
PHYSO_526623                                                          140        2e-36 
PITG_04208                                                            139        3e-36 
PHYSO_526071                                                          139        4e-36 
PYIR_13252                                                            137        1e-35 
PITG_22053                                                            137        1e-35 
PYIR_13251                                                            137        2e-35 
PITG_19938                                                            137        2e-35 
PYU1_G001737                                                          132        4e-35 
PYU1_G014259                                                          136        5e-35 
PHYRA_74310                                                           136        6e-35 
PHYRA_52440                                                           135        1e-34 
PHYSO_526832                                                          135        1e-34 
SPRG_19943                                                            137        2e-34 
PITG_04267                                                            135        2e-34 
PHYRA_74343                                                           134        2e-34 
HYAP_12621                                                            140        2e-34 
PYU1_G011237                                                          132        1e-33 
PYVX_22467                                                            131        2e-33 
PHYKE_7568                                                            134        7e-33 
PHYCA_11951                                                           129        7e-33 
PHYCA_118674                                                          130        1e-32 
PYU1_G011231                                                          129        1e-32 
PHYSO_507736                                                          129        1e-32 
PITG_04248                                                            129        2e-32 
PHYSO_249751                                                          128        3e-32 
PPTG_07661                                                            127        3e-32 
PHYKE_7566                                                            129        3e-32 
PHYCA_118551                                                          128        3e-32 
PYIR_13275                                                            127        3e-32 
PYU1_G011230                                                          128        3e-32 
PHYRA_72438                                                           127        4e-32 
PPTG_17245                                                            128        4e-32 
PPTG_15233                                                            127        4e-32 
PYU1_G011235                                                          127        6e-32 
PPTG_15231                                                            127        7e-32 
PHYRA_71308                                                           127        8e-32 
PHYRA_72385                                                           127        8e-32 
PPTG_19506                                                            126        1e-31 
PPTG_07660                                                            124        3e-31 
PHYRA_74306                                                           124        6e-31 
PHYKE_5753                                                            124        8e-31 
PPTG_17049                                                            124        9e-31 
PHYRA_71310                                                           123        1e-30 
PYVX_21248                                                            129        1e-30 
PHYRA_74356                                                           122        2e-30 
PYIW_25259                                                            122        3e-30 
PITG_16866                                                            122        4e-30 
PHYCA_122048                                                          122        4e-30 
PHYRA_72386                                                           121        6e-30 
PHYRA_72344                                                           121        6e-30 
PHYSO_249691                                                          120        8e-30 
PHYKE_9680                                                            127        9e-30 
PHYRA_76249                                                           123        9e-30 
PHYRA_42876                                                           120        1e-29 
PITG_04200                                                            120        1e-29 
PHYSO_527352                                                          120        2e-29 
PHALS_09942                                                           125        2e-29 
PHYCA_129784                                                          120        2e-29 
PPTG_07671                                                            120        2e-29 
PHYCA_108039                                                          119        2e-29 
PITG_10839                                                            116        3e-29 
SPRG_09825                                                            125        3e-29 
PHYSO_329843                                                          118        6e-29 
PHYSO_556052                                                          124        6e-29 
PHYRA_72215                                                           124        8e-29 
PYU1_G011236                                                          118        9e-29 
PITG_15359                                                            123        1e-28 
SDRG_06945                                                            122        2e-28 
PHYRA_71477                                                           117        2e-28 
PHYSO_254223                                                          116        3e-28 
PYIW_24350                                                            115        3e-28 
PPTG_13736                                                            115        5e-28 
PHYCA_107869                                                          118        6e-28 
PPTG_15230                                                            116        6e-28 
PYAR_20075                                                            120        8e-28 
PHYSO_477165                                                          111        1e-27 
PHYKE_2376                                                            116        3e-27 
PHYCA_6835                                                            112        3e-27 
PHYCA_123621                                                          119        3e-27 
PPTG_19331                                                            116        5e-27 
PHYSO_249692                                                          113        5e-27 
PHYKE_7564                                                            118        6e-27 
PHYRA_71931                                                           112        7e-27 
PHYCA_9358                                                            113        7e-27 
PHYCA_123779                                                          113        9e-27 
PHYRA_71404                                                           112        9e-27 
PHYRA_72433                                                           112        9e-27 
PHYKE_7565                                                            110        2e-26 
PPTG_08017                                                            117        5e-26 
PHYSO_254112                                                          109        5e-26 
PYU1_G011233                                                          110        6e-26 
PPTG_15224                                                            110        7e-26 
PPTG_17409                                                            109        8e-26 
PHYSO_406265                                                          109        9e-26 
PHYSO_259736                                                          109        9e-26 
PPTG_22174                                                            115        2e-25 
PPTG_08005                                                            114        4e-25 
PHYCA_118356                                                          107        6e-25 
CCI50816                                                              113        1e-24 
PHYKE_4438                                                            108        2e-24 
PHYRA_45462                                                           103        2e-24 
PHYKE_4946                                                            106        2e-24 
PYIW_24688                                                            105        3e-24 
PPTG_19330                                                            107        3e-24 
CCA16670                                                              110        3e-24 
PITG_22668                                                            110        5e-24 
PITG_22916                                                            104        6e-24 
PITG_23094                                                            104        6e-24 
PPTG_18464                                                            104        7e-24 
PHYRA_72345                                                           103        9e-24 
PHYRA_52423                                                           102        9e-24 
PHYSO_414520                                                          101        2e-23 
PHYSO_254099                                                          102        3e-23 
PPTG_15220                                                            102        3e-23 
PHYRA_75425                                                           102        3e-23 
PPTG_15234                                                            102        3e-23 
PHYKE_1224                                                            98.6       3e-23 
PHYCA_129892                                                          101        4e-23 
PHYSO_490000                                                          100        1e-22 
PHYRA_73883                                                           105        1e-22 
PHYSO_468315                                                          100        1e-22 
H257_16541                                                            105        2e-22 
PHALS_06162                                                           104        3e-22 
PHYCA_18373                                                           99.8       3e-22 
PPTG_07089                                                            99.8       3e-22 
PHYRA_71307                                                           99.4       3e-22 
PHYSO_334500                                                          99.0       3e-22 
PHYCA_12462                                                           97.4       4e-22 
PHYRA_46230                                                           98.2       4e-22 
PHYCA_123205                                                          97.1       4e-22 
PHYSO_397673                                                          98.6       4e-22 
PHYSO_329114                                                          98.2       7e-22 
PITG_18935                                                            102        7e-22 
PHYSO_334487                                                          98.6       1e-21 
PHYSO_560790                                                          97.8       1e-21 
PYAR_16840                                                            102        1e-21 
PHYCA_69457                                                           96.7       1e-21 
PHYRA_52960                                                           96.7       2e-21 
PHYRA_52955                                                           96.7       2e-21 
PHYCA_133455                                                          95.1       2e-21 
PHYSO_334498                                                          96.7       2e-21 
H310_02523                                                            101        3e-21 
PHYCA_504445                                                          101        3e-21 
PYVX_20512                                                            101        4e-21 
PHYCA_69479                                                           95.5       4e-21 
PHYCA_576423                                                          95.9       5e-21 
HYAP_09243                                                            96.3       5e-21 
PYU1_G011605                                                          100        7e-21 
H310_07641                                                            100        8e-21 
PHYCA_108409                                                          96.3       9e-21 
PYAP_19280                                                            99.8       1e-20 
PPTG_00938                                                            99.8       1e-20 
PHYCA_69480                                                           94.0       1e-20 
PHYCA_69477                                                           94.0       1e-20 
HYAP_05562                                                            93.6       1e-20 
PHYRA_41766                                                           93.6       1e-20 
H257_01186                                                            99.0       1e-20 
PHYCA_507156                                                          90.9       2e-20 
PHYRA_54327                                                           93.6       2e-20 
PHALS_13513                                                           94.0       2e-20 
PPTG_13769                                                            96.3       2e-20 
PHALS_06084                                                           93.6       4e-20 
PYIW_25190                                                            92.0       5e-20 
PHALS_12028                                                           97.8       5e-20 
PHYSO_510888                                                          93.2       6e-20 
PHYRA_47253                                                           96.7       6e-20 
H310_00561                                                            96.7       7e-20 
HYAP_05559                                                            92.8       8e-20 
HYAP_04977                                                            92.8       8e-20 
PPTG_12847                                                            94.0       1e-19 
PPTG_09121                                                            96.3       1e-19 
PYVX_22469                                                            95.9       1e-19 
HYAP_05558                                                            92.4       1e-19 
PYAR_25201                                                            89.7       1e-19 
PPTG_12853                                                            94.0       1e-19 
PHYRA_74617                                                           93.6       2e-19 
PPTG_07277                                                            92.4       2e-19 
PPTG_13000                                                            94.0       2e-19 
PHYRA_74630                                                           93.2       2e-19 
SPRG_12054                                                            95.5       2e-19 
PPTG_13026                                                            90.9       2e-19 
PYIW_19795                                                            95.1       2e-19 
SDRG_05060                                                            95.5       3e-19 
PPTG_12852                                                            92.8       3e-19 
PHYSO_365377                                                          90.1       3e-19 
PHYRA_52260                                                           90.5       3e-19 
SDRG_14446                                                            94.4       5e-19 
PHALS_10055                                                           94.4       5e-19 
PITG_08522                                                            92.8       6e-19 
PHYSO_330015                                                          89.4       8e-19 
H257_07450                                                            93.6       1e-18 
PHYRA_86968                                                           88.6       2e-18 
PHYRA_39489                                                           88.2       2e-18 
PHYCA_119748                                                          89.0       2e-18 
PHYRA_44618                                                           85.1       2e-18 
PHYRA_49009                                                           87.4       2e-18 
PHYKE_6288                                                            83.6       3e-18 
PHYSO_260049                                                          86.7       3e-18 
PYAP_24304                                                            87.4       3e-18 
PHYKE_9807                                                            92.0       3e-18 
PHALS_14424                                                           84.3       4e-18 
PHYRA_72477                                                           87.4       4e-18 
PITG_23228                                                            87.4       5e-18 
PYIW_20257                                                            91.3       5e-18 
PHYCA_555180                                                          91.3       5e-18 
PPTG_15262                                                            87.0       5e-18 
PYU1_G005699                                                          91.3       5e-18 
PHYRA_39485                                                           84.7       6e-18 
PHYRA_71588                                                           86.7       8e-18 
PHYCA_132529                                                          86.3       9e-18 
PHYRA_84273                                                           85.9       1e-17 
PHALS_03592                                                           86.3       1e-17 
PHYSO_509491                                                          80.9       1e-17 
PHYSO_253029                                                          85.9       1e-17 
PPTG_00460                                                            86.3       1e-17 
PHYKE_208                                                             84.3       2e-17 
PHYRA_72430                                                           85.5       2e-17 
PHYRA_72306                                                           85.5       2e-17 
CCI39993                                                              89.4       2e-17 
PHYKE_7051                                                            82.0       2e-17 
HYAP_07436                                                            85.9       2e-17 
PHYSO_480350                                                          85.1       3e-17 
PHYRA_39486                                                           82.8       3e-17 
PITG_00957                                                            86.3       3e-17 
PHYRA_71618                                                           84.7       3e-17 
HYAP_07925                                                            85.1       3e-17 
PHALS_14425                                                           85.9       4e-17 
PYIR_14132                                                            88.2       4e-17 
PHYRA_45457                                                           83.2       5e-17 
HYAP_04149                                                            88.2       5e-17 
HYAP_08306                                                            85.1       5e-17 
PHYRA_72475                                                           84.0       6e-17 
PHYSO_521124                                                          84.3       7e-17 
PITG_22981                                                            84.0       9e-17 
HYAP_14784                                                            84.0       9e-17 
PHYKE_4231                                                            79.3       1e-16 
PHYRA_83592                                                           82.8       1e-16 
PYAP_19148                                                            86.7       1e-16 
PPTG_14652                                                            83.2       1e-16 
PYAR_24955                                                            82.8       1e-16 
PHYRA_72165                                                           82.8       2e-16 
PITG_23211                                                            82.8       2e-16 
PHALS_08445                                                           82.8       2e-16 
PHYSO_496064                                                          82.8       2e-16 
PHYSO_336498                                                          82.4       2e-16 
HYAP_07922                                                            79.3       2e-16 
CCA14030                                                              86.3       2e-16 
PHYCA_18619                                                           79.0       3e-16 
PPTG_00471                                                            81.6       3e-16 
PHYSO_489418                                                          85.1       4e-16 
PPTG_15218                                                            81.6       4e-16 
PYAP_24757                                                            81.3       5e-16 
PHYCA_123797                                                          81.3       5e-16 
PHALS_12600                                                           81.6       6e-16 
PPTG_15219                                                            80.9       7e-16 
PHYCA_114913                                                          80.5       7e-16 
PHYRA_72403                                                           80.5       8e-16 
PHYCA_132177                                                          80.5       9e-16 
PHYKE_2864                                                            84.0       9e-16 
PHYRA_72390                                                           80.5       1e-15 
PPTG_07991                                                            80.9       1e-15 
PHYSO_514298                                                          80.5       1e-15 
PYVX_23499                                                            83.6       1e-15 
PHYRA_83851                                                           80.1       1e-15 
PHYSO_338051                                                          79.0       1e-15 
PPTG_04504                                                            80.1       1e-15 
PITG_23039                                                            77.4       2e-15 
PHYRA_43347                                                           79.3       2e-15 
PHYRA_72531                                                           79.7       2e-15 
PITG_22734                                                            77.4       2e-15 
HYAP_14846                                                            78.6       3e-15 
PHYSO_246397                                                          79.0       4e-15 
PHALS_08945                                                           78.6       5e-15 
HYAP_07496                                                            74.7       5e-15 
PHYRA_76657                                                           78.2       5e-15 
PPTG_17453                                                            78.6       5e-15 
PHYSO_328418                                                          77.4       6e-15 
PHALS_02474                                                           77.4       9e-15 
HYAP_06628                                                            77.4       1e-14 
PITG_23055                                                            77.0       1e-14 
PPTG_08703                                                            77.8       1e-14 
HYAP_08078                                                            74.7       1e-14 
PHYKE_5284                                                            77.0       1e-14 
PHYRA_84277                                                           77.0       1e-14 
PHYCA_109163                                                          77.0       1e-14 
PHYRA_52296                                                           77.0       1e-14 
PHALS_08947                                                           77.0       2e-14 
PHYCA_109441                                                          75.9       2e-14 
PHALS_08447                                                           76.6       2e-14 
PPTG_04799                                                            76.6       2e-14 
PHYSO_264049                                                          72.4       3e-14 
PHALS_05391                                                           76.3       3e-14 
PHYRA_72541                                                           75.9       4e-14 
PHYRA_76603                                                           75.9       4e-14 
PHYCA_118700                                                          75.1       4e-14 
PHYSO_527850                                                          74.3       4e-14 
PPTG_17295                                                            75.5       5e-14 
HYAP_08846                                                            76.3       5e-14 
PHYRA_72357                                                           75.1       6e-14 
PITG_23051                                                            75.9       6e-14 
PYAR_16664                                                            78.6       7e-14 
PHYRA_44405                                                           74.7       8e-14 
PHYSO_508915                                                          73.2       9e-14 
PPTG_18463                                                            74.3       1e-13 
PYAP_24339                                                            73.2       2e-13 
PHYRA_47103                                                           73.6       2e-13 
PHYCA_544875                                                          73.9       2e-13 
PHALS_14423                                                           75.9       2e-13 
PHYRA_52426                                                           71.2       2e-13 
HYAP_08069                                                            73.9       2e-13 
PPTG_11469                                                            73.2       3e-13 
PPTG_00542                                                            72.8       4e-13 
PPTG_15860                                                            71.2       4e-13 
PHALS_13512                                                           72.4       5e-13 
PHYSO_482931                                                          72.4       6e-13 
PHYCA_124462                                                          72.4       8e-13 
PHYSO_245789                                                          69.7       1e-12 
PPTG_10591                                                            71.6       1e-12 
PITG_01778                                                            74.3       1e-12 
PITG_23076                                                            71.2       2e-12 
PYAR_21977                                                            70.1       3e-12 
PHYCA_124383                                                          70.9       3e-12 
PHYSO_263794                                                          69.7       3e-12 
PHYSO_365942                                                          70.1       3e-12 
PHYSO_423056                                                          69.3       4e-12 
PHYCA_553546                                                          70.1       6e-12 
PHYSO_480321                                                          69.3       6e-12 
PHYSO_526541                                                          68.9       8e-12 
PHYSO_327908                                                          72.4       8e-12 
PPTG_03796                                                            69.3       8e-12 
PHYSO_526791                                                          67.0       1e-11 
PPTG_16647                                                            68.9       1e-11 
PYIW_25932                                                            63.9       1e-11 
PPTG_13004                                                            68.9       1e-11 
PHYCA_109162                                                          68.6       1e-11 
PYIR_21896                                                            70.9       1e-11 
PPTG_11475                                                            68.6       2e-11 
PITG_22876                                                            65.1       2e-11 
PHYSO_327912                                                          67.4       2e-11 
PPTG_05868                                                            67.8       2e-11 
PHYSO_516261                                                          67.0       3e-11 
PHYSO_255972                                                          66.2       4e-11 
PHYCA_544885                                                          67.0       4e-11 
PITG_19065                                                            68.9       4e-11 
PHYSO_264058                                                          65.5       4e-11 
PHYCA_69122                                                           66.6       5e-11 
PHYSO_562795                                                          68.6       6e-11 
PHYSO_341539                                                          66.2       6e-11 
PITG_23075                                                            67.0       6e-11 
PHYSO_504553                                                          66.2       9e-11 
PHYRA_47241                                                           63.5       2e-10 
PPTG_05373                                                            63.2       2e-10 
PHYSO_251206                                                          64.7       2e-10 
PHYCA_109174                                                          65.1       3e-10 
PHYSO_515401                                                          60.8       4e-10 
PHYCA_108964                                                          63.9       5e-10 
PHYKE_5655                                                            63.5       6e-10 
PHYCA_109095                                                          63.9       6e-10 
PHALS_01213                                                           62.0       2e-09 
SPRG_04114                                                            63.2       3e-09 
PHYRA_52427                                                           58.5       3e-09 
PHYCA_123587                                                          60.8       7e-09 
PHYCA_10570                                                           60.8       7e-09 
PHYSO_257244                                                          60.1       9e-09 
PHYCA_108999                                                          57.0       9e-09 
PHYSO_245887                                                          57.4       1e-08 
PHYCA_109192                                                          60.1       1e-08 
PHYCA_11676                                                           58.9       1e-08 
PPTG_06202                                                            58.5       3e-08 
PHYCA_109089                                                          58.5       4e-08 
PPTG_24712                                                            53.1       5e-08 
PITG_22709                                                            58.2       5e-08 
PITG_19802                                                            55.8       8e-08 
PHYCA_133546                                                          57.4       9e-08 
PHYSO_327911                                                          56.2       1e-07 
PPTG_23721                                                            57.8       2e-07 
PHALS_08480                                                           54.7       6e-07 
PPTG_05581                                                            54.7       7e-07 
PPTG_08713                                                            51.2       2e-06 
PHYSO_449487                                                          50.4       2e-06 
PHYRA_52174                                                           52.4       2e-06 
PHYSO_481543                                                          52.8       2e-06 
PHYCA_59113                                                           51.2       2e-06 
PHYSO_246660                                                          52.0       4e-06 
PYIR_26577                                                            48.1       4e-06 
PHYSO_261711                                                          51.2       5e-06 
PPTG_11648                                                            51.6       7e-06 
PHYSO_336673                                                          49.3       8e-06 
HYAP_13613                                                            52.0       1e-05 
PHYSO_445618                                                          47.4       1e-05 
PHALS_05247                                                           50.1       2e-05 
PHYCA_5621                                                            49.3       3e-05 
HYAP_07033                                                            48.5       3e-05 
PHYCA_109151                                                          47.4       4e-05 
HYAP_11184                                                            46.2       4e-05 
PITG_23062                                                            48.9       5e-05 
PHALS_13274                                                           48.5       5e-05 
PHYSO_342831                                                          47.4       6e-05 
PHYCA_10715                                                           48.1       6e-05 
PYIW_27568                                                            46.2       7e-05 
HYAP_12828                                                            43.5       1e-04 
SPRG_04231                                                            42.7       4e-04 
PPTG_11479                                                            43.1       0.004 
SPRG_17626                                                            40.0       0.011 
HYAP_08068                                                            38.9       0.012 
PPTG_20194                                                            39.7       0.014 
PHYSO_251461                                                          40.4       0.017 
PPTG_20067                                                            38.1       0.031 
HYAP_03446                                                            37.4       0.032 
PPTG_17455                                                            37.7       0.038 
PHYRA_85280                                                           40.0       0.040 
PPTG_04456                                                            35.8       0.064 
PYAP_24306                                                            36.6       0.082 
PHYSO_335499                                                          38.9       0.083 

>PHYKE_8391
Length=778

 Score = 1524 bits (3945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 765/765 (100%), Positives = 765/765 (100%), Gaps = 0/765 (0%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA
Sbjct  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN
Sbjct  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120

Query  121  MCDVKMPLKDGEFTKNLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDK  180
            MCDVKMPLKDGEFTKNLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDK
Sbjct  121  MCDVKMPLKDGEFTKNLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDK  180

Query  181  VSFETHAFEDRDAFKQWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLL  240
            VSFETHAFEDRDAFKQWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLL
Sbjct  181  VSFETHAFEDRDAFKQWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLL  240

Query  241  AFFRSGVAVGSPQGadpaekaeaaasievaessMTVTETPAVPMEEETSYDYDLVVIGGG  300
            AFFRSGVAVGSPQGADPAEKAEAAASIEVAESSMTVTETPAVPMEEETSYDYDLVVIGGG
Sbjct  241  AFFRSGVAVGSPQGADPAEKAEAAASIEVAESSMTVTETPAVPMEEETSYDYDLVVIGGG  300

Query  301  SGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMH  360
            SGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMH
Sbjct  301  SGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMH  360

Query  361  HDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLD  420
            HDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLD
Sbjct  361  HDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLD  420

Query  421  PHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVV  480
            PHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVV
Sbjct  421  PHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVV  480

Query  481  GASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPES  540
            GASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPES
Sbjct  481  GASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPES  540

Query  541  ITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTK  600
            ITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTK
Sbjct  541  ITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTK  600

Query  601  NEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYG  660
            NEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYG
Sbjct  601  NEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYG  660

Query  661  CCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFH  720
            CCGLSEEDSNERFGEDNVEVYHKNFVPLEWSLSESRTSSESCYVKVICDTTRDKFVVGFH
Sbjct  661  CCGLSEEDSNERFGEDNVEVYHKNFVPLEWSLSESRTSSESCYVKVICDTTRDKFVVGFH  720

Query  721  YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEV
Sbjct  721  YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765

>PHYCA_556160
Length=649

 Score = 1084 bits (2803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/630 (83%), Positives = 564/630 (90%), Gaps = 1/630 (0%)

Query  137  LAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQ  196
            LAETL T+ +SSV TFHI+GW+TCPSF KAGEVA AMQMLYPD+V+FE H FEDR+AFK 
Sbjct  7    LAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKH  66

Query  197  WLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQGad  256
            WLS S+D F   FG DSKA  HVTSPFVWSSNP  FVGGCDDLL +FRSGV VG+PQGA 
Sbjct  67   WLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQGAT  126

Query  257  paekaeaaasievaessMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQK  316
            P        +      S T  E  +    EET+YDYDLVVIGGGSGGLACSKEAASFGQK
Sbjct  127  PNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQK  186

Query  317  VCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGK  376
            VCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGE +HHD ANFGWN++SG+G 
Sbjct  187  VCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGN  246

Query  377  GATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQI  436
              TF+WKQLVSNVD YIKSINFKYKVELRSKYVKYENFLGSF++PHTLELWHPRKGTKQI
Sbjct  247  APTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQI  306

Query  437  TTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGM  496
            TTR VV+AVGGRPK+LTCPG E+AISSDDIFWMKK  PGKTLVVGASYVALECAGFLKGM
Sbjct  307  TTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGM  366

Query  497  GYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTE  556
            GYDVKVMVRSILLRGFDQDMA+KIGEYMEVQ+GIEFIRKTVP+SITKLENGQLLVKWT+E
Sbjct  367  GYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE  426

Query  557  DDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVI  616
            D ESCEE FDTVLNATGRDPDVAKL LDKAGVKLNEK+GRIW KNEQTSTPNI+AIGDVI
Sbjct  427  DGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVI  486

Query  617  DAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGED  676
            DAPELTPVAIQAGR LSRRLYNNSTVQMDY+KVCTAVFTPIEYGCCG+SEEDS ERFGED
Sbjct  487  DAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGED  546

Query  677  NVEVYHKNFVPLe-wslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGL  735
            N+EVYH NFVPLE    +++RT++ESCY+KVICD TRDKFVVGFHYLGPNAGEVTQAMGL
Sbjct  547  NIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGL  606

Query  736  AMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            AMKLGFTYDQMVDTVGIHPTTAE+FTTLEV
Sbjct  607  AMKLGFTYDQMVDTVGIHPTTAESFTTLEV  636

>PITG_18452
Length=856

 Score = 1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/635 (81%), Positives = 566/635 (89%), Gaps = 7/635 (1%)

Query  136  NLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFK  195
            NL +TL+TA +SSV TF+I+GW++C SF KA EVAAAMQMLYPD+V+FETH FEDR+AFK
Sbjct  6    NLGDTLSTALSSSVATFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFK  65

Query  196  QWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQGa  255
            QWLS S+D    HFGADS+A  HVTSPFVWSS    FVGGCD+LLAFFRSG+AVG PQG 
Sbjct  66   QWLSASQDDITAHFGADSRATKHVTSPFVWSST--IFVGGCDELLAFFRSGIAVGKPQGV  123

Query  256  dpaekaeaaasievaessMTV----TETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAA  311
             P+EK    +S    E+  ++     ET +   +EE SYDYDLVVIGGGSGGLACSKEAA
Sbjct  124  MPSEKQPTPSSALAPETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSKEAA  183

Query  312  SFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVA  371
            SFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGE +HHDSA+FGWNV+
Sbjct  184  SFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVS  243

Query  372  SGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRK  431
            SG+G    FDWKQLV+NVD YI+ INFKYKVELRSKYVKYENFLGSF+DPHTLELWHPRK
Sbjct  244  SGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRK  303

Query  432  GTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAG  491
            G+KQITTR VV+AVGGRP++LT PG E+AISSDDIFWMK   PGKTLVVGASYVALECAG
Sbjct  304  GSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAG  363

Query  492  FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLV  551
            FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQ+GIEFIRKTVP+SITKLENGQLLV
Sbjct  364  FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLV  423

Query  552  KWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFA  611
            KWT+ED ESCEE FD+VLNATGRDPD+AKL LDKAGVKLNEKTGRIW K+EQTSTPNI+A
Sbjct  424  KWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYA  483

Query  612  IGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNE  671
            IGDVIDAPELTPVAIQAGR LSRRLYNN+TVQMDYDKVCTAVFTPIEYGCCGLSEEDS +
Sbjct  484  IGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIK  543

Query  672  RFGEDNVEVYHKNFVPLe-wslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVT  730
            RFG+D +EVYH NFVPLE    +E+R ++ESCYVKVICD  RDKFVVGFHYLGPNAGEVT
Sbjct  544  RFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVT  603

Query  731  QAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            QAMGLAMKLGFTYDQMVDTVGIHPTTAE+FTTLEV
Sbjct  604  QAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEV  638

>HYAP_07095
Length=613

 Score = 969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/599 (78%), Positives = 521/599 (87%), Gaps = 7/599 (1%)

Query  173  MQMLYPDKVSFETHAFEDRDAFKQWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKF  232
            M ++YP +V+FETHAFEDRDAFKQWLSTS + FV  FG DSKA THVTSPFVW SNP  F
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60

Query  233  VGGCDDLLAFFRSGVAVGSPQGadpaeka------eaaasievaessMTVTETPAVPMEE  286
            VGGCDDLLA FRSG+AVG+ Q      +        A      + S +  + TP + +E+
Sbjct  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120

Query  287  ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  346
            + SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180

Query  347  KLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRS  406
            KLMHQSSLIGE +HHD A+FGWNV S  G+  TFDWKQLVSNV SYIKSI+FKYKVELRS
Sbjct  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRS  240

Query  407  KYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDI  466
            K VKYEN LGSF+DPHTL+LWHP+KGTK+ITTRHVV+AVGGRP+QL C G E A+SSDDI
Sbjct  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300

Query  467  FWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEV  526
            FWMK+  PGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+
Sbjct  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360

Query  527  QAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKA  586
            Q+GIEFIRKTVP+SITKL++GQLLVKW TED +  EETFDTVLNATGRDPDVAKLGLD+A
Sbjct  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420

Query  587  GVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDY  646
            GVKLNEKTGRIW  NEQT+TPN++AIGDVIDAPELTPVAIQAGR LSRRLYN  TVQMDY
Sbjct  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480

Query  647  DKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLe-wslsesrtssesCYVK  705
            DK+CTAVFTPIEYGCCGLSEEDS E +G+D+VEVYHKNFVPLE     ++R ++ESCYVK
Sbjct  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540

Query  706  VICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLE  764
            V+CD TR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHPTTAEAFTTLE
Sbjct  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFTTLE  599

>PHALS_06481
Length=644

 Score = 937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/620 (74%), Positives = 526/620 (85%), Gaps = 18/620 (3%)

Query  148  SVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQWLSTSKDHFVM  207
            ++ TF+++GW+TCPSF KA E+ AAMQMLYPD+++F+   FEDR+ F+ WL  S+  F +
Sbjct  28   TLATFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAV  87

Query  208  HFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQGadpaekaeaaasi  267
             FGA SKA+ HVTSPFVWSSNP  FVGGCDDLL FFRSG+AVG PQG   +++       
Sbjct  88   SFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSDE-------  140

Query  268  evaessMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSP  327
                    V E  +  ++E+  +DYDLVVIGGG GGLACSKEAASFGQKVCVLDYVKPSP
Sbjct  141  --------VAEISSTAVQEKPIFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSP  192

Query  328  QGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGA-TFDWKQLV  386
            QGT+WGLGGTCVNVGCIPKKL+HQSSLIGE + HDSA FGW     EGK    FDWKQLV
Sbjct  193  QGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKF-DNEGKTVPVFDWKQLV  251

Query  387  SNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVG  446
            +NVD YIK+INFKYKV+LRSK VKYENFLGSF+DPHT++L HPRKGTKQITTR+VV+AVG
Sbjct  252  ANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVG  311

Query  447  GRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  506
             RP++LTCPG EYA+SSDDIFWMK+  PGKTLV+GASYVALECAGFLKGMGY+VKVMVRS
Sbjct  312  SRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRS  371

Query  507  ILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFD  566
            ILLR FDQ+MA+KIGEYMEVQ+GI+FIRKTVP+SI++LEN QLLVKW  E  ++CEE F+
Sbjct  372  ILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFN  431

Query  567  TVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAI  626
            TVLNATGRDP+VA LGLDKAGVKLNEKTGRI  KNEQTST NI+AIGDV+DAPELTPVAI
Sbjct  432  TVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAI  491

Query  627  QAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFV  686
            Q+GR LS+RLYNNS+VQMDYDKVCT VFTPIEYGCCGLSEE S  R+GEDN+E+YH NFV
Sbjct  492  QSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFV  551

Query  687  PLe-wslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  745
            PLE    SE+RT+S SCY+KV+CD +RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQ
Sbjct  552  PLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQ  611

Query  746  MVDTVGIHPTTAEAFTTLEV  765
            MV+TVGIHP TAE+ T LEV
Sbjct  612  MVNTVGIHPMTAESLTILEV  631

>PHYSO_348901
Length=526

 Score = 909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/488 (90%), Positives = 458/488 (94%), Gaps = 1/488 (0%)

Query  279  TPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  338
            TP+   E ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC
Sbjct  26   TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  85

Query  339  VNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINF  398
            VNVGCIPKKLMHQSSLIGE MHHDSANFGWN+AS +G  +TF WKQLV+NVD YI+ INF
Sbjct  86   VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  145

Query  399  KYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAE  458
            KYKVELRSKYVKYENFLGSF+D HTLELWHPRKGTKQITTR VV+AVGGRPK+LTCPG E
Sbjct  146  KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  205

Query  459  YAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  518
            +AISSDDIFWMKK  PGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN
Sbjct  206  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  265

Query  519  KIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDV  578
            KIGEYMEVQ+GIEFIRKTVP+SITKLENGQLLVKWTTED ESCEE FDTVLNATGRDPDV
Sbjct  266  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325

Query  579  AKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYN  638
            AKLGLDKA VKLNEKTGRIW KNEQTSTPNI+AIGDVIDAPELTPVAIQAGR LSRRLYN
Sbjct  326  AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385

Query  639  NSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLe-wslsesrt  697
            NST QMDYDK+CTAVFTPIEYGCCGLSEEDS ER+GEDN+EVYHKNFVPLE     E+RT
Sbjct  386  NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445

Query  698  ssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  757
            ++ESCY+KVICD TRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA
Sbjct  446  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  505

Query  758  EAFTTLEV  765
            E FTTLE+
Sbjct  506  ETFTTLEI  513

>PHYRA_50855
Length=489

 Score = 892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/477 (92%), Positives = 456/477 (96%), Gaps = 1/477 (0%)

Query  289  SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  348
            SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL
Sbjct  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60

Query  349  MHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408
            MHQSSLIGE MHHDSANFGWNVAS EG   TF+WKQLVSNVD+YIKSINFKYKVELRSKY
Sbjct  61   MHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119

Query  409  VKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFW  468
            VKYENFLGSF+DPHTLELWH RKGTKQITTR VV+AVGGRPK+L+CPG E+AISSDDIFW
Sbjct  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179

Query  469  MKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQA  528
            MKK  PGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFDQDMANKIGEYMEVQ+
Sbjct  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239

Query  529  GIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGV  588
            GIEFIRKTVP+SIT LENGQLLVKWT ED ESCEE FDTVLNATGRDPDVAKLGLDKAGV
Sbjct  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299

Query  589  KLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDK  648
            KLNEK+GRIW KNEQTST NI+A+GDVIDAPELTPVAIQAGR LSRRLYNNST QMDY+K
Sbjct  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359

Query  649  VCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVIC  708
            VCTAVFTPIEYGCCGLSEEDS ERFGEDNVEVYH NFVPLEWSLSE+RTS+ESCYVKVIC
Sbjct  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVIC  419

Query  709  DTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            D TRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE+FTTLEV
Sbjct  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEV  476

>PYAP_17761
Length=622

 Score = 890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/630 (70%), Positives = 511/630 (81%), Gaps = 25/630 (4%)

Query  136  NLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFK  195
            +  +++   ++ +  T++++GW TCP + KA +VA AMQ+LY D V+ E   FE RDAFK
Sbjct  5    DFPQSVVPPASGAPATYYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESRDAFK  64

Query  196  QWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQGa  255
             WL+ S   F   FG DS A+TH +SPFVWS N   F+GGCD  LA FRSGVA     G 
Sbjct  65   AWLAESNAAFAQAFGTDSPALTHTSSPFVWS-NARGFIGGCDATLAHFRSGVAARPLAGP  123

Query  256  dpaekaeaaasievaessMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQ  315
                               + T TP V ++E  +YDYDLVVIGGGSGGLACSKEAA +G+
Sbjct  124  SA-----------------SPTMTP-VAVDESKTYDYDLVVIGGGSGGLACSKEAAKYGK  165

Query  316  KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEG  375
            KVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKLMHQS+LIGE MH D+  FGWN+  GE 
Sbjct  166  KVCVLDYVKPSPLGTTWGLGGTCVNVGCIPKKLMHQSALIGELMHKDAGAFGWNM--GEQ  223

Query  376  KGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQ  435
            K   F W QLV +V++YIK INFKYKVELR K VKYENFLGSF+DPHT+ELWH +KGTK 
Sbjct  224  K---FTWTQLVESVNNYIKGINFKYKVELRDKKVKYENFLGSFVDPHTIELWHHKKGTKT  280

Query  436  ITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKG  495
            ITTRHVVVAVGGRP+QL+CPG E+AISSDDIFW +KT PGKTLVVGASYVALECAGFLKG
Sbjct  281  ITTRHVVVAVGGRPRQLSCPGGEHAISSDDIFW-RKTEPGKTLVVGASYVALECAGFLKG  339

Query  496  MGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTT  555
            MGY+VKVMVRSILLRGFD+DMAN+IG++M+ ++ IEFIR  VP+SI KLENGQLLVKW +
Sbjct  340  MGYEVKVMVRSILLRGFDEDMANRIGDFMQDESKIEFIRGAVPKSIEKLENGQLLVKWNS  399

Query  556  EDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDV  615
             D E+ EE FD+VLNATGRDPDV+KL LDKAGV+LN KTGRI   NEQTSTPN+FAIGDV
Sbjct  400  ADGETVEEVFDSVLNATGRDPDVSKLNLDKAGVQLNPKTGRIAVTNEQTSTPNVFAIGDV  459

Query  616  IDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGE  675
            IDAPELTPVAIQAGR L+RRLYNN T  MDYDKVCTAVFTPIEYGCCGLSEE + +++GE
Sbjct  460  IDAPELTPVAIQAGRLLARRLYNNETTLMDYDKVCTAVFTPIEYGCCGLSEEAAKDKYGE  519

Query  676  DNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGL  735
            DN+E+YH++F+PLEWSLS+ R ++ +CYVKVICD TRDK+VVGFHYLGPNAGEVTQAMGL
Sbjct  520  DNLEIYHQSFMPLEWSLSQDRVAANTCYVKVICDKTRDKYVVGFHYLGPNAGEVTQAMGL  579

Query  736  AMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            AMK+GFTYDQMV+ VGIHPTTAE FTTLEV
Sbjct  580  AMKIGFTYDQMVNVVGIHPTTAEVFTTLEV  609

>PYIR_13452
Length=645

 Score = 889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/650 (69%), Positives = 509/650 (78%), Gaps = 41/650 (6%)

Query  125  KMPLKDGEFT--KNLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVS  182
            K   + GE     N+ ETL        T +H++GWR C  + KA +V  AM++LYPD V 
Sbjct  15   KREARSGELMTRANIKETLV--HEGGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVD  72

Query  183  FETHAFEDRDAFKQWLSTSK--DHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLL  240
            FE H F DR+AF++WL+ S   +     FGADSKA+TH +SPFVW+ N   F+GGCDD L
Sbjct  73   FELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVWA-NTRGFIGGCDDTL  131

Query  241  AFFRSGVAVGSPQGadpaekaeaaasievaessMTVTETPAV-----PMEEETSYDYDLV  295
            A FRSGV+  +                       T+  TP +        ++  YDYDL+
Sbjct  132  ALFRSGVSAPA-----------------------TLAATPTMVAAAPAPADDAKYDYDLI  168

Query  296  VIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLI  355
            VIGGGSGGLACSKEA+ +G+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKLMHQSSLI
Sbjct  169  VIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLI  228

Query  356  GETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFL  415
            GET+H D+  FGW V        TFDW Q++ +V+SYIKSINFKYKVELR K VKYEN L
Sbjct  229  GETIHKDAKAFGWTVGE-----QTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283

Query  416  GSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPG  475
            GSF+D HTLELWHP+KGTK +TTR VV+AVGGRPK L+C G + AISSDDIFW +K APG
Sbjct  284  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW-RKEAPG  342

Query  476  KTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRK  535
            KTLVVGASYVALECAGF+KGMGYDVK+MVRSILLRGFDQDMANKIGE+ME ++ IEFIR 
Sbjct  343  KTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRG  402

Query  536  TVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTG  595
             VP+SITKLE+GQLLVKW + D E+CEE FDTVLNATGRDPDVAKLGLDK GVKLN KTG
Sbjct  403  AVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTG  462

Query  596  RIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFT  655
            RI   NEQTSTPNI+AIGDVIDAPELTPVAIQAGR L+RRLYNN T  MDYDKVCTAVFT
Sbjct  463  RIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFT  522

Query  656  PIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKF  715
            PIEYGCCGLSEE S E++GE+N+E+YH+NF PLEWSLS  R ++ SCYVKVICDT R+K 
Sbjct  523  PIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKH  582

Query  716  VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            VVGFHYLGPNAGEVTQA+GLAMKLGFTYDQMV+ VGIHPTTAE FTTLEV
Sbjct  583  VVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEV  632

>PYIW_19972
Length=609

 Score = 834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/632 (69%), Positives = 489/632 (77%), Gaps = 52/632 (8%)

Query  134  TKNLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDA  193
            T N+ ETL         T+HI+GWR C  + KA +V  AM++LYPD V  E H F DR+A
Sbjct  17   TVNIKETLVRGGGPP--TYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREA  74

Query  194  FKQWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQ  253
            F+ WLS S   F  +FGADSKA TH +SPF           G D+            SP 
Sbjct  75   FRAWLSASAADFAANFGADSKAATHTSSPFF----------GKDE------------SP-  111

Query  254  GadpaekaeaaasievaessMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASF  313
                                 T T   A  +++  +YDYDL+VIGGGSGGLACSKEAA +
Sbjct  112  ---------------------TPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKY  150

Query  314  GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASG  373
            G+KVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKLMHQSSLIGET+H D+A FGW+V  G
Sbjct  151  GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSV--G  208

Query  374  EGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGT  433
            E K   FDW Q++ +V+SYIKSINFKYKVELR K VKYEN LGSF+D HTLELWHP+KGT
Sbjct  209  EQK---FDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGT  265

Query  434  KQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFL  493
            K +TTR VV+AVGGRPK L+C G E AISSDDIFW +K APGKTLV+GASYVALECAGF+
Sbjct  266  KTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW-RKEAPGKTLVIGASYVALECAGFM  324

Query  494  KGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKW  553
            KGMGYDVK+MVRSILLRGFDQDMA+KIGE+MEV++ IEFIR  VP+SITKLE+GQLLVKW
Sbjct  325  KGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKW  384

Query  554  TTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIG  613
             + D + CEE FDTVLNATGRDPDVAKL LD  GV+LN KTGRI   NEQTS PNIFAIG
Sbjct  385  VSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIG  444

Query  614  DVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERF  673
            DVIDAPELTPVAIQAGR L+RRLYNN T  MDYDKVCTAVFTPIEYGCCGLSEE S E+F
Sbjct  445  DVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKF  504

Query  674  GEDNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAM  733
            GED +E+YH+NF PLEWSLS  R ++ SCYVKVICDTTR+K VVGFHYLGPNAGEVTQA+
Sbjct  505  GEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAI  564

Query  734  GLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            GLAMKLGFTYD MV+ VGIHPTTAE FTTLEV
Sbjct  565  GLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEV  596

>PYAR_13569
Length=494

 Score = 760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/482 (76%), Positives = 419/482 (87%), Gaps = 6/482 (1%)

Query  284  MEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGC  343
            +++E +YDYDLVVIGGGSGGLACSKEAA  G+KV VLDYVKPSP GT+WGLGGTCVNVGC
Sbjct  6    VDDEATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVGC  65

Query  344  IPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVE  403
            IPKKLMHQS+L+GE MH D+  FGW   +      +F W QLV++V++YIK INFKYKVE
Sbjct  66   IPKKLMHQSALLGELMHKDAPAFGWTTGA-----QSFTWTQLVASVNNYIKGINFKYKVE  120

Query  404  LRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISS  463
            LR K VKYENFLGSF+D HT+ELWH +K  K +TTRHVV+AVGGRP+ LTCPG E+AISS
Sbjct  121  LRDKKVKYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISS  180

Query  464  DDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEY  523
            DDIFW +KT PGKTLVVGASYVALECAGFLKGMGYDVK+MVRSILLRGFDQDMAN+IG++
Sbjct  181  DDIFW-RKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDF  239

Query  524  MEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGL  583
            M+ ++ IEFIR  VP+SI K ENG+LLVKW + D +  EE FDTVLNATGRDPDV KL L
Sbjct  240  MQDESRIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNL  299

Query  584  DKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQ  643
            DKAGV+LN K+GRI   NEQTSTPNIFAIGDVIDAPELTPVAIQAGR L+RRLYNN T  
Sbjct  300  DKAGVELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTL  359

Query  644  MDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCY  703
            MDYDK+CTAVFTPIEYGCCGLSEED+  ++GE+N+E+YH++F+PLEWSLSE R ++ +CY
Sbjct  360  MDYDKICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEERVAAATCY  419

Query  704  VKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            VKVICD TRDK VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV+ VGIHPTTAE FTTL
Sbjct  420  VKVICDKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTTL  479

Query  764  EV  765
            E+
Sbjct  480  EI  481

>PYVX_18170
Length=510

 Score = 733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/552 (69%), Positives = 423/552 (77%), Gaps = 60/552 (11%)

Query  219  VTSPFVWSSNPIKFVGGCDDLLAFFRSGV----AVGSPQGadpaekaeaaasievaessM  274
            ++SPFVW+SNP  FVGGCD LL  FRS V    A   PQ                     
Sbjct  1    MSSPFVWTSNPTAFVGGCDALLDRFRSQVPRPNAASKPQ---------------------  39

Query  275  TVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGL  334
                                      +G +  SK    FGQKV VLDYVKPSPQGT WGL
Sbjct  40   -------------------------ANGEVEASK----FGQKVLVLDYVKPSPQGTKWGL  70

Query  335  GGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIK  394
            GGTCVNVGCIPKKLMHQS+LIGE MH D+A FGW   +       FDW QL S+V +YIK
Sbjct  71   GGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFEN----APKFDWSQLASSVSTYIK  126

Query  395  SINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTC  454
            ++NFKYKV+LR K VKYENFLG+F+DPHT+EL +PRK +K +TTR VVVAVGGRP+ L C
Sbjct  127  TLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNPRKPSKTVTTRRVVVAVGGRPRLLPC  186

Query  455  PGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQ  514
            PG E +I+SDDIFW +KTAPGKTLVVGASYVALECAGFLKG GYDVKVMVRSILLRGFDQ
Sbjct  187  PGGELSITSDDIFW-RKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQ  245

Query  515  DMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGR  574
            DMAN+IGEYMEV+AGIEFIR+TVP SITKLE+G+LLVKWT  D  + EE FDTVLNATGR
Sbjct  246  DMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGR  305

Query  575  DPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSR  634
            +PDV KL LDKAGVKLN KTGRI   NEQTSTPNIFAIGDVIDAPELTPVAIQAGR L+R
Sbjct  306  NPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLAR  365

Query  635  RLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLe-wsls  693
            RLYNN T  MDY+KVCTAVFTPIEYGCCGLSEE+S ERFGEDN+EVYH+NF PLE     
Sbjct  366  RLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSD  425

Query  694  esrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  753
            ++R S  +CY+KVICD TRD FVVGFHYLGPNAGEVTQA+GLAMKLGFTY+QMV  VGIH
Sbjct  426  DTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIH  485

Query  754  PTTAEAFTTLEV  765
            PTTAE FTTLEV
Sbjct  486  PTTAETFTTLEV  497

>H310_08590
Length=640

 Score = 733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/630 (60%), Positives = 456/630 (72%), Gaps = 39/630 (6%)

Query  144  ASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQWLSTSKD  203
            +S  S   +H+ GW+ CP + KA  V ++MQ L+P +V    H   ++++F  WL+ S+ 
Sbjct  29   SSKMSTINYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQT  88

Query  204  HFVMHFGADSKAVTHVTSPFVW--SSNPIKFVGGCDDLLAFFR----SGVAVGSPQGadp  257
             F   F  D++ + H +SPF +    +  KFVGGCDD LAFFR    S  + G+P  A+ 
Sbjct  89   EFARQFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAANA  148

Query  258  aekaeaaasievaessMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKV  317
                              V++T +    +ET YD+DLVVIGGGSGGLACSKEA+  GQKV
Sbjct  149  H-----------------VSDTSS---SDETQYDWDLVVIGGGSGGLACSKEASKLGQKV  188

Query  318  CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKG  377
             VLDYVKPSP G++WGLGGTCVNVGCIPKKLMHQSS+IGE +H D+  FGW V++     
Sbjct  189  LVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSN-----  243

Query  378  ATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWH--PRKGTKQ  435
            A+FDW +LVS+V  YI  +NFKY+++LR K VKYEN LG+F D HTL L +   +KG   
Sbjct  244  ASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTD  303

Query  436  ITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKG  495
            +T R  V+AVGGRPK L+CPG E+AISSDDIF  K  APGKTLVVGASYVALECAGFLKG
Sbjct  304  VTFRRAVIAVGGRPKPLSCPGWEHAISSDDIF-SKAEAPGKTLVVGASYVALECAGFLKG  362

Query  496  MGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTT  555
             G+DV +MVRSILLRGFDQD+A +IGEYME ++GI FI+++VP SI KL NGQL V  T 
Sbjct  363  QGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHT-  421

Query  556  EDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDV  615
                  E  +DTVLNATGR PDV  L L  AGV LN K+GRI   NEQTSTP+I+AIGDV
Sbjct  422  ----HGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDV  477

Query  616  IDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGE  675
            IDAPELTPVAIQAG+ L+RRL+ N T  MDY K+CTAVFTP+EYGCCGLSEED+    G 
Sbjct  478  IDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGR  537

Query  676  DNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGL  735
            DN++VYH+NF PLEWSLS  R  ++ CY K+I DTT+ K VVGFHYLGPNAGEVTQA+G+
Sbjct  538  DNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGV  597

Query  736  AMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            AMKL  TYD  V+TVGIHPTTAE FTTLE+
Sbjct  598  AMKLHATYDDFVNTVGIHPTTAEIFTTLEI  627

>H257_08436
Length=642

 Score = 730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/618 (60%), Positives = 457/618 (74%), Gaps = 33/618 (5%)

Query  152  FHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQWLSTSKDHFVMHFGA  211
            +H+ GW+ CP + KA  VA++MQ L+P +V    H   ++++F  WL+ S+  F   F  
Sbjct  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100

Query  212  DSKAVTHVTSPFVW--SSNPIKFVGGCDDLLAFFRSGVAVGSPQGadpaekaeaaasiev  269
            D++ + H +SPF +    +  KFVGGCDD LAFFR+              + ++A S   
Sbjct  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRA--------------RTQSAPSAPA  146

Query  270  aessMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  329
            + +S+   +T     + +  YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKPSP G
Sbjct  147  SSASIHANDTS----DADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVG  202

Query  330  TSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNV  389
            ++WGLGGTCVNVGCIPKKLMHQSS+IGE +H D+  FGW+V++     ATFDW +LVS+V
Sbjct  203  STWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSN-----ATFDWSKLVSSV  257

Query  390  DSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWH--PRKGTKQITTRHVVVAVGG  447
              YI  +NFKY+V+LR K VKYEN LG+F D HTL L +   +KG   +T R  V+AVGG
Sbjct  258  QDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGG  317

Query  448  RPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  507
            RPK L+CPG E+A+SSDDIF  K  APGKTLVVGASYVALECAGFLKG G+DV +MVRSI
Sbjct  318  RPKPLSCPGWEHALSSDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI  376

Query  508  LLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDT  567
            LLRGFDQD+A +IGEYME ++GI FI+++VP SI KLENGQ  V  TT  D      +DT
Sbjct  377  LLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQD-----VYDT  431

Query  568  VLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQ  627
            +LNATGR PDV KL LD AGV LN K+GRI   NEQTSTPNI+A+GDVIDAPELTPVAIQ
Sbjct  432  ILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQ  491

Query  628  AGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVP  687
            AG+ LSRRL+ N T  MDY K+CTAVFTP+EYGCCGLSEED+    G +NVEVYH+NF P
Sbjct  492  AGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTP  551

Query  688  LewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  747
            LEWSLS  R  ++ CY K+I DTT+ K V+GFHYLGPNAGEVTQA+G+A+KL  TYD  +
Sbjct  552  LEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFI  611

Query  748  DTVGIHPTTAEAFTTLEV  765
            +TVGIHPTTAE FTTLE+
Sbjct  612  NTVGIHPTTAEIFTTLEI  629

>SDRG_16720
Length=628

 Score = 692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/630 (58%), Positives = 445/630 (71%), Gaps = 34/630 (5%)

Query  140  TLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQWLS  199
            T  ++S  S   +H+ GW++CP + +A  VA +MQ L+P +V    H    + +F  WL 
Sbjct  16   TWRSSSTMSSVNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLE  75

Query  200  TSKDHFVMHFGADSKAVTHVTSPFVWSSNP--IKFVGGCDDLLAFFRSGVAVGSPQGadp  257
            TS+  F   F  D++A  H TSPF +  +    KFVGGCDD LAFFRS            
Sbjct  76   TSQSTFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS------------  123

Query  258  aekaeaaasievaessMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKV  317
                    +   A  S       A  +++  +YD+DLVVIGGGSGGLA SKEAA +GQKV
Sbjct  124  -------RTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKV  176

Query  318  CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKG  377
             VLDYVKPSPQG++WGLGGTCVNVGCIPKKLMHQS+++GE +H D+  FGW V +     
Sbjct  177  LVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPN-----  231

Query  378  ATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGT--KQ  435
            ATFDW +L+++V  YI  +NFKY+V+LR K VKYENFLG+F D HTL L +P KG   K 
Sbjct  232  ATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKD  291

Query  436  ITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKG  495
            +T R  ++AVGGRPK L CPGA+ AISSDDIF  + T PGKTLVVGASYVALECAGFLKG
Sbjct  292  VTFRRALIAVGGRPKSLDCPGADLAISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKG  350

Query  496  MGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTT  555
             G+DV VMVRSILLRGFD DMA +IG YME +A I FI+  VP SI +L NGQL V  T 
Sbjct  351  QGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTF  410

Query  556  EDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDV  615
                  E  +DTVLNATGR PDV+ L L  AGV LN KTGRI   +EQTSTP+I+A+GDV
Sbjct  411  G-----EGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDV  465

Query  616  IDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGE  675
            ID PELTPVAIQAGR LS+RL++NS   M YDKVCTAVFTPIEYGCCGLSE+ + E  G 
Sbjct  466  IDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGA  525

Query  676  DNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGL  735
            DN+ VYH++F PLEWSLS  R  ++ CY K+I D T++  VVGFHYLGPNAGEVTQA+G+
Sbjct  526  DNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGI  585

Query  736  AMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            A+KL  +Y+  V TVGIHPTTAE FTTLE+
Sbjct  586  AIKLNASYEDFVSTVGIHPTTAEIFTTLEI  615

>SPRG_14103
Length=628

 Score = 692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/630 (58%), Positives = 445/630 (71%), Gaps = 34/630 (5%)

Query  140  TLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQWLS  199
            T  ++S  S   +H+ GW++CP + +A  VA++MQ L+P +V    H    + +F  WL 
Sbjct  16   TWRSSSTMSSVNYHVVGWKSCPYYERAANVASSMQTLFPGQVKATIHEHATKQSFNDWLE  75

Query  200  TSKDHFVMHFGADSKAVTHVTSPFVWSSNP--IKFVGGCDDLLAFFRSGVAVGSPQGadp  257
             S+  F   F  D++A  H TSPF +  +    KFVGGCDD LAFFRS            
Sbjct  76   ASQATFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS------------  123

Query  258  aekaeaaasievaessMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKV  317
                    +   A  S       A  +++  +YD+DLVVIGGGSGGLA SKEAA +GQKV
Sbjct  124  -------RTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKV  176

Query  318  CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKG  377
             VLDYVKPSPQG++WGLGGTCVNVGCIPKKLMHQS+++GE +H D+  FGW V +     
Sbjct  177  LVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPN-----  231

Query  378  ATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGT--KQ  435
            ATFDW +LV++V  YI  +NFKY+V+LR K VKYENFLG+F D HTL L +P KG   K 
Sbjct  232  ATFDWTKLVTSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKD  291

Query  436  ITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKG  495
            +T R  ++AVGGRPK L CPGA+ AISSDDIF  + T PGKTLVVGASYVALECAGFLK 
Sbjct  292  VTFRRALIAVGGRPKSLDCPGADLAISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKA  350

Query  496  MGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTT  555
             G+DV VMVRSILLRGFD DMA +IG YME +A I+FI+  VP SI +L NGQL V  T 
Sbjct  351  QGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTF  410

Query  556  EDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDV  615
                  E  +DTVLNATGR+PDV+ L L  AGV LN KTGRI   +EQTS P+I+A+GDV
Sbjct  411  G-----EGIYDTVLNATGRNPDVSGLNLPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDV  465

Query  616  IDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGE  675
            ID PELTPVAIQAGR L++RL++NS   M YDKVCTAVFTPIEYGCCGLSE+ + E  G 
Sbjct  466  IDGPELTPVAIQAGRLLAKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGA  525

Query  676  DNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGL  735
            DN+ VYH++F PLEWSLS  R  ++ CY K+I D T++  VVGFHYLGPNAGEVTQA+G+
Sbjct  526  DNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGI  585

Query  736  AMKLGFTYDQMVDTVGIHPTTAEAFTTLEV  765
            AMKL  +YD  V TVGIHPTTAE FTTLE+
Sbjct  586  AMKLNASYDDFVSTVGIHPTTAEIFTTLEI  615

>SPRG_04074
Length=509

 Score = 415 bits (1066),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 238/496 (48%), Positives = 316/496 (64%), Gaps = 26/496 (5%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK
Sbjct  2    SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  61

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
            +MH S ++G  + HD+A+ GW V     +    +W+ LV  V +++K +NF Y+V LRS 
Sbjct  62   IMHYSGILGAGL-HDAAHLGWQVP----EKVEHNWETLVEAVQAHVKKLNFSYRVGLRSN  116

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPK-QLTCPG-AEYAISSDD  465
             V+Y N L  F DPHTL        T+ +T  H+++A GGRP      PG AEYAI+SDD
Sbjct  117  KVQYINALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDD  176

Query  466  IFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYME  525
            +F +  TAPGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + M 
Sbjct  177  LFSL-STAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIMV  235

Query  526  VQAGIEFIRKTVPESITKLE-NGQLLVKW-TTEDDESCEETFDTVLNATGRDPDVAKLGL  583
             Q G++F   T+P SI K E  GQL V +  +E  E+  E FDTVL A GR  D   +GL
Sbjct  236  AQ-GMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGL  294

Query  584  DKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDA-PELTPVAIQAGRFLSRRLYN-NST  641
            +KAGVK     G+  T NE T+ P+I A+GDV+   PELTPVAI+AG  L RRL+  N T
Sbjct  295  EKAGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYT  353

Query  642  VQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVY------------HKNFVPLe  689
              M+YD + T VFTP+EYG  GLSEE++  R+G+D++ VY            H+      
Sbjct  354  KTMNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKAESA  413

Query  690  wslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  749
                       +C  K++C  + ++ V+GFH++GPNAGEVTQ   +A+ +G T +   + 
Sbjct  414  QEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNV  473

Query  750  VGIHPTTAEAFTTLEV  765
            +GIHPT AE+F  L V
Sbjct  474  IGIHPTDAESFMALTV  489

>SDRG_14408
Length=528

 Score = 411 bits (1056),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 235/496 (47%), Positives = 315/496 (64%), Gaps = 26/496 (5%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK
Sbjct  21   SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  80

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
            +MH S ++G  + HD+A+ GW +     +    +W+ LV  V +++K +NF Y+V LRS 
Sbjct  81   IMHYSGILGAGL-HDAAHLGWQLP----EKVEHNWETLVETVQAHVKKLNFSYRVGLRSN  135

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPK-QLTCPG-AEYAISSDD  465
             V+Y N L  F DPHTL        T+ +T  H+++A GGRP      PG  EYAI+SDD
Sbjct  136  KVQYINALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEIPGVGEYAITSDD  195

Query  466  IFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYME  525
            +F +  TAPGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + M 
Sbjct  196  LFSL-TTAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIMV  254

Query  526  VQAGIEFIRKTVPESITKLE-NGQLLVKW-TTEDDESCEETFDTVLNATGRDPDVAKLGL  583
             Q G++F   T+P SI K +  GQL V +  +E +E+  E FDTVL A GR  D   +GL
Sbjct  255  AQ-GMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFNIGL  313

Query  584  DKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDA-PELTPVAIQAGRFLSRRLYN-NST  641
            +K GVK     G+  T NE T+ P+I A+GDV+   PELTPVAI+AG  L RRL+  N T
Sbjct  314  EKVGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYT  372

Query  642  VQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVY------------HKNFVPLe  689
              M+YD + T VFTP+EYG  GLSEE++  R+G+D+V VY            H+      
Sbjct  373  KTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVHRQKAESA  432

Query  690  wslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  749
                       +C  K++C  + ++ V+GFH++GPNAGEVTQ   +A+ +G T +   + 
Sbjct  433  QEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNV  492

Query  750  VGIHPTTAEAFTTLEV  765
            +GIHPT AE+F  L V
Sbjct  493  IGIHPTDAESFMALTV  508

>SDRG_15045
Length=494

 Score = 252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 165/479 (34%), Positives = 258/479 (54%), Gaps = 19/479 (4%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            T+YDY  +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK
Sbjct  2    TTYDY--IVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKK  56

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
            +M  ++L  E +H   A + +   S    GA FDW  + +  D+Y+  +N  Y   +   
Sbjct  57   IMFNAALHAEMLHSARA-YAFKGVSDIQYGA-FDWAAMKAKRDAYVTWLNSMYGEGMLED  114

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIF  467
             V        F+D HT+E+   R      T +H+++AVGG P     PG E+AISSD  F
Sbjct  115  KVDLVMGAAKFVDNHTIEVNGER-----YTAKHILIAVGGVPALPPIPGIEHAISSDGFF  169

Query  468  WMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  526
             ++ T P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME 
Sbjct  170  ALE-TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-  227

Query  527  QAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKA  586
             AG++F+R++   +I K  +G L ++ T   +      F+TVL A GR P    LGL+  
Sbjct  228  HAGVQFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETT  287

Query  587  GVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNS-TVQM  644
             + L+ +        E T+ PN++AIGDV     ELTPVAI AGR L+ RL+ N     +
Sbjct  288  DIALSTEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACV  347

Query  645  DYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYV  704
            +Y ++ T VF+    G  GL+E  + E++G  NV  +  +F  + +++   +   ++  +
Sbjct  348  NYSQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-M  406

Query  705  KVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  407  KLVCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_11131
Length=494

 Score = 250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 164/479 (34%), Positives = 257/479 (54%), Gaps = 19/479 (4%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            T+YDY  +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK
Sbjct  2    TTYDY--IVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKK  56

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
            +M  ++L  E +H   A + +   S    GA FDW  + +  D+Y+  +N  Y   +   
Sbjct  57   IMFNAALHAEMLHSARA-YAFKGVSDIQYGA-FDWAAMKAKRDAYVTWLNSMYGEGMLED  114

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIF  467
             V        F+D HT+E+   R      T +H+++AVGG P     PG E+AISSD  F
Sbjct  115  KVDLVMGAAKFVDNHTIEVNGER-----YTAKHILIAVGGVPALPPIPGIEHAISSDGFF  169

Query  468  WMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  526
             ++ T P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME 
Sbjct  170  ALE-TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-  227

Query  527  QAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKA  586
             AG++F+R++   +I K  +G L ++ T   +      F+TVL A GR P    LGL+  
Sbjct  228  HAGVQFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETT  287

Query  587  GVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNS-TVQM  644
             + L+ +        E T+ PN++AIGDV     ELTPVAI AGR L+ RL+ N     +
Sbjct  288  DIALSTEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACV  347

Query  645  DYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYV  704
            +Y ++ T VF+    G  GL+E  +  ++G  NV  +  +F  + +++   +   ++  +
Sbjct  348  NYSQIPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-M  406

Query  705  KVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  407  KLVCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_03822
Length=494

 Score = 249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 165/475 (35%), Positives = 251/475 (53%), Gaps = 17/475 (4%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YD +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  352  SSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKY  411
            ++L  E +H   A + +        GA FDW  + +  D+Y+K +N  Y   +    V  
Sbjct  61   AALHAEMLHSARA-YAFKGVQDIQFGA-FDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  118

Query  412  ENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKK  471
                  F+D HT+E+   R   K     H+++AVGG P     PG E+AISSD  F + +
Sbjct  119  VMGAAKFVDNHTVEVNGDRYAAK-----HILIAVGGVPAMPPLPGIEHAISSDGFFAL-E  172

Query  472  TAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGI  530
            T P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + +   ME  AG+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  531  EFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKL  590
             F+R++   SI K E+G L ++ T          F+TVL A GR P    LGL+   + L
Sbjct  232  RFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  591  NEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNS-TVQMDYDK  648
            +          E T+ PN+ A+GDV     ELTPVAI AGR L+ RL+ N     ++Y +
Sbjct  292  SPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQ  351

Query  649  VCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVIC  708
            + T VF+    G  GL+E  +  ++G  NV  +  +F  + +++S  +   ++  +K++C
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKVQTA-MKLVC  410

Query  709  DTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
                +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  411  IGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PHYSO_254571
Length=489

 Score = 249 bits (636),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 170/499 (34%), Positives = 254/499 (51%), Gaps = 39/499 (8%)

Query  283  PMEEET----SYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGT  337
            P+EE +    + +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGT
Sbjct  3    PLEENSLQPDTTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGT  53

Query  338  CVNVGCIPKKLMHQSSLIGETMHHDSANFGW---NVASGEGKGATFDWKQLVSNVDSYIK  394
            CVNVGC+PKKLM  ++ +   +HHD  ++G+         G+   FDW +L +  D+Y+ 
Sbjct  54   CVNVGCVPKKLMFIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVL  113

Query  395  SINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTC  454
             +N  Y+  L +  V        F D   +E+       K+I  ++V++AVGG+P     
Sbjct  114  RLNGIYERNLANSKVALIRGSAKFNDKGNVEV-----DGKEILAKNVMIAVGGKPLIPDI  168

Query  455  PGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD  513
            PG E  I SD  F + +T P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD
Sbjct  169  PGKELCIDSDGFFEL-ETLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD  227

Query  514  QDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATG  573
             D+     E    + G+     +    + K ++G    K     D S    +D V+ A G
Sbjct  228  -DIVRTTLEDAMAKDGVHLRPHSNIARVEKADDG---TKTLVLADGSEYSGYDVVIYAAG  283

Query  574  RDPDVAKLGLDKAGVKLNEKTGRIWTKN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRFL  632
            R P  + L LDKAGV   +K G I     ++TS   + A+GDV   P LTPVAI AGR L
Sbjct  284  RVPLTSNLQLDKAGVD-TDKNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRL  342

Query  633  SRRLYNN-STVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPL---  688
            S RL+      ++ Y+ + T VF+    G  GL+EE +  ++G+D ++VY   FV +   
Sbjct  343  SDRLFGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYG  402

Query  689  ----ewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  744
                    +          +K++C    +K VVG H +G  A E+ Q  G+A+K+G T  
Sbjct  403  LINEMDEATGEPKDKPKTAMKLVCAGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKA  461

Query  745  QMVDTVGIHPTTAEAFTTL  763
               + V IHPT  E   TL
Sbjct  462  DFDNCVAIHPTAGEELVTL  480

>PYAP_21882
Length=502

 Score = 249 bits (636),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 165/485 (34%), Positives = 253/485 (52%), Gaps = 34/485 (7%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQ-KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  350
            YD +VIG GSGG+A S+ AA++   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  31   YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  81

Query  351  QSSLIGETMHHDSANFGWNVASGE--GKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408
             ++ +G T+H D  ++G+    GE       F WK+L    D+Y+  +N  Y   L +  
Sbjct  82   LAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRLNGIYGRNLDNSK  141

Query  409  VKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFW  468
            V       +F     +E+       K+I  ++V++AVGG+P     PG E+ I SD  F 
Sbjct  142  VDLFRGTATFNAKGNVEV-----DGKEIAAKNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  196

Query  469  MKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQ  527
            +++  P K  VVGA Y+A+E AG L G+G D  +  R   +LRGFD+ +   + + M  +
Sbjct  197  LEEQ-PKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDELIRTTLHDAM-AK  254

Query  528  AGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAG  587
             G+     +    + K  +G    K     D S    FD+V+ A GR P    L L+ AG
Sbjct  255  EGVNLRPHSSVTKVIKAADG---TKTLVLADGSEHSGFDSVIYAAGRVPLTESLNLEAAG  311

Query  588  VKLNEKTGRIWTKNEQTSTP--NIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN-STVQM  644
            ++ ++  G I     Q +T   NIFA+GDV   P LTPVAI AGR L+ RL+      + 
Sbjct  312  IETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRLFGGMKDAKA  370

Query  645  DYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslse------srts  698
             Y+ + T VF+    G  GL+E+ +  +FG+D ++VY   FV + + +         +  
Sbjct  371  SYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINEFGEDGQQKP  430

Query  699  sesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  758
                 +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T       V IHPT AE
Sbjct  431  KPMTAMKLVCQ-GKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCVAIHPTAAE  489

Query  759  AFTTL  763
               T+
Sbjct  490  ELVTM  494

>SDRG_03823
Length=497

 Score = 249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 172/483 (36%), Positives = 259/483 (54%), Gaps = 19/483 (4%)

Query  284  MEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGC  343
            M   T+YDY  +VIGGGSGG + ++ AA++G KV V++           G+GGTCVNVGC
Sbjct  1    MATTTTYDY--IVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGC  55

Query  344  IPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVE  403
            +PKK+M  +++  E +H   A    N+   E    +FDW  L    D+Y+  +N  Y+  
Sbjct  56   VPKKVMFNAAMHAEMLHSAHAYTFKNIQDVE--YGSFDWAALKKKRDAYVARLNGIYERN  113

Query  404  LRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISS  463
            L +  +        F+D HT+E+   R      T +H+++AVGG P     PG E+AISS
Sbjct  114  LGNNKIPLIYGAAKFVDNHTIEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISS  168

Query  464  DDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGE  522
            D  F + +T P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + +  
Sbjct  169  DGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNT  227

Query  523  YMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLG  582
             ME  AG+ F+R++   SI K E+G L ++ T          F+TVL A GR P    LG
Sbjct  228  EME-HAGVRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLG  286

Query  583  LDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNS-  640
            L+   + L+          E T+ PN+ A+GDV     ELTPVAI AGR L+ RL+ N  
Sbjct  287  LETTDIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEP  346

Query  641  TVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsse  700
               ++Y ++ T VF+    G  GL+E  + E++G  NV+VY   F  + +++SE     +
Sbjct  347  NACVNYHQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDEKQK  406

Query  701  sCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
            +  +K++C    ++ V+G H  G  A E+ Q  G+A+K+G       + V IHPT +E  
Sbjct  407  TA-MKLMC-IGEEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEEL  464

Query  761  TTL  763
             T+
Sbjct  465  VTM  467

>PHALS_08068
Length=497

 Score = 247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 159/503 (32%), Positives = 261/503 (52%), Gaps = 33/503 (7%)

Query  274  MTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSW  332
            +T+    A  +      +YD +VIG GSGG+A ++ AAS+ G +V +++  +        
Sbjct  6    ITLRLARAFSVSRHLQTEYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR--------  57

Query  333  GLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGA---TFDWKQLVSNV  389
             LGGTCVNVGC+PKKLM+ ++ +   +HHD   +G+  A+  G  +    F+W +L +  
Sbjct  58   -LGGTCVNVGCVPKKLMYIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARR  116

Query  390  DSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRP  449
            D+Y+  +N  Y+  L +  V        F +   +E+       K++  + +++AVGGRP
Sbjct  117  DAYVLRLNEIYETNLANSKVDLIRGSAKFNERGNVEV-----DDKEVRAKKILIAVGGRP  171

Query  450  KQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-L  508
                 PG E  I SD  F + +T P K  +VGA Y+A+E AG L  +G    V  R   +
Sbjct  172  LIPDIPGKELCIDSDGFFEL-ETLPTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGV  230

Query  509  LRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTV  568
            LR FD  +   + E M    G+     +    + +  +G   +  T   + S    FD V
Sbjct  231  LRSFDNILRTTLEEAM-ANDGVHLRPNSTVARVKEAADGTKTLVLT---NGSEHRGFDVV  286

Query  569  LNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQA  628
            + ATGR P  + L L+KAG+  ++       + ++T+  N++A+GDV + P LTPVAI A
Sbjct  287  ICATGRVPLTSTLNLEKAGITTDDNGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAA  346

Query  629  GRFLSRRLYNN-STVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVP  687
            GR LS RL+      ++ Y+ + T +F+    G  GL+EE + +++G++N++VY   FV 
Sbjct  347  GRRLSDRLFGGMKDAKLSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVN  406

Query  688  Lewslsesrtsse-------sCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  740
            + + L      +           +K++C   ++K VVG H +G  A E+ Q  G+A+K+G
Sbjct  407  MYYGLINETIEATGVPKEKPKTAMKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMG  465

Query  741  FTYDQMVDTVGIHPTTAEAFTTL  763
             T     + + IHPT  E   TL
Sbjct  466  ATKADFDNCIAIHPTAGEELVTL  488

>PPTG_18033
Length=500

 Score = 247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 174/501 (35%), Positives = 259/501 (52%), Gaps = 39/501 (8%)

Query  279  TPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGT  337
            T A+        +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGT
Sbjct  14   TRALSASRAPQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGT  64

Query  338  CVNVGCIPKKLMHQSSLIGETMHHDSANFGW-NVASGE--GKGATFDWKQLVSNVDSYIK  394
            CVNVGC+PKKLM  ++ +   + HD  ++G+ + A+GE  GK   FDW +L +  D+Y+ 
Sbjct  65   CVNVGCVPKKLMFIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVL  124

Query  395  SINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTC  454
             +N  Y+  L +  V+       F +   +E+       K++  ++V++AVGG+P     
Sbjct  125  RLNGIYERNLANSKVELIRGSAKFNENGNVEV-----DGKELLAKNVLIAVGGKPLIPDI  179

Query  455  PGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD  513
            PG E  I SD  F + +  P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD
Sbjct  180  PGKELCIDSDGFFEL-EILPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD  238

Query  514  QDMANKIGEYMEVQAGIEFIRKTVPES-ITKLENGQLLVKWTTEDDESCEETFDTVLNAT  572
             D+     E   V+ G+       P S + ++E      K     D S    +D V+ A 
Sbjct  239  -DIVRTTLEDAMVKDGVHL----RPHSNVARVEQAADGTKTVVLTDGSEYNGYDVVMYAA  293

Query  573  GRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFL  632
            GR P  + L LDKAGV  +E       + ++TS   + A+GDV   P LTPVAI AGR L
Sbjct  294  GRVPLTSNLQLDKAGVTTDEHGFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRL  353

Query  633  SRRLY---NNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLe  689
            S RL+   NNS V   Y+ + T VF+    G  GL+E+ +  ++G+D V+VY   FV + 
Sbjct  354  SDRLFGGLNNSKVS--YENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMY  411

Query  690  wslsesrtsse-------sCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  742
            + L      S           +K++C    +K VVG H +G  A E+ Q  G+A+K+G T
Sbjct  412  YGLINEVDESTGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGAT  470

Query  743  YDQMVDTVGIHPTTAEAFTTL  763
                 + + IHPT  E   TL
Sbjct  471  KADFDNCIAIHPTAGEELVTL  491

>PHYCA_504517
Length=493

 Score = 246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 169/475 (36%), Positives = 259/475 (55%), Gaps = 16/475 (3%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YD +VIGGGSGG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  352  SSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKY  411
            ++   E ++ +  ++  N A  E +   FDW  +    D+YIK +N  Y+  L +  V +
Sbjct  64   TAAHVEHLNRNK-DYSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNANVDH  122

Query  412  ENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKK  471
               +   +    +++     G K  T +HV+VA GG P     PG E  I SD  F +++
Sbjct  123  VQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFFKLEQ  177

Query  472  TAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGI  530
              P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME +AG+
Sbjct  178  Q-PKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  531  EFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKL  590
            +F+R      + K +NG+L    T   +E     FDT+L A GR+P    LGL++ GVKL
Sbjct  236  KFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLEEVGVKL  295

Query  591  NEKTGRIWTKNEQTSTPNIFAIGDV-IDAPELTPVAIQAGRFLSRRLYNNST-VQMDYDK  648
            +E         E TS P ++AIGD  +   ELTPVAI AGR LS RL+       ++Y +
Sbjct  296  SEGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQ  355

Query  649  VCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVIC  708
            + T +F+    G  G +E ++ E++GE+NV+VY   FV L  S+++     ++  +K++ 
Sbjct  356  IPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTA-MKLVT  414

Query  709  DTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
               ++  VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  VGEKET-VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PYAR_17512
Length=533

 Score = 246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 168/507 (33%), Positives = 261/507 (51%), Gaps = 49/507 (10%)

Query  291  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  349
            +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  33   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIM  83

Query  350  HQSSLIGETMHHDSANFGWNVASGEGK---GATFDWKQLVSNVDSYIKSINFKYKVELRS  406
            + ++ +G  +H D  ++G+    G G       F W +L    D+Y+  +N  Y+  L +
Sbjct  84   YLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYERNLGN  143

Query  407  KYVKYENFLGSFLDPHTLEL---WHPRKGT------------------KQITTRHVVVAV  445
              V+      +F     +E+     P K                    K+I+ ++V++AV
Sbjct  144  SKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEISAKNVLIAV  203

Query  446  GGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR  505
            GG+P     PG E+ I SD  F +++  P K  VVGA Y+A+E AG L G+G D  +  R
Sbjct  204  GGKPLIPNIPGKEHCIDSDGFFELEEM-PKKVAVVGAGYIAVELAGVLHGLGSDTTIFCR  262

Query  506  SI-LLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEET  564
               +LRGFD+ + + + + M+ + G++    ++   +TK  +G    K     D +    
Sbjct  263  KDGVLRGFDELIRSTLHDAMD-KDGLKLRPHSLVAKVTKQADG---TKTLVLQDGTEHAG  318

Query  565  FDTVLNATGRDPDVAKLGLDKAGVKLNEKTG-RIWTKNEQTSTPNIFAIGDVIDAPELTP  623
            FDTV+ A GR P    L L+ AGV+ + +   +I      T+  NIFA+GDV   P LTP
Sbjct  319  FDTVIYAAGRVPLTQSLNLEGAGVETDAQGFIKIDEYQRTTAKKNIFAVGDVCGTPALTP  378

Query  624  VAIQAGRFLSRRLYNN-STVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYH  682
            VAI AGR LS RL+      +M Y+ + T VF+    G  GL+E+++  + G+D V+VY 
Sbjct  379  VAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVKVYS  438

Query  683  KNFVPLewslse------srtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLA  736
              FV + + +         +       +K++C    +K VVG H +G  A E+ Q  G+A
Sbjct  439  SRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEK-VVGVHLIGMAADEILQGFGVA  497

Query  737  MKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            +K+G T       V IHPT AE   T+
Sbjct  498  VKMGATKADFDSCVAIHPTAAEELVTM  524

>PYAP_23435
Length=951

 Score = 254 bits (650),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 259/479 (54%), Gaps = 16/479 (3%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            T   YD VVIGGGSGG+A ++ AA++G KV +++  +        GLGGTCVN GC+PKK
Sbjct  467  TDMVYDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKK  523

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
            +M  ++   E +  +  ++  N A    +   FDW  + +  D+YI  +N  Y+  + + 
Sbjct  524  VMFNAAAHVEHLARN-GDYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNA  582

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIF  467
             +     + + +  + +E+       K  T +HV+VAVGG P     PG E+AI SD  F
Sbjct  583  GIDLVQGVATLVSSNQIEV-----DGKVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFF  637

Query  468  WMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  526
             ++ + P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME 
Sbjct  638  KLE-SQPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-  695

Query  527  QAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKA  586
            + G+ F+R++  E I K  +G+L +    +  +   E FD VL A GR+P    LGLDKA
Sbjct  696  KHGVNFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKA  755

Query  587  GVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNST-VQM  644
            GVKLN+         E TS P ++AIGD      ELTPVAI AGR L+ RL+ N     +
Sbjct  756  GVKLNDGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACL  815

Query  645  DYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYV  704
             Y ++ T VF+    G  G +E ++  +FG D V+VY   FV L  S+++     ++  +
Sbjct  816  HYHQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMADPENKGKTA-M  874

Query  705  KVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            K++C    D+ VVG H  G  A E+ Q  G+AMK+  T     + V IHPT AE F T+
Sbjct  875  KLVC-VGDDEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHPTAAEEFVTM  932

>PPTG_09787
Length=493

 Score = 244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 262/479 (55%), Gaps = 16/479 (3%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            T   YD +VIGGGSGG+A ++ AA+FG KV V++  +   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYMVIGGGSGGMASARRAATFGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKK  59

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
            +M  ++   E ++ +  ++  N AS + +   FDW  + +  D+YIK +N  Y+  L + 
Sbjct  60   VMFNTAAHVEHLNRNK-DYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNA  118

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIF  467
             V +   +   +    +E+       +  T +HV+VA GG P     PG E+ I SD  F
Sbjct  119  KVDHVQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFF  173

Query  468  WMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  526
             +++  P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME 
Sbjct  174  KLEQQ-PKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-  231

Query  527  QAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKA  586
            +AG++F+R +    + K ENG+L    T   +E     FDT++ A GR+P    LGL++ 
Sbjct  232  KAGVKFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLGLEEI  291

Query  587  GVKLNEKTGRIWTKNEQTSTPNIFAIGDV-IDAPELTPVAIQAGRFLSRRLYNNST-VQM  644
            GVKL+E         E TS P ++AIGD  +   ELTPVAI AGR LS RL+       +
Sbjct  292  GVKLSEGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  645  DYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYV  704
            +Y ++ T +F+    G  G +E ++  ++GE+N++VY   FV L  S+++     ++  +
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTA-M  410

Query  705  KVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            K++    ++  VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  411  KLVTVGEKET-VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PHYKE_10327
Length=1200

 Score = 254 bits (650),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 167/491 (34%), Positives = 260/491 (53%), Gaps = 37/491 (8%)

Query  287  ETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIP  345
            +T YDY  +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+P
Sbjct  24   QTEYDY--LVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVP  72

Query  346  KKLMHQSSLIGETMHHDSANFGWNVASGEG---KGATFDWKQLVSNVDSYIKSINFKYKV  402
            KKLM  ++ +G  +HHD  ++G+  A+  G   + A FDW +L +  D+Y+  +N  Y+ 
Sbjct  73   KKLMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRLNGIYER  132

Query  403  ELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAIS  462
             L +  V+      +F D   + +       K++  ++V++AVGG+P     PG E  I 
Sbjct  133  NLANSKVELIRGSAAFNDNGNVVV-----DGKEVRAKNVLIAVGGKPMIPDIPGKELCID  187

Query  463  SDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIG  521
            SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD  +   + 
Sbjct  188  SDGFFELE-MLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLE  246

Query  522  EYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKL  581
            + M+ + G+   R +    + +  +G    K     D S    +D V+ A GR P  + L
Sbjct  247  DAMK-KDGVHLQRHSNIARVNQAADG---TKTLVLADGSEHSGYDVVIYAAGRVPLTSTL  302

Query  582  GLDKAGVKLNEKTGRIWT-KNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN-  639
             LDKAG+   +K G I   K ++TS   + A+GDV   P LTPVAI AGR LS RL+   
Sbjct  303  KLDKAGIA-TDKNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGM  361

Query  640  STVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPL-------ewsl  692
               ++ Y+ + T VF+    G  GL+EE + +++G+D+++VY   FV +           
Sbjct  362  GGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLINEMDET  421

Query  693  sesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  752
            +          +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + + I
Sbjct  422  TGEPKDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCMAI  480

Query  753  HPTTAEAFTTL  763
            HPT  E   TL
Sbjct  481  HPTAGEELVTL  491

>PYIR_17506
Length=509

 Score = 242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 166/484 (34%), Positives = 254/484 (52%), Gaps = 33/484 (7%)

Query  292  YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  350
            YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  351  QSSLIGETMHHDSANFGWNVASGE--GKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408
             ++ +  T+H D+  +G+    G   G    F W +L    D+YI  +N  Y+  L +  
Sbjct  90   LAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERNLGNSK  149

Query  409  VKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFW  468
            V       +F     +E+       K I+ R+V++AVGG+P     PG E+ I SD  F 
Sbjct  150  VDLIQGTAAFNAQGEVEV-----DGKVISARNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  204

Query  469  MKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQ  527
            +++  P K  VVGA Y+A+E AG L G+G D  +  R   +LR FD+ + + + + M  +
Sbjct  205  LEEL-PNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDAM-AK  262

Query  528  AGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAG  587
             GI    ++    I K  +G+   K     D S    FDTV+ A GR P  + L +  AG
Sbjct  263  DGIVVRPQSNVARIEKTLDGK---KTLVLADGSEHAGFDTVIYAAGRIPLTSNLNISAAG  319

Query  588  VKLNEKTGRIWTKNEQTSTP-NIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN-STVQMD  645
            ++  +K G I     QT++  N+FA+GDV     LTPVAI AGR LS RL+      ++ 
Sbjct  320  IE-TDKHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMEDAKIS  378

Query  646  YDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPL------ewslsesrtss  699
            Y+ + T VF+    G  GL+E+++ E++G+  ++ Y   FV +      E     +    
Sbjct  379  YNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNELDAEGNTKPK  438

Query  700  esCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEA  759
                +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V IHPT  E 
Sbjct  439  PMTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCVAIHPTAGEE  497

Query  760  FTTL  763
              TL
Sbjct  498  LVTL  501

>SPRG_11769
Length=453

 Score = 240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 253/476 (53%), Gaps = 36/476 (8%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YDLVV+GGGSGG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  352  SSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKY  411
            ++ +  +M HD+  +G+          T DW  L    D+Y+  +N  Y   L+   V +
Sbjct  56   AADLAHSMRHDAPAYGFPAVP----NTTVDWATLKQRRDAYVTRLNGIYARNLQGSGVDF  111

Query  412  ENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKK  471
             + L SF           R+G +++      VAVGG+P     PG E+ ISSD  F + +
Sbjct  112  AHGLCSFGS-------DGRRGDERL------VAVGGQPVMPDIPGIEHCISSDGFFELDE  158

Query  472  TAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQAGI  530
              P +  VVGA Y+A+E AG L+G+G D  +  R   +LR FD DM   +      + GI
Sbjct  159  R-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQSVLHDAFKRDGI  216

Query  531  EFIRKTVPESITKLE--NGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGV  588
                 +    + K++   G L +  T  D  +    FD VL ATGR P    LGL+  G+
Sbjct  217  TLQPHSTVARVDKVDPATGTLSLTTTAGDYHT---GFDCVLVATGRTPMTKHLGLEHRGI  273

Query  589  KLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN-STVQMDYD  647
            +L+          + TS P +FA+GDV++   LTPVAI AGR L+ RL+      + DY 
Sbjct  274  ELSPNGFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYT  333

Query  648  KVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVI  707
             + + VF+    G  GL+E+++ + + ED ++VY   FV + +SL E      +  +K+I
Sbjct  334  SIPSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAHEKPTTAMKLI  393

Query  708  CDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            C    +K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  394  CVGPTEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>SDRG_12187
Length=462

 Score = 240 bits (613),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 250/475 (53%), Gaps = 25/475 (5%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YDLVV+GGGSGG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  352  SSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKY  411
            ++ +  +M HD+  +G+          T DW  L    D+Y+  +N  Y   L+   V +
Sbjct  56   AADLAHSMRHDAPAYGFPAV----PNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDF  111

Query  412  ENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKK  471
               L SF     +++             +V+VAVGG+P     PG E+ ISSD  F + +
Sbjct  112  AQGLCSFGSDGRVQI---DATPLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFELDE  168

Query  472  TAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQAGI  530
              P +  VVGA Y+A+E AG L+G+G D  +  R   +LR FD DM   +      + GI
Sbjct  169  R-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQAVLHDAFQRDGI  226

Query  531  EFIRKTVPESITK-LENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVK  589
                 +    + K    G L V  T  +  S    FD VL ATGR P    LGL+  G++
Sbjct  227  TLQPHSTIARVDKDPTTGSLSVTTTAGEHHS---GFDCVLVATGRTPMTKDLGLEHRGIQ  283

Query  590  LNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN-STVQMDYDK  648
            L+          + TS P +FA+GDV+D   LTPVAI AGR L+ RL+      + DY  
Sbjct  284  LSPNGFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADYTN  343

Query  649  VCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVIC  708
            + + VF+    G  GL+E+++ + + +D ++VY   FV + +SL E      +  +K+IC
Sbjct  344  IPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAHEKPTTAMKLIC  403

Query  709  DTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
                +K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  404  VGPSEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>PHYSO_550665
Length=491

 Score = 239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 255/479 (53%), Gaps = 16/479 (3%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            T   YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFEGMGLGGTCVNFGCVPKK  59

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
            +M  ++   E +  +  ++  N A+ + +   FDW  + +  D+YIK +N  Y+  L + 
Sbjct  60   VMFNAAAHVEHLARNK-DYSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNA  118

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIF  467
             V +   +   +    +E+       K  T +HV+VA GG P     PG E+ I SD  F
Sbjct  119  QVDHVQGIAKLVAKDKVEV-----AGKVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDGFF  173

Query  468  WMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  526
             +++  P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME 
Sbjct  174  KLEQQ-PKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-  231

Query  527  QAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKA  586
            +AG++F+R      + K  +G+L    T   +E     FD +L A GR+P    LGL++ 
Sbjct  232  KAGVKFVRNMRAARVEKQADGKLTFVVTINGEEHKFPDFDAILYAVGREPRTKDLGLEEV  291

Query  587  GVKLNEKTGRIWTKNEQTSTPNIFAIGDV-IDAPELTPVAIQAGRFLSRRLYNNST-VQM  644
            GVKL+E         E TS P ++AIGD  I   ELTPVAI AGR LS RL+       +
Sbjct  292  GVKLSEGGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  645  DYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYV  704
            +Y ++ T +F+    G  G +E ++  ++GE+NV+ Y   FV L  S+++     ++  +
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMADPERKGKTA-M  410

Query  705  KVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            K++      + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  411  KLVT-VGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PITG_14083
Length=493

 Score = 238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 168/476 (35%), Positives = 255/476 (54%), Gaps = 18/476 (4%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YD +VIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  352  SSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKY  411
            ++   E ++ +  ++  N AS + +   FDW  + +  D+YIK +N  Y+  L +  V +
Sbjct  64   AAAHVEHLNRNK-DYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  412  ENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKK  471
               +   +    +E+       +  T +HV+VA GG P     PG E+ I SD  F +++
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFFKLEQ  177

Query  472  TAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGI  530
              P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME +AG+
Sbjct  178  Q-PKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  531  EFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKL  590
             F+R +    + K +NG+L    T + +E     FD+++ A GR P    LGL++ GVKL
Sbjct  236  NFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVGVKL  295

Query  591  NEKTGRIWTKNEQTSTPNIFAIGDV-IDAPELTPVAIQAGRFLSRRLYNNST-VQMDYDK  648
             E         E TS   ++AIGD  +   ELTPVAI AGR LS RL+       ++Y +
Sbjct  296  AEGGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQ  355

Query  649  VCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVIC  708
            + T +F+    G  G +E ++  ++GE+NV+VY   FV L  S+++     ++    V  
Sbjct  356  IPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAMKLV--  413

Query  709  DTTRDK-FVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
             T  DK  VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  414  -TVGDKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>H257_09722
Length=518

 Score = 238 bits (608),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 172/485 (35%), Positives = 267/485 (55%), Gaps = 26/485 (5%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            TSYDY  +V+GGGSGG++ ++ AAS+G  V V++  +   QG + GLGGTCVNVGC+PKK
Sbjct  26   TSYDY--IVLGGGSGGISSARRAASYGANVLVIE--RGREQGGA-GLGGTCVNVGCVPKK  80

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
            +M+ ++   E +H   A + +      G G +FDW  + +  DSY+  ++  Y+  L   
Sbjct  81   VMYNAAFHAEILHSAKA-YAFKGVQDVGFG-SFDWATMKTKRDSYVARLHGIYERNLAKD  138

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIF  467
             +   +   SF+D HT+ +          T  H++VAVGG P+  + PG E+AISSD  F
Sbjct  139  NITLVSGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISSDGFF  193

Query  468  WMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEV  526
             + +T P K  V+GA Y+A+E AG    +  +  V  R   +LR FD  + + + + M  
Sbjct  194  GL-ETQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-  251

Query  527  QAGIEFIRKTVPESITKLENGQLLVK--WTTEDDESCE----ETFDTVLNATGRDPDVAK  580
            ++G++F+  +  +SI K  +G L ++   TTED  S        FD ++ A GR P  + 
Sbjct  252  RSGVQFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSG  311

Query  581  LGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNN  639
              ++   +  NEK        E TS P ++AIGDV +   ELTPVAI AGR L+ RL+  
Sbjct  312  F-MEHTTIIRNEKGFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFGG  370

Query  640  ST-VQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrts  698
                 + Y ++ T VF+    G  G +E D+  +FG  NV+VY  +FV L +S+      
Sbjct  371  EPDACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPENK  430

Query  699  sesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  758
             ++  +K+IC   +++ VVG H  G  A E+ Q  G+A+K+G     + + V IHPT +E
Sbjct  431  PKTA-MKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPTASE  488

Query  759  AFTTL  763
             F T+
Sbjct  489  EFVTM  493

>PHYRA_72037
Length=493

 Score = 236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 166/475 (35%), Positives = 253/475 (53%), Gaps = 16/475 (3%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  352  SSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKY  411
            ++   E +H +  ++    A+ +     FDW  +    D+YI  +N  Y+  L +  V +
Sbjct  64   AAAHVEHLHRNE-DYSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNAKVDH  122

Query  412  ENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKK  471
               + + +    +E+       K  T +HV+VA GG P     PG E+   SD  F +++
Sbjct  123  VQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFFRLEQ  177

Query  472  TAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGI  530
              P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + + ME +AG+
Sbjct  178  Q-PKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-KAGV  235

Query  531  EFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKL  590
            +F+R T    + K ++G+L    T + +E     FD +L A GR+P    LGL+K GVKL
Sbjct  236  KFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKVGVKL  295

Query  591  NEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNST-VQMDYDK  648
             +         E TS P ++AIGD      ELTPVAI AGR LS RL+       ++Y +
Sbjct  296  ADGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQ  355

Query  649  VCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVIC  708
            + T +F+    G  G +E ++  +FGE+NV+VY   FV L  S+++     ++  +K++ 
Sbjct  356  IPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTA-MKLVT  414

Query  709  DTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
                 + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  -VGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>SPRG_05609
Length=496

 Score = 236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 252/475 (53%), Gaps = 17/475 (4%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YD +VIGGGSGG + ++ AA++G KV +++           G+GGTCVNVGC+PKK+M  
Sbjct  6    YDYIVIGGGSGGNSSARRAAAYGAKVLLIER---GHANDGAGMGGTCVNVGCVPKKIMFN  62

Query  352  SSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKY  411
            ++L  E +H   A    N+   E    +FDW  L    D+Y+  +N  Y+  L +  +  
Sbjct  63   AALHAEMLHSAHAYTFKNIQDVE--YGSFDWAALKKKRDAYVARLNGIYERNLGNNQIPL  120

Query  412  ENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKK  471
                  F+D HT+E+   R      T +H+++AVGG P     PG E+AISSD  F + +
Sbjct  121  VYGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-E  174

Query  472  TAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGI  530
            T P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   ME  AG+
Sbjct  175  TQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-HAGV  233

Query  531  EFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKL  590
             F+R++   SI K  +G                 F+TVL A GR P    LGL+   + L
Sbjct  234  HFVRESGITSIEKAVDGYADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLETTDIAL  293

Query  591  NEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNS-TVQMDYDK  648
            +          E TS PN++A+GDV     ELTPVAI AGR L+ RL+ N     ++Y +
Sbjct  294  SADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACINYHQ  353

Query  649  VCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVIC  708
            + T VF+    G  GL+E  +  ++G +NV+VY  +F  + +++SE     ++  +K+IC
Sbjct  354  IPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDDKQKTA-MKLIC  412

Query  709  DTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
                ++ VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  413  -IGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  466

>PHYRA_71927
Length=485

 Score = 235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 165/488 (34%), Positives = 254/488 (52%), Gaps = 37/488 (8%)

Query  291  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  349
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  11   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  61

Query  350  HQSSLIGETMHHDSANFGW-NVASGE--GKGATFDWKQLVSNVDSYIKSINFKYKVELRS  406
              ++ +   + HD  ++G+ + A+G   G+   FDW +L +  D+Y+  +N  Y+  L +
Sbjct  62   FIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  121

Query  407  KYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDI  466
              V+  +    F +   +E+       K++  ++V+VAVGG+P     PG E  I SD  
Sbjct  122  SKVELIHGSAKFNEKGNVEV-----DGKELLAKNVLVAVGGKPLIPDIPGKELCIDSDGF  176

Query  467  FWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYME  525
            F + +  P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD  +   + + M 
Sbjct  177  FEL-EMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAM-  234

Query  526  VQAGIEFIRKTVPES-ITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLD  584
             + G+       P S +T++E      K     D S    +D V+ A GR P  + L LD
Sbjct  235  AKDGVHL----RPHSNVTRVEQVADGTKTLVLADGSEHSGYDVVIYAAGRVPLTSNLQLD  290

Query  585  KAGVKLNEKTGRIWTKN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN-STV  642
             A +   +K G I     ++TS   + A+GDV   P LTPVAI AGR LS RL+      
Sbjct  291  NADIA-TDKHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDA  349

Query  643  QMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsse--  700
            ++ Y+ + T VF+    G  GL+EE +  ++G+DN +VY   FV + + L      +   
Sbjct  350  KVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEVDEATGE  409

Query  701  -----sCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPT  755
                    +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT
Sbjct  410  PKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPT  468

Query  756  TAEAFTTL  763
              E   TL
Sbjct  469  AGEELVTL  476

>CCI11048
Length=496

 Score = 236 bits (601),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 154/464 (33%), Positives = 243/464 (52%), Gaps = 18/464 (4%)

Query  308  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFG  367
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++   E +   S    
Sbjct  22   RRAATYGAKVLLIERHR---EYDGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  368  WNVASGEGKGATF-----DWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPH  422
                S E    +F     DW ++ +  D+YI+ +N  Y   L +  +     +   +   
Sbjct  79   RPFTSKECASHSFSFGDFDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGIAKLIAKD  138

Query  423  TLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGA  482
             +++            +H+++AVGG P   + PG E+AI SD  F ++ T P K  VVGA
Sbjct  139  RVQVNQ----DSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLE-TQPKKVAVVGA  193

Query  483  SYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESI  541
             Y+A+E AG    +  D  V  R   +LR FD  + + + E ME + G+ F+RK+  E I
Sbjct  194  GYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEME-KDGVNFVRKSHLEKI  252

Query  542  TKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKN  601
            TK ++ +L +     ++      FD ++ A GR P    LGL++ GV LNE    I    
Sbjct  253  TKAKDDKLAITARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALNETGHIIVDAQ  312

Query  602  EQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNST-VQMDYDKVCTAVFTPIEY  659
            E TS P ++A+GDV     ELTPVAI AGR L+ RL+NN     + Y ++ T VF+    
Sbjct  313  ENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHPPL  372

Query  660  GCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGF  719
            G  G +E ++  ++GE+NV+ Y   FV L +S++E     +   +K++C  +++  VVG 
Sbjct  373  GTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTAMKLVCVGSKET-VVGL  431

Query  720  HYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            H  G  A E+ Q  G+AMK+G T     + V IHPT +E   T+
Sbjct  432  HVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>CCA23647
Length=496

 Score = 235 bits (599),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 154/467 (33%), Positives = 242/467 (52%), Gaps = 24/467 (5%)

Query  308  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFG  367
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++     + H      
Sbjct  22   RRAATYGAKVLLIERHR---EYEGAGYGGTCVNYGCVPKKVMYNAA---AHVEHIERAPD  75

Query  368  WNVASGEGKGAT--------FDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFL  419
            +++     KG T        FDW ++    D+YI+ +N  Y   L +  +     +   +
Sbjct  76   YSIRPFASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLI  135

Query  420  DPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLV  479
                +++            +H+++AVGG P   + PG E+AI SD  F ++ T P K  V
Sbjct  136  AKDRVQVNQ----DSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKLE-TQPKKVAV  190

Query  480  VGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGIEFIRKTVP  538
            VGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME + G+ F+RK+  
Sbjct  191  VGAGYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHL  249

Query  539  ESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIW  598
            E I K E+ +L +     D       FD ++ A GR P    LGL+  GV+LNE    I 
Sbjct  250  EKIVKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNETGHIIV  309

Query  599  TKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNST-VQMDYDKVCTAVFTP  656
               E TS P ++A+GDV     ELTPVAI AGR L+ RL+NN     + Y ++ T VF+ 
Sbjct  310  DAQENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSH  369

Query  657  IEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFV  716
               G  G +E ++  ++GE+NV+ Y   FV L +S++E     +   +K++C  +++  V
Sbjct  370  PPLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTCMKLVCVGSKET-V  428

Query  717  VGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            VG H  G  A E+ Q  G+AMK+G T     + V IHPT +E   T+
Sbjct  429  VGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>H310_14447
Length=501

 Score = 233 bits (595),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 165/483 (34%), Positives = 259/483 (54%), Gaps = 26/483 (5%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            TSYDY  +V+GGGSGG++ +  A  +G KV V++  + +      G+GGTCVNVGC+PKK
Sbjct  7    TSYDY--IVVGGGSGGVSSASRAVEYGAKVLVIERGRVN---GGAGMGGTCVNVGCVPKK  61

Query  348  LMHQSSLIGETMHHDSANFGW----NVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVE  403
            +M+ + +  E + H + ++ +    NV  G     +FDW  + +  D+Y+  ++  Y+  
Sbjct  62   IMYNAGVHAEIL-HSAKDYSFKDVVNVKFG-----SFDWAAMKAKRDAYVNWLSAAYEEG  115

Query  404  LRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISS  463
            L  + + +      F+D HT+E+       ++ T  H+++AVGG P+    PG E+A+SS
Sbjct  116  LGEENIDHVIGAAVFVDDHTVEV-----NGQRYTAPHILIAVGGMPQMPNIPGIEHAVSS  170

Query  464  DDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGE  522
            D  F +  T P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + + +
Sbjct  171  DGFFDL-PTQPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVND  229

Query  523  YMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLG  582
             M  +AG+ F+     ESI K  +G L V     +  +    FD +++A GR P    +G
Sbjct  230  EM-AKAGVAFVTHAHLESIRKEADGSLTVVAKVGEATNEFAGFDAIVSAIGRIPRTQDVG  288

Query  583  LDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNST  641
            LDK  V+L++    +    E T+   ++AIGDV     ELTPVAI AGR L+ RL+   T
Sbjct  289  LDKTHVELSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKET  348

Query  642  -VQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsse  700
               + Y ++ T VF+    G  GL+E D+  ++G DNV VY   F  + ++L+       
Sbjct  349  NACIHYHQIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKP  408

Query  701  sCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
               +K++C    +  V+G H  G  A E+ Q  G+A+KLG       + V IHPT AE  
Sbjct  409  QTAMKLVCIGVEET-VIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIHPTAAEEM  467

Query  761  TTL  763
             T+
Sbjct  468  VTM  470

>H310_11259
Length=519

 Score = 232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 170/489 (35%), Positives = 266/489 (54%), Gaps = 25/489 (5%)

Query  283  PMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  342
            PM   TSYDY  +V+GGGSGG+A ++ AAS+G KV V++  +        GLGGTCVNVG
Sbjct  23   PMST-TSYDY--IVLGGGSGGIASARRAASYGAKVLVVERGR---TLGGAGLGGTCVNVG  76

Query  343  CIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKV  402
            C+PKK+M+ ++ + E M H +  + +    G   G +FDW  + S  D+Y+  ++  Y+ 
Sbjct  77   CVPKKVMYNAAFLAEIM-HSAKTYTFKGVQGVEFG-SFDWPAMKSKRDAYVTRLHGIYER  134

Query  403  ELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAIS  462
             L    +   + + +F+D HT+ +     G K  T  H++VAVGG P+  + PG E AIS
Sbjct  135  NLAKDGISLVSGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIPGIELAIS  189

Query  463  SDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIG  521
            SD  F + +T P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + 
Sbjct  190  SDGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVRDHVN  248

Query  522  EYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEET-----FDTVLNATGRDP  576
            + M  +AG+ F+ ++  +SI K  NG L ++ T + +     T     +D V+ A GR P
Sbjct  249  KEMR-RAGVAFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTP  307

Query  577  DVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRR  635
                 G D+  +  + K        E T+ P ++AIGD      ELTPVAI AGR L+ R
Sbjct  308  RTTDCGFDRTDIVFDRKGFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADR  367

Query  636  LYNNST-VQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslse  694
            L+       ++Y ++ T VF+    G  G +E D+  ++G  NV+VY  +FV L ++L  
Sbjct  368  LFGGEPDACINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLP  427

Query  695  srtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  754
             +    +  +KV+C   +++ VVG H  G  A E+ Q  G+A+K+G     + + + IHP
Sbjct  428  PKDMPSTA-MKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHP  485

Query  755  TTAEAFTTL  763
            T +E   T+
Sbjct  486  TASEELVTM  494

>PYIW_25301
Length=512

 Score = 229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 163/492 (33%), Positives = 247/492 (50%), Gaps = 49/492 (10%)

Query  292  YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  350
            YD +VIG GSGG+A S+ AA +   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  351  QSSLIGETMHHDSANFGWNVASGE--GKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408
             ++ +   +H D+ ++G+    G   G    F W +L    D+YI  +N  Y+  L +  
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYILRLNDIYERNLGNSK  150

Query  409  VKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFW  468
            V        F     +E+       K+I  +++++AVGG+P     PG E  I SD  F 
Sbjct  151  VDLLTGTAVFNAHGNVEM-----DGKEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFFE  205

Query  469  MKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQ-------DMANKI  520
            +++  P K  VVGA Y+A+E AG L G+G +  +  R   +LR FD+       D   K 
Sbjct  206  LEQL-PKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAMAKD  264

Query  521  GEYMEVQAGIEFIRKTVPESITK-LENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVA  579
            G  +  Q+ +  + +T     T  L+NG            S    FDTV+ A GR P  +
Sbjct  265  GIVVRPQSNVARVEQTADGKKTLFLQNG------------SEHAGFDTVIYAAGRVPLTS  312

Query  580  KLGLDKAGVKLNEKTGRIWTKNEQ-TSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYN  638
            +L L  AG+   +K G I     Q TS  N+FA+GDV     LTPVAI AGR LS RL+ 
Sbjct  313  ELNLSAAGIA-TDKHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFG  371

Query  639  N-STVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPL------ews  691
              +  ++ YD + T VF+    G  GL+E ++ E+ G+  ++ Y   FV +      +  
Sbjct  372  GMADAKISYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVD  431

Query  692  lsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  751
               +        +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V 
Sbjct  432  ADGAAKPKPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVA  490

Query  752  IHPTTAEAFTTL  763
            IHPT  E   T+
Sbjct  491  IHPTAGEELVTM  502

>PITG_13427
Length=463

 Score = 228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 160/475 (34%), Positives = 247/475 (52%), Gaps = 36/475 (8%)

Query  304  LACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHD  362
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   + HD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHD  51

Query  363  SANFGW-NVASGE--GKGATFDWKQLVSNVDSYIKSINFKY-KVELRSKYVKYENFLGSF  418
              ++G+ + A+G   GK   FDW +L +  D+Y+  +N  Y +  L +  V+    L +F
Sbjct  52   LLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATF  111

Query  419  LDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTL  478
             +   +E+     G K++  ++V++AVGG+P     PG E  I SD  F + +T P K  
Sbjct  112  NEKGNVEV-----GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFEL-ETLPKKVA  165

Query  479  VVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQAGIEFIRKTV  537
            VVGA Y+A+E AG L  +G D  +  R   +LR FD D+     E    + G+       
Sbjct  166  VVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFD-DIVRTTLEDAMAKEGVHL----R  220

Query  538  PES-ITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGR  596
            P S + ++E G    K     D S    +D V+ A GR P  + L LDKAG+  +E    
Sbjct  221  PHSNVARVELGADGTKTLVLTDGSKYSGYDVVIYAAGRVPLTSNLQLDKAGITTDEHGFI  280

Query  597  IWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN-STVQMDYDKVCTAVFT  655
               + ++TS   + A+GDV   P LTPVAI AGR LS RL+   +  ++ Y+ + T VF+
Sbjct  281  PVNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFS  340

Query  656  PIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsse-------sCYVKVIC  708
                G  GL+EE +  ++G+D ++VY   FV + + L      S           +K++C
Sbjct  341  HPPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLVC  400

Query  709  DTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
                +K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT  E   TL
Sbjct  401  AGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTL  454

>PHYRA_81103
Length=252

 Score = 220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 1/140 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WYFPKG + +GG GLGHRHNWE+ +VWIDNPALDNSTILGVSMSAS GYSK +PPK+
Sbjct  111  MYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNSTILGVSMSASIGYSKRAPPKS  170

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K++DG+SVK+ Y+YS++ GNTAL  TED GETQDLI WDQLP VA+DAL NTDWDTTLWN
Sbjct  171  KYIDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIMWDQLPDVARDAL-NTDWDTTLWN  229

Query  121  MCDVKMPLKDGEFTKNLAET  140
            + + +MPLKD  FTK L ++
Sbjct  230  LGNAQMPLKDDVFTKKLKKS  249

>H257_17037
Length=498

 Score = 228 bits (580),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 151/464 (33%), Positives = 245/464 (53%), Gaps = 24/464 (5%)

Query  307  SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANF  366
            +  A  +G KV V++  + +      G+GGTCVNVGC+PKK+M+ +    E +H  + ++
Sbjct  23   ASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKKIMYNAGFHAEILH-SAKDY  78

Query  367  GW----NVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPH  422
             +    NV  G     +FDW  + +  D+Y+  +   Y+  L  + + +     +F+D H
Sbjct  79   SFKEVVNVKFG-----SFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDH  133

Query  423  TLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGA  482
            T+E+   R      T  H+++AVGG P+  T PG E+AISSD  F +  T P K  VVGA
Sbjct  134  TVEVNGLR-----FTAPHILIAVGGVPQLPTIPGIEHAISSDGFFDLP-TQPKKVAVVGA  187

Query  483  SYVALECAGFLKGMGYDVKVMVRS-ILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESI  541
             Y+A+E AG    +  D  V  R   +LR FD  + + + + M  ++G+ F+ ++  +SI
Sbjct  188  GYIAVELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEM-AKSGVTFVTQSHLQSI  246

Query  542  TKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKN  601
             K  +G L +  T  D  +    F+ +++A GR P    +GLDK  V+L+     +    
Sbjct  247  RKEADGTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQ  306

Query  602  EQTSTPNIFAIGDV-IDAPELTPVAIQAGRFLSRRLY-NNSTVQMDYDKVCTAVFTPIEY  659
            E T+ P ++AIGD  I   ELTPVAI AGR L+ RL+ + +   + Y ++ T +F+    
Sbjct  307  ENTTVPGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPI  366

Query  660  GCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGF  719
            G  GL+E ++  ++G+ NV  Y  +F  L +SL +         +K++C    +  VVG 
Sbjct  367  GTIGLTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTAMKLVCIGVEET-VVGA  425

Query  720  HYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  426  HVAGLGADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEEMVTM  469

>PHALS_09136
Length=493

 Score = 227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 160/479 (33%), Positives = 254/479 (53%), Gaps = 16/479 (3%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            T   YD +VIGGGSGG+A ++ AA+ G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDMVYDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  59

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
            +M  +++  E ++ +  ++  N  + + +   FDW  + +  D+YI+ +N  Y+  L + 
Sbjct  60   VMFNTAVHVEHLNRNK-DYSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIYERNLSNA  118

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIF  467
             V     +   +    +++          T +HV+VA GG P     PG E+ I SD  F
Sbjct  119  QVDVIQGIAKIVAKDKIQV-----AGHIYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFF  173

Query  468  WMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  526
             +++  P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME 
Sbjct  174  KLEQQ-PKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-  231

Query  527  QAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKA  586
            +AG+EF+R      I K  + +L    T   +E     FDT+L A GR P    LGL++ 
Sbjct  232  KAGVEFVRNMSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEI  291

Query  587  GVKLNEKTGRIWTKNEQTSTPNIFAIGDV-IDAPELTPVAIQAGRFLSRRLYNNST-VQM  644
            GVKL +         E T+ P ++AIGDV +   ELTPVAI AGR L+ RL+       +
Sbjct  292  GVKLADGGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDACL  351

Query  645  DYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYV  704
            +Y ++ T +F+    G  G +E ++  RFG++N+++Y   FV L  ++++     ++  +
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMADPERKGKTA-M  410

Query  705  KVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            K++     ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHPT +E   T+
Sbjct  411  KLVT-VGEEETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  468

>PHYCA_7619
Length=462

 Score = 226 bits (576),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 155/473 (33%), Positives = 238/473 (50%), Gaps = 33/473 (7%)

Query  304  LACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHD  362
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   +HHD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHD  51

Query  363  SANFGW--NVASGE-GKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFL  419
              ++G+   V  G  GK   FDW +L +  D+Y+  +N  Y+  L +  V        F 
Sbjct  52   FLHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFN  111

Query  420  DPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLV  479
                +E+       K+I   +V++AVGG+P     PG E  I SD  F + +T P K  V
Sbjct  112  QNGNVEV-----DGKEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFEL-ETLPKKVAV  165

Query  480  VGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQAGIEFIRKTVP  538
            VGA Y+A+E AG L  +G +  +  R   +LR FD  +   + + ME + G+     +  
Sbjct  166  VGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAME-KDGVHLCPHS--  222

Query  539  ESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIW  598
             ++ ++E      +     D S    ++ V+ A GR P    L LDKAGV  +       
Sbjct  223  -NVVRVEQAADNTRTLVLADGSEHSGYEVVIYAAGRVPLTTSLQLDKAGVTTDNHGFIQV  281

Query  599  TKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN-STVQMDYDKVCTAVFTPI  657
             + +QTS  N+FA+GD    P LTPVAI AGR LS RL+      ++ Y+ + T VF+  
Sbjct  282  DEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSHP  341

Query  658  EYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsse-------sCYVKVICDT  710
              G  GL+E  +  ++G+D ++VY   FV + + L                  +K++C  
Sbjct  342  PIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVC-A  400

Query  711  TRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
             +D+ VVG H +G  A E+ Q  G+A+K+G T     D + IHPT  E   TL
Sbjct  401  GKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>HYAP_08763
Length=473

 Score = 226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 147/463 (32%), Positives = 243/463 (52%), Gaps = 18/463 (4%)

Query  304  LACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDS  363
            +A ++ AA++G KV V++  +   Q    GLGGTCVN GC+PKK+M  ++     + H +
Sbjct  1    MASARRAATYGAKVLVIERGR---QYDGMGLGGTCVNFGCVPKKIMFNTA---AHVEHLN  54

Query  364  ANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHT  423
                +++ + E     FDW ++ +  D+YI  +   Y+  L +  V +   +  F+  + 
Sbjct  55   RAKDYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNK  114

Query  424  LELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGAS  483
            +++       +  T +HV++A GG P +   PG  + I SDD F +++  P K  VVGA 
Sbjct  115  VQV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQQ-PQKVAVVGAG  168

Query  484  YVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESIT  542
            Y+A+E AG    +  D  +  R   +LR F+  + + + E ME +AG+ F+R      + 
Sbjct  169  YIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGVE  227

Query  543  KLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNE  602
            K  +G+L +     ++E     FDT+L A GR P    LGL+  GVKL E         E
Sbjct  228  KQLDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKLAEGGFIQVDAQE  287

Query  603  QTSTPNIFAIGDV-IDAPELTPVAIQAGRFLSRRLYNNST-VQMDYDKVCTAVFTPIEYG  660
             TS P ++AIGD  +   ELTPVAI AGR L+ RL+       ++Y ++ + +F+    G
Sbjct  288  NTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPPIG  347

Query  661  CCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFH  720
              G +E ++  ++GE+NV+VY   FV L  S+++     ++  +K++      + VVG H
Sbjct  348  TIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTA-MKLVT-VGEQETVVGVH  405

Query  721  YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
              G  A E+ Q  G+A+K+  T     + V IHPT +E   T+
Sbjct  406  VAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>PHYKE_6836
Length=493

 Score = 218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 159/475 (33%), Positives = 254/475 (53%), Gaps = 16/475 (3%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YD VVIGGGSGG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGR---KYDGMGLGGTCVNYGCVPKKVMFN  63

Query  352  SSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKY  411
            +++  E +  +  ++  N A  + +   FDW  + +  D+YI  +N  Y+  L+++ V +
Sbjct  64   TAMHVEHLARNR-DYSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNLQNQQVDH  122

Query  412  ENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKK  471
               +   +    +++       +  T ++++VA GG P     PG E+ I SD  F +++
Sbjct  123  VQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFFKLEQ  177

Query  472  TAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGI  530
              P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME +AG+
Sbjct  178  Q-PKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  531  EFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKL  590
            +F+R +    + K  +G+L    T +  E     FDT+L A GR P    LGL++  VKL
Sbjct  236  KFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPDFDTILYAVGRTPRTKDLGLEEINVKL  295

Query  591  NEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNST-VQMDYDK  648
            ++         E TS   ++AIGD      ELTPVAI AGR LS RL+       ++Y +
Sbjct  296  SQDGFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQ  355

Query  649  VCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVIC  708
            + T +F+    G CG +E ++ E+FG++N++ Y   FV L  S+++     ++     + 
Sbjct  356  IPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKTAM--KLV  413

Query  709  DTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
                ++ VVG H  G  A E+ Q  G+AMK+  T     + V IHPT AE   T+
Sbjct  414  CVGEEEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAAEELVTM  468

>PYVX_21517
Length=482

 Score = 214 bits (544),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 149/498 (30%), Positives = 240/498 (48%), Gaps = 71/498 (14%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  346
            T+ ++DL+VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PK
Sbjct  24   TAREFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPK  74

Query  347  KLMHQSSLIGETMHHDSANFGWNVASGEGKG----ATFDWKQLVSNVDSYIKSINFKYKV  402
            K+M+  + +   +H D+ ++G+  A+  GK       FDW++L    D+Y+  +N  Y+ 
Sbjct  75   KIMYTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYER  134

Query  403  ELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCP----GAE  458
             L +  V+       F     +E+        ++  + V++AVGG+P     P    G E
Sbjct  135  NLANSKVELLTGTARFNVDGKIEV-----DGVEVRAKKVLLAVGGKPLIPDIPVAATGKE  189

Query  459  YAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD----  513
              I SD  F +++  P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD    
Sbjct  190  LCIDSDGFFELEQL-PRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWNS  248

Query  514  --------QDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETF  565
                    Q++     +    Q G+     +  E +    +G    K     D S    F
Sbjct  249  QFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADG---TKTLVLADGSTHTGF  305

Query  566  DTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVA  625
            ++V+ A GR P    LGLD AGV  +E+      + +QT+ P+I A+GD      LTP++
Sbjct  306  ESVIYAAGRVPLTGDLGLDNAGVATDERGHIRVDEYQQTTAPDILAVGDACGTIALTPIS  365

Query  626  IQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNF  685
                                Y+ V T VF+    G  GL+E+ +  +FG++ +++Y   F
Sbjct  366  --------------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYKSTF  405

Query  686  VPLewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  745
            V + + +            +++C    D+ +VG H +G  A E+ Q  G+A+K+G T   
Sbjct  406  VNMYYGVVN----------ELVC-AGPDEKIVGLHVIGMGADEMLQGFGVAVKMGATKAD  454

Query  746  MVDTVGIHPTTAEAFTTL  763
            +   V IHPT AE   T+
Sbjct  455  LDSCVAIHPTGAEELVTM  472

>PYIR_23431
Length=468

 Score = 197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 145/461 (31%), Positives = 224/461 (49%), Gaps = 45/461 (10%)

Query  308  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFG  367
            + AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  +S     + H + N  
Sbjct  23   RRAATYGAKVLVVERGR---KYDGMGLGGTCVNYGCVPKKVMFNAS---AHVEHLNRNAD  76

Query  368  WNVASGEGKG---ATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTL  424
            +++ +   K      FDW  + +  D+YI  +N  Y+  L +  V     +   +  + +
Sbjct  77   YSITTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQI  136

Query  425  ELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASY  484
            E+          T +H++VAVGG+P     PG E+ I SD  F ++   P K  VVGA Y
Sbjct  137  EV-----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLE-AQPKKVAVVGAGY  190

Query  485  VALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITK  543
            +A+E AG    +  D  +  R   +LR FD  + + I E  E +AGI F+R +  E I K
Sbjct  191  IAIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDK  249

Query  544  LENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQ  603
              +G L +    + +E     FDT+L A GR+P    LGL++ GVKL +    +    E 
Sbjct  250  QADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQEN  309

Query  604  TSTPNIFAIGDV-IDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCC  662
            TS P I+AIGD  I   ELTP+                          T VF+    G  
Sbjct  310  TSVPGIYAIGDATITGWELTPIP-------------------------TVVFSHPPLGTI  344

Query  663  GLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFHYL  722
            G +E  + E+FG +NV+VY   FV L +++++     ++  +K++     +  V   H  
Sbjct  345  GYTEPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTA-MKLVTVGEDEVVVG-VHVA  402

Query  723  GPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  403  GEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>HYAP_04843
Length=430

 Score = 196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 130/420 (31%), Positives = 211/420 (50%), Gaps = 29/420 (7%)

Query  359  MHHDSANFGWNVASGEGKGAT------FDWKQLVSNVDSYIKSINFKYKVELRSKYVKYE  412
            + HD  ++G+     EG G +      FDW +L +  D+Y++ +N  Y+  L S  V++ 
Sbjct  5    LQHDVVHYGF---EKEGTGGSLGAQMHFDWTKLKTRRDAYVRRLNGIYERNLASSKVEFI  61

Query  413  NFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKT  472
                 F     +E+       K++  ++V++AVGG+P     PG E  I SD  F +  T
Sbjct  62   QGSARFNKQGNVEV-----DGKEVLAKNVMIAVGGKPMIPDIPGKELCIDSDGFFELD-T  115

Query  473  APGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQAGIE  531
             P K  V+GA Y+A+E AG L  +G +  +  R   +LR FD  +   + + M +  G+ 
Sbjct  116  LPKKVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVRTTLEDAMAID-GLH  174

Query  532  FIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLN  591
                +    + +  +G   +  T   D S    FD V+ A GR P   KL LD AGV  N
Sbjct  175  LRPNSNVARVEQAADGTNTLVLT---DGSAHCGFDIVIYAAGRVPLTDKLDLDNAGVATN  231

Query  592  EKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN-STVQMDYDKVC  650
            +    +  + ++TS   +FA+GDV   P LTPVA+ AGR LS RL+ N    ++ Y+ + 
Sbjct  232  KHGYIVVNEFQETSNSKVFAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIP  291

Query  651  TAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPL-------ewslsesrtssesCY  703
            T VF+    G  GL+E+ +  ++G+D+++VY  +FV +           +          
Sbjct  292  TVVFSHPPIGTIGLTEKQAQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTA  351

Query  704  VKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            +K++C   ++K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT +E   TL
Sbjct  352  IKLVCAGKKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYAR_17714
Length=444

 Score = 195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 153/483 (32%), Positives = 239/483 (49%), Gaps = 61/483 (13%)

Query  284  MEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGC  343
            M  ET YDY  +VIGGGSGG+A ++ AA  G KV +++  + +      GLGGTCVN GC
Sbjct  1    MSTETVYDY--IVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGC  55

Query  344  IPKKLMHQSSLIGETMHHDSANFGWNVASG-EGKGATFDWKQLVSNVDSYIKSINFKYKV  402
            +PKK+M  ++     + H + N  +++ SG E +   FDW  + +  D+YI  +N  Y+ 
Sbjct  56   VPKKVMWNAA---SHVEHLARNADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYER  112

Query  403  ELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAIS  462
             + +  +     + S      + +      T     +H++VAVGG P     PG E+AI 
Sbjct  113  NIGNAKIDLIEGIASLTAKDAVTV---DGKTXXXXGKHILVAVGGVPAMPQIPGIEHAID  169

Query  463  SDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIG  521
            SDD F +K T P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + 
Sbjct  170  SDDFFKLK-TQPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVN  228

Query  522  EYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKL  581
              M+ + G+ F+R++   +I K  +G+L V+ T +  ++    FD VL A GR+P    L
Sbjct  229  AEMD-KHGVHFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGL  287

Query  582  GLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNS  640
            GL+  GVKL++       K E TS   ++AIGD      ELTP                 
Sbjct  288  GLESVGVKLSDAGFIEVDKFENTSVDGVYAIGDATTTGYELTP-----------------  330

Query  641  TVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsse  700
                                       ++ E+FG D+V+VY   FV L +++++    S+
Sbjct  331  --------------------------PEAVEKFGADHVKVYTSTFVNLLYAMADPDHKSK  364

Query  701  sCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
            +  +K++C    ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE  
Sbjct  365  TA-MKLVC-VGENEQVVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEEL  422

Query  761  TTL  763
             T+
Sbjct  423  VTM  425

>PHYKE_4541
Length=147

 Score = 182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 106/143 (74%), Gaps = 4/143 (3%)

Query  1    MYAWYFPKGRKITG----GAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSS  56
            MYAWYFPKGR+           GHRHNWEYAIVWIDNPALD+  ILGVSMSA+  YSK +
Sbjct  1    MYAWYFPKGREAVSMHPYARFFGHRHNWEYAIVWIDNPALDDPAILGVSMSAATSYSKRA  60

Query  57   PPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116
            PP AK++DG S+K++YY + +  +TALR T+  GE QDL+TWDQLP  A++AL +TDWDT
Sbjct  61   PPMAKYLDGDSLKVEYYSNAVVASTALRLTKTKGEFQDLVTWDQLPDAARNALIDTDWDT  120

Query  117  TLWNMCDVKMPLKDGEFTKNLAE  139
            TL+N    K PLKDG F + LA+
Sbjct  121  TLFNTAGAKFPLKDGVFNETLAK  143

>PHYRA_81102
Length=251

 Score = 184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 108/144 (75%), Gaps = 4/144 (3%)

Query  1    MYAWYFPKGRKITGGAGL----GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSS  56
            MYAWYFPKGR  T         GHRHNWEY +VWIDNP L+N+T+LGVSMSAS GYSK +
Sbjct  105  MYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQA  164

Query  57   PPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116
            P   K+VDG+SVK+ YYY+ + GNTAL+ TED GE QDLI WDQL  +A+ +LN+TDWD 
Sbjct  165  PTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224

Query  117  TLWNMCDVKMPLKDGEFTKNLAET  140
            TL+ +  +KMPLKDG F + L +T
Sbjct  225  TLFGLAGLKMPLKDGVFEELLDKT  248

>PHYRA_72504
Length=251

 Score = 184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 108/144 (75%), Gaps = 4/144 (3%)

Query  1    MYAWYFPKGRKITGGAGL----GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSS  56
            MYAWYFPKGR  T         GHRHNWEY +VWIDNP L+N+T+LGVSMSAS GYSK +
Sbjct  105  MYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQA  164

Query  57   PPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116
            P   K+VDG+SVK+ YYY+ + GNTAL+ TED GE QDLI WDQL  +A+ +LN+TDWD 
Sbjct  165  PTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224

Query  117  TLWNMCDVKMPLKDGEFTKNLAET  140
            TL+ +  +KMPLKDG F + L +T
Sbjct  225  TLFGLAGLKMPLKDGVFEELLDKT  248

>PPTG_17125
Length=283

 Score = 181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 108/141 (77%), Gaps = 4/141 (3%)

Query  1    MYAWYFPKGRKITGGAGL----GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSS  56
            MYAWYFPKGR       +    GHRHNWEYAIVWIDNP L+NSTILGVSMSAS GY+  +
Sbjct  137  MYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQT  196

Query  57   PPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116
            PP+ ++VDG SVKL YYY+ + G+T+L+ TE  GE QDLITWD+L  +A+ +LN+TDWD 
Sbjct  197  PPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDE  256

Query  117  TLWNMCDVKMPLKDGEFTKNL  137
            TL+N+  +KMPLKDG F + L
Sbjct  257  TLFNLAGLKMPLKDGVFDELL  277

>PITG_18453
Length=252

 Score = 178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 110/141 (78%), Gaps = 4/141 (3%)

Query  1    MYAWYFPKGRKITGGAGL----GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSS  56
            MYAWYFPKGR       +    GHRHNWEYAIVWIDNP L+NSTILGVS+SAS  Y+  +
Sbjct  106  MYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASET  165

Query  57   PPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116
            PP+A HVDG SVKL+YYY+ + G+T+L+ TED GE QDL+TWDQL  +A+ +LNNTDWD 
Sbjct  166  PPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDE  225

Query  117  TLWNMCDVKMPLKDGEFTKNL  137
            TL+N+  +KMPLKDGEF + L
Sbjct  226  TLFNLAGLKMPLKDGEFDELL  246

>PHYCA_129485
Length=251

 Score = 178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 10/144 (7%)

Query  1    MYAWYFPKGRKITGGAGL-------GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYS  53
            MYAWYFPKGR   G   L       GHRHNWEY IVWIDNP   NSTILGVSMSA+ GY+
Sbjct  105  MYAWYFPKGR---GAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYA  161

Query  54   KSSPPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTD  113
              +PP+A +VDG SVKL+YYY+ + G+T+L+ TED GE QDLITWD+L  +A+ +LN+TD
Sbjct  162  SQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTD  221

Query  114  WDTTLWNMCDVKMPLKDGEFTKNL  137
            WD TL+++  +KMPLKDG F + L
Sbjct  222  WDETLFDLAGLKMPLKDGVFQELL  245

>PHYKE_6286
Length=250

 Score = 176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 1/141 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPK R+       GHRH W++A+VWID+PA DNST+ GVSMSAS GY K SPPK+
Sbjct  107  MYAWYFPKARQRLSKYFYGHRHMWQWAVVWIDDPASDNSTVQGVSMSASVGYQKRSPPKS  166

Query  61   KHVDGSSVKLDYYYSV-IRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+VD SSVKLD Y      G  +LR TED GETQDLI WDQL   A+++L++ D+D +LW
Sbjct  167  KYVDDSSVKLDSYVDFWWSGKASLRLTEDTGETQDLIQWDQLTDAARESLSSFDFDESLW  226

Query  120  NMCDVKMPLKDGEFTKNLAET  140
            N   +KMPLKDG FTKNL  +
Sbjct  227  NTKKIKMPLKDGVFTKNLKRS  247

>PHYCA_121494
Length=248

 Score = 175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFP G+      GLGHR+ WEYA++W+D P  DNST+LGVS+SA+ G+SK +P K 
Sbjct  106  MYAWYFPMGQAPVPPVGLGHRNGWEYAVIWLDRPTADNSTLLGVSLSAAVGWSKEAPAKQ  165

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K +DG+S+K+ YYY+ I  NTA++YTE+ GE Q LITWDQLP  A++AL NTDWD T +N
Sbjct  166  KWMDGNSLKVSYYYNNIFRNTAVKYTEEKGEFQTLITWDQLPDAARNALINTDWDETPFN  225

Query  121  MCDVKMPLKDGEFTKNL  137
            +  VKMP+KDG F + L
Sbjct  226  VARVKMPMKDGVFMEKL  242

>PHYCA_10034
Length=274

 Score = 174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFP G+      GLGHR+ WEYA++W+D P  DNST+LGVS+SA+ G+SK +P K 
Sbjct  132  MYAWYFPMGQAPVPPVGLGHRNGWEYAVIWLDRPTADNSTLLGVSLSAAVGWSKEAPAKQ  191

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K +DG+S+K+ YYY+ I  NTA++YTE+ GE Q LITWDQLP  A++AL NTDWD T +N
Sbjct  192  KWMDGNSLKVSYYYNNIFHNTAVKYTEEKGEFQTLITWDQLPDAARNALINTDWDETPFN  251

Query  121  MCDVKMPLKDGEFTKNL  137
            +  VKMP+KDG F + L
Sbjct  252  VARVKMPMKDGVFMEKL  268

>PPTG_06973
Length=165

 Score = 169 bits (429),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 103/138 (75%), Gaps = 1/138 (1%)

Query  1    MYAWYFPKGR-KITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPK  59
            MYAW+FPK R        LGHRH WEYAIVW+D P  DNSTILGVS+SA+ G++K +PP 
Sbjct  22   MYAWFFPKARAPFPVLRFLGHRHGWEYAIVWLDKPNADNSTILGVSVSAAAGWAKEAPPP  81

Query  60   AKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
             K++DG+S+K+ YYY+ I GNTA++YT++ GE QDLITW+QL  +A+  LNNTDWD T  
Sbjct  82   EKYLDGNSLKVAYYYNHIYGNTAVKYTDETGEFQDLITWNQLSDLARSYLNNTDWDETPL  141

Query  120  NMCDVKMPLKDGEFTKNL  137
            N   +KMP+KDG F K L
Sbjct  142  NAALLKMPMKDGVFMKKL  159

>PHYRA_71825
Length=254

 Score = 169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 101/141 (72%), Gaps = 4/141 (3%)

Query  1    MYAWYFPKGRKIT----GGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSS  56
            MYAWYFPKGR            GHR+ WEYA+VW+DN    NST+L  S+SA+ G+SK +
Sbjct  108  MYAWYFPKGRAPLPVPLSLRFFGHRNGWEYAVVWLDNLNAKNSTVLATSLSAAVGWSKEA  167

Query  57   PPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116
            PPK K+ DG+S+ + YYY+ I GNTA++YTED GE Q LITWDQLP +A+ ALNNTDWD 
Sbjct  168  PPKEKYFDGTSLMVSYYYNHIFGNTAVKYTEDAGEFQPLITWDQLPDLARKALNNTDWDA  227

Query  117  TLWNMCDVKMPLKDGEFTKNL  137
            T  N+  VKMP+KDG F + L
Sbjct  228  TPSNVARVKMPMKDGVFLEKL  248

>PYVX_16175
Length=446

 Score = 169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 141/482 (29%), Positives = 228/482 (47%), Gaps = 59/482 (12%)

Query  284  MEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGC  343
            M  ET+YDY ++  G G   +A ++ AAS G KV +++  + +      GLGGTCVN GC
Sbjct  1    MSTETTYDYVVLGGGSGG--VASARRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGC  55

Query  344  IPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVE  403
            +PKK+M  ++   E ++         +   + +   FDW  + +  D+YI  +N  Y+  
Sbjct  56   VPKKVMFNAAAHVEHLNRAGDYSVTTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERN  115

Query  404  LRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISS  463
            L +  +     +   +  + LE+       K  T +++++A GG P     PG E+AI S
Sbjct  116  LGNAKIDVVQGVARVVARNQLEV-----DGKVYTGKNLLLAPGGVPTLPPIPGIEHAIDS  170

Query  464  DDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGE  522
            D  F +++  P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + +  
Sbjct  171  DGFFKLEQQ-PRKVAVVGAGYIAVEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNA  229

Query  523  YMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLG  582
             ME + G++F+R++    I KLE+G+L +    +        FDTVL A GR+P  A LG
Sbjct  230  EME-KNGVQFVRRSHITRIDKLEDGKLQITAEVDGATQTIGGFDTVLFAIGREPRTADLG  288

Query  583  LDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRFLSRRLYNNST  641
            L+  GV L++K        E TS   ++AIGD      ELTP                  
Sbjct  289  LEAIGVDLDDKGFIKVDAQENTSAAGVYAIGDATTTGWELTP------------------  330

Query  642  VQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsses  701
                                      D+  ++G +NV+VY   FV L  ++++     ++
Sbjct  331  -------------------------PDAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKT  365

Query  702  CYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFT  761
              +K++    ++  VVG H  G  A E+ Q  G+A+KLG T     + V IHPT +E   
Sbjct  366  A-MKLVTVGAQET-VVGVHVAGEGADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELV  423

Query  762  TL  763
            T+
Sbjct  424  TM  425

>PPTG_16851
Length=249

 Score = 162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 101/138 (73%), Gaps = 2/138 (1%)

Query  1    MYAWYFPKGR-KITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPK  59
            MYAWYFPKGR  I      GHRH WEYA+VW+D  A  NST+LG SMSA+ G++K SP  
Sbjct  107  MYAWYFPKGRAPIPAPRSYGHRHGWEYAVVWLDK-ASANSTLLGTSMSAAIGWAKESPTP  165

Query  60   AKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
             +++DG+S+K+ YY++    NTA++YT+D GE QDLI WDQLP VA++AL NTDWD T  
Sbjct  166  KEYLDGNSLKVAYYFNDDSINTAVKYTQDAGEFQDLIIWDQLPDVARNALVNTDWDETPL  225

Query  120  NMCDVKMPLKDGEFTKNL  137
            N+  VKMP+KDG F + L
Sbjct  226  NVARVKMPMKDGVFMEKL  243

>PPTG_08893
Length=251

 Score = 157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 100/139 (72%), Gaps = 1/139 (1%)

Query  1    MYAWYFPKGR-KITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPK  59
            MY WYFPKGR  I G    GHRH WEYA+VW+D    DNSTILG S+SA+ G++K SP  
Sbjct  108  MYTWYFPKGRAPIPGPRSSGHRHGWEYAVVWLDKLTADNSTILGTSLSAAVGWAKESPTP  167

Query  60   AKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
             +++DG+S+K+ YY++    NTA++YT+  G  QDLI WDQL  VA+ +L+NTDWD T +
Sbjct  168  KEYLDGNSLKVAYYFNDDFKNTAVKYTQAGGAFQDLIIWDQLSDVARASLSNTDWDETPF  227

Query  120  NMCDVKMPLKDGEFTKNLA  138
            N+  VKMP+KDG F + L+
Sbjct  228  NVARVKMPMKDGVFEEKLS  246

>PPTG_07667
Length=143

 Score = 150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 93/140 (66%), Gaps = 2/140 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+       GHRH W YAIVW DNP  DNSTILGVSMS+  GY K SPPK+
Sbjct  1    MYAWYFPKGRQYIRKYRSGHRHYWSYAIVWTDNPNPDNSTILGVSMSSGVGYMKRSPPKS  60

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            ++V DG++VK D Y S       +R T+  G+TQDLITW+QL   A+ AL+  D+D   W
Sbjct  61   EYVIDGTTVKFDSYNSFWGSKQGVRLTKKSGDTQDLITWEQLSKQARTALSEADFDVQ-W  119

Query  120  NMCDVKMPLKDGEFTKNLAE  139
             +  V MPLKDG FT  L +
Sbjct  120  TLKKVVMPLKDGAFTDRLQK  139

>PITG_09716
Length=250

 Score = 153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 99/139 (71%), Gaps = 1/139 (1%)

Query  1    MYAWYFPKGR-KITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPK  59
            MY WYFPKGR  I G    GHRH WEYA+VW+D    ++STILG S+SA+ G++K SP  
Sbjct  107  MYTWYFPKGRAPIPGLRSSGHRHGWEYAVVWLDRLDANSSTILGTSLSAAVGWAKESPTP  166

Query  60   AKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
             +++DG S+K+ YY++    NTA++YT+D G  QDLI WDQL   A+ +L NTDWD TL+
Sbjct  167  KEYLDGHSLKVAYYFNDDFSNTAVKYTQDGGAFQDLIQWDQLSDPARASLINTDWDETLF  226

Query  120  NMCDVKMPLKDGEFTKNLA  138
            N+  VKMP+KDG F + L+
Sbjct  227  NVARVKMPMKDGVFEEKLS  245

>PITG_19936
Length=249

 Score = 152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 94/140 (67%), Gaps = 2/140 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPK R+       GHRH W YAIVW +NP  DNSTILGVSMS+  GY K SPPK+
Sbjct  107  MYAWYFPKSRQYVDKYRFGHRHYWSYAIVWTNNPNPDNSTILGVSMSSGVGYMKRSPPKS  166

Query  61   KH-VDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+ VDG++VKLD+Y+S       L+ TE  GETQDLITW+QL   A++AL+  D+D + W
Sbjct  167  KYVVDGTTVKLDWYWSFWGSKQGLQLTEKSGETQDLITWEQLSEEARNALSEADFDVS-W  225

Query  120  NMCDVKMPLKDGEFTKNLAE  139
                  MPLKD  FT  L +
Sbjct  226  AFTKAVMPLKDDIFTSRLKK  245

>PHYSO_261265
Length=247

 Score = 150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 99/137 (72%), Gaps = 2/137 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFP GR        GHR+ WEYAIVW+D+ +  NSTILG S+SA+ G++K  P   
Sbjct  107  MYAWYFPMGRAPL--LPFGHRNGWEYAIVWLDSVSSTNSTILGTSLSAAVGWAKEVPRNR  164

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K++DG+++K+ YY++     TA+ YTE++GE QD+ITWDQLP   +D+L+NTDWD T +N
Sbjct  165  KYLDGNNLKVAYYFNRDVRCTAVEYTEEIGEFQDVITWDQLPAPTRDSLSNTDWDHTPFN  224

Query  121  MCDVKMPLKDGEFTKNL  137
            +  +KMP+KDG F + L
Sbjct  225  VALLKMPMKDGVFQEKL  241

>PPTG_07668
Length=136

 Score = 145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 92/140 (66%), Gaps = 9/140 (6%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+       GHRH W YAIVW DNP  DNSTILGVSMS+  GY K SPPK+
Sbjct  1    MYAWYFPKGRQYIRKYRSGHRHYWSYAIVWTDNPNPDNSTILGVSMSSGVGYMKRSPPKS  60

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            ++V DG++VK D           +R T+  G+TQDLITW+QL   A+ AL+  D+D   W
Sbjct  61   EYVIDGTTVKFD-------SKQGVRLTKKSGDTQDLITWEQLSEQARTALSEADFDVQ-W  112

Query  120  NMCDVKMPLKDGEFTKNLAE  139
             +  V MPLKDG FT+ L +
Sbjct  113  TLKKVVMPLKDGAFTERLEK  132

>PHYSO_526774
Length=249

 Score = 148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 93/138 (67%), Gaps = 2/138 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR++  G   GH H W YAIVWIDNP  DNSTILGVSMSA  GY K+SPPK+
Sbjct  107  MYAWYFPKGRRMGDGYNSGHHHYWSYAIVWIDNPNPDNSTILGVSMSAGVGYRKASPPKS  166

Query  61   KH-VDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+ VDG +VK D Y S       +R T   G+ QDLITW+QL   A+ AL++ D+D   W
Sbjct  167  KYVVDGVTVKFDSYRSFWGSKQGVRLTTKSGDQQDLITWEQLTDEARTALSDADFDVN-W  225

Query  120  NMCDVKMPLKDGEFTKNL  137
            ++ +V MPLKD    + L
Sbjct  226  SLKNVVMPLKDDALRERL  243

>PHYCA_118548
Length=246

 Score = 148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 91/141 (65%), Gaps = 4/141 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR   GG    HRH WEYAIVW D+P   NS+I GVSMSA  GY K++PP  
Sbjct  108  MYAWYFPKGRYHLGG----HRHYWEYAIVWTDSPTSSNSSIQGVSMSAGVGYGKATPPML  163

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K++DG+S+K D ++S++    AL+ T++ GE QDLITWDQL V A+D LN    D   W 
Sbjct  164  KYIDGNSIKFDSHFSLLGNKAALQLTKEAGERQDLITWDQLTVAARDTLNGDALDGKAWF  223

Query  121  MCDVKMPLKDGEFTKNLAETL  141
                ++P KD  F K L +  
Sbjct  224  TDKDEVPFKDDIFVKRLQKAF  244

>PYIR_20273
Length=505

 Score = 154 bits (389),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 138/486 (28%), Positives = 216/486 (44%), Gaps = 39/486 (8%)

Query  289  SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  348
            S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  31   STEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKA  82

Query  349  MHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408
            +  S+ +  +  HD A +G  V+       + ++ +++ + +  +K++    +   +   
Sbjct  83   LLHSTHLYHSAQHDFAKYGIEVSE-----VSMNFGKMMKSKEKAVKTLTGGIEQLFKKNK  137

Query  409  VKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQL-TCP---GAEYAISSD  464
            V Y    G  +  + + +     G + +T +++++A G     L   P    A   + S 
Sbjct  138  VTYIKGHGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVPVDNAAGKIVDST  197

Query  465  DIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLR---GFDQDMANKIG  521
                +KK  P   +VVGA  + LE     K +G   KV V   L R   G D ++  +  
Sbjct  198  GALELKKV-PEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELGKEFT  254

Query  522  EYMEVQA-GIEFIRKTVP-----ESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRD  575
            + ++ Q  G EF  K        E IT                 S  E  D VL ATGR 
Sbjct  255  KLLKKQGLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIEC-DAVLVATGRR  313

Query  576  PDVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSR  634
            P    LGL+  G++  +K GRI   +  +T  PNIFAIGDVI  P L   A + G   + 
Sbjct  314  PYTNGLGLENMGIQ-TDKFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACAE  372

Query  635  RLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslse  694
             +       ++Y+ +   ++T  E    G +E    E+  E+ V  Y+    P+  +   
Sbjct  373  TIAGKHG-HVNYNAIPGVIYTFPEVASVGKTE----EQLKEEGV-TYNVGKFPMLANSRA  426

Query  695  srtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  754
                     VKVI D   DK ++G H +  NAGE+     L M+ G + + +  T   HP
Sbjct  427  RAVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSEDIARTCHAHP  485

Query  755  TTAEAF  760
            T +EAF
Sbjct  486  TLSEAF  491

>CCA22989
Length=494

 Score = 154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 136/484 (28%), Positives = 221/484 (46%), Gaps = 37/484 (8%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQK-VCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  346
            +S +YDL+VIGGG GG   + +AA  G K VC+        +GT   LGGTC+NVGCIP 
Sbjct  23   SSTEYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPS  73

Query  347  KLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRS  406
            K +  SS +  T  HD    G      E      ++ +++   +  +K +    +   + 
Sbjct  74   KALLHSSHMFHTAQHDFKAIGI-----EASDLRLNFGKMMKAKEKSVKVLTSGIEGLFKK  128

Query  407  KYVKYENFLGSFL--DPHTLELWHPRKGTKQITTRHVVVAVGGRPKQL-TCP--GAEYAI  461
              V Y    G+ +  D  ++      KG + I  +++++A G     L  CP    +  I
Sbjct  129  NKVAYIKGHGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRI  188

Query  462  SSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKI  520
                   + K+ P + +VVGA  + LE     + +G +V V+   + +  G D ++  + 
Sbjct  189  VDSTGALVLKSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREF  248

Query  521  GEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEET---FDTVLNATGRDPD  577
             + ++ Q G +F   T    +T  +  +  V  T ED +   ET    D VL ATGR P 
Sbjct  249  AKTLQKQ-GFKFKFAT---KVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPF  304

Query  578  VAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRL  636
               LGL+  G++  +K GRI   N  +T  PNI+AIGDVI  P L   A + G   +  +
Sbjct  305  TQNLGLENLGIQ-TDKLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEI  362

Query  637  YNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesr  696
                   ++Y+ +   ++T  E  C G +EE   E     NV  +     P+  +     
Sbjct  363  MLGKQGHVNYNAIPGVIYTFPEVACVGRTEEQLKEEGVSYNVGKF-----PMIANSRARA  417

Query  697  tssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  756
                  +VKV+     D+ ++G H +  NAGE+     L ++ G + + +  T   HPT 
Sbjct  418  VGETDGFVKVLAQKDNDR-ILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTL  476

Query  757  AEAF  760
            +EA 
Sbjct  477  SEAL  480

>CCI10477
Length=494

 Score = 153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 134/482 (28%), Positives = 221/482 (46%), Gaps = 35/482 (7%)

Query  289  SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  348
            S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  24   SSEYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKA  75

Query  349  MHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408
            +  SS +  T  HD  + G  V+         ++ +++   +  +K +    +   +   
Sbjct  76   LLHSSHLFHTAQHDFKSIGIEVSD-----LRLNFGKMMKAKEKSVKVLTSGIEGLFKKNK  130

Query  409  VKYENFLGSFLDPH--TLELWHPRKGTKQITTRHVVVAVGGRPKQL-TCP--GAEYAISS  463
            V Y    G  +  +  ++ L    KG + IT +++++A G     L  CP    +  I  
Sbjct  131  VAYIKGHGKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKIVD  190

Query  464  DDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGE  522
                 + K+ P + +VVGA  + LE     + +G +V V+   + +  G D ++  +  +
Sbjct  191  STGALVLKSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAK  250

Query  523  YMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEET---FDTVLNATGRDPDVA  579
             ++ Q G++F   T   S TK+      V  T ED +   ET    D VL ATGR P   
Sbjct  251  TLQKQ-GLKFKFATRVTS-TKVNGDN--VTITMEDAKGGNETSMECDVVLVATGRRPFTN  306

Query  580  KLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYN  638
             LGL+  G++  +K GRI   +  +T+ P+I+AIGDVI  P L   A + G   +  +  
Sbjct  307  GLGLESMGIQ-TDKMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IAAVEIML  364

Query  639  NSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrts  698
                 ++Y+ +   ++T  E  C G +EE   E     NV  +     P+  +       
Sbjct  365  GKHGHVNYNAIPGVIYTHPEVACVGKTEEQLKEEGISYNVGKF-----PMIANSRARAVG  419

Query  699  sesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  758
                +VKV+     D+ ++G H +  NAGE+     L ++ G   + +  T   HPT +E
Sbjct  420  ETDGFVKVLAQKDNDR-ILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTLSE  478

Query  759  AF  760
            A 
Sbjct  479  AL  480

>PPTG_07664
Length=245

 Score = 145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 6/138 (4%)

Query  1    MYAWYFPKGRK-ITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPK  59
            MYAWYFPKGR  ITG     HRH WEYAIVW D+    NS+I GVSMSA  G++K++PP 
Sbjct  107  MYAWYFPKGRYGITG-----HRHYWEYAIVWTDSATSTNSSIQGVSMSAGVGHAKATPPM  161

Query  60   AKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
             K+VDGSS+KLD Y+S +    AL+ T++ GETQDLITWDQL V A+D LN+   D  +W
Sbjct  162  LKYVDGSSIKLDSYFSFMGNKAALQLTKEHGETQDLITWDQLTVAARDTLNSDALDGNVW  221

Query  120  NMCDVKMPLKDGEFTKNL  137
                 ++P KD  F + L
Sbjct  222  LTNKDEVPFKDDIFMQRL  239

>PYAP_22645
Length=1565

 Score = 155 bits (392),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 133/479 (28%), Positives = 219/479 (46%), Gaps = 31/479 (6%)

Query  289   SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  348
             S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  1097  SSEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKA  1148

Query  349   MHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408
             +  ++ +     HD + +G  V+         ++  ++ + +  +K++    +   +   
Sbjct  1149  LLHATHMYHAAQHDFSKYGIEVSD-----VKMNFDGMMKSKEKAVKTLTGGIEGLFKKNK  1203

Query  409   VKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYA----ISSD  464
             V Y    G  +  + + +     G + +  +++++A G     L     + A    + S 
Sbjct  1204  VTYVKGFGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDNAAGKIVDST  1263

Query  465   DIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS-ILLRGFDQDMANKIGEY  523
                 +KK  P   +V+G   + LE     K +G  V V+  +  +  G DQ++  +  + 
Sbjct  1264  GALELKKV-PEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKEFTKL  1322

Query  524   MEVQAGIEFIRKT-VPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLG  582
             ++ Q G++F   T V  S    +   L V+       S  E  DTVL ATGR P    LG
Sbjct  1323  LKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVATGRRPFTKGLG  1380

Query  583   LDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNST  641
             L++ G++  +K GRI   N  +T  PNIFAIGDVI  P L   A + G      +     
Sbjct  1381  LEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVENIAGLHG  1439

Query  642   VQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsses  701
               ++YD +   ++T  E    G +E    E+  E+ V  Y+    P+  +      +   
Sbjct  1440  -HVNYDAIPGVIYTYPEVASVGKTE----EQLKEEGV-AYNVGKFPMMANSRARAVAESD  1493

Query  702   CYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
              +VKVI D T D+ ++G H +  NAGE+     L M+ G   + +  T   HPT +EAF
Sbjct  1494  GFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHPTLSEAF  1551

>PHYRA_74307
Length=249

 Score = 142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 93/141 (66%), Gaps = 2/141 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+       GHRH W Y IVW D+ + DNSTILGVSMSA  GY K SPPK+
Sbjct  107  MYAWYFPKGRQYIHKYHSGHRHYWSYGIVWTDSSSPDNSTILGVSMSAGVGYRKVSPPKS  166

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K V DG++VK D Y S       +R T+  G+TQDLITW+Q+   A+ AL +TD+D   W
Sbjct  167  KFVIDGTTVKFDSYKSFWGSKQGVRLTKKTGDTQDLITWEQMTEEARTALVDTDFDVE-W  225

Query  120  NMCDVKMPLKDGEFTKNLAET  140
            ++  V MPL D  FT+ L ++
Sbjct  226  SLKKVVMPLSDDAFTERLEKS  246

>PHYCA_132252
Length=249

 Score = 141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 91/140 (65%), Gaps = 2/140 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+       GHRH W YAIVW+D+   DNSTILGVSMSA  GY+K +PPK+
Sbjct  107  MYAWYFPKGRQYISKYRFGHRHFWSYAIVWMDSDVPDNSTILGVSMSAGVGYNKKTPPKS  166

Query  61   KH-VDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+ VDG++VK D Y S   G  A+  T   GETQDLITW+QL    +  L + D+D   W
Sbjct  167  KYVVDGTTVKFDSYQSFWGGKLAVGLTTKEGETQDLITWEQLTDEGRTGLTDADFDVD-W  225

Query  120  NMCDVKMPLKDGEFTKNLAE  139
            ++  V MP+ D  F K L +
Sbjct  226  SIRKVVMPMADDVFVKKLKK  245

>PHYSO_254108
Length=246

 Score = 140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 93/137 (68%), Gaps = 5/137 (4%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WYFPKGR+       GHRH WEYAI+W D+P+ DNST LG+SMSA  G+ K +P   
Sbjct  109  MYTWYFPKGRQDV----WGHRHFWEYAIIWTDSPSPDNSTFLGISMSAGVGHGKQTPVLL  164

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K+++G+SVKL+ +YSV+    AL+ T+D G+ QDLITW QLPV A+DALN   +D T + 
Sbjct  165  KYMNGNSVKLESHYSVLGNKAALQLTKDSGDFQDLITWGQLPVPARDALNGDAFDVTYF-  223

Query  121  MCDVKMPLKDGEFTKNL  137
                +MPLKD  F   L
Sbjct  224  FNKFEMPLKDRVFMSVL  240

>PHYCA_9298
Length=248

 Score = 140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 91/140 (65%), Gaps = 2/140 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+       GHRH W YAIVW+D+   DNSTILGVSMSA  GYSK +PPK+
Sbjct  106  MYAWYFPKGRQYISKYRFGHRHFWSYAIVWMDSDVPDNSTILGVSMSAGVGYSKETPPKS  165

Query  61   KH-VDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+ VDG++VK   Y+S      A+  T   GE+QDLI W+QL   A+  L + D+D   W
Sbjct  166  KYVVDGTTVKFKSYHSFWGSKLAVGLTTKEGESQDLIAWEQLTDEARSGLTDADFDVD-W  224

Query  120  NMCDVKMPLKDGEFTKNLAE  139
            +   V MP+ DG FT+ L +
Sbjct  225  SFRKVVMPMTDGVFTEKLKK  244

>PHYSO_526623
Length=249

 Score = 140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 89/138 (64%), Gaps = 2/138 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+       GHRH W YAIVW D+   DNSTI GVSMSA  GY K++PPK+
Sbjct  107  MYAWYFPKGRQYASQYRSGHRHFWSYAIVWTDSDKPDNSTIQGVSMSAGVGYGKATPPKS  166

Query  61   KH-VDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+ VDG +VK D Y+S       +R T   GETQDLITW+QL   A+ AL + D+D   W
Sbjct  167  KYVVDGVTVKFDSYFSFWGSKVGIRTTTKTGETQDLITWEQLTDEARTALTDADFDVD-W  225

Query  120  NMCDVKMPLKDGEFTKNL  137
            +   V MPL D  FT+ L
Sbjct  226  SYKKVVMPLLDDVFTEKL  243

>PITG_04208
Length=245

 Score = 139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 91/142 (64%), Gaps = 6/142 (4%)

Query  1    MYAWYFPKGRKITGGAGL-GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPK  59
            MYAWYFPKGR      GL GHRH WEY +VW D P   NS+I GVSMSA  G++K++PP 
Sbjct  107  MYAWYFPKGRY-----GLTGHRHYWEYVVVWTDTPTSTNSSIQGVSMSAGVGHAKATPPM  161

Query  60   AKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
             K++ GSS+KLD Y+S +    AL+ T++ GE QDLITWDQ+ V A+  LN+   D  +W
Sbjct  162  LKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQDLITWDQMTVSARYTLNSDALDGNVW  221

Query  120  NMCDVKMPLKDGEFTKNLAETL  141
                 ++P KD  F K LA   
Sbjct  222  LTNIDEVPFKDTIFLKRLANAF  243

>PHYSO_526071
Length=249

 Score = 139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 89/140 (64%), Gaps = 2/140 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+       GHRH W YAIVW D+   DNSTI GVSMSA  G+ K++PPK+
Sbjct  107  MYAWYFPKGRQYVSKYRKGHRHFWSYAIVWTDSDKPDNSTIQGVSMSAGVGFRKATPPKS  166

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+V DG +VK D Y+S       +R T   GE+QDLITW+QL   A+  L N D+D   W
Sbjct  167  KYVIDGVTVKFDSYFSFWGSKVGIRTTTKTGESQDLITWEQLTDEARTGLTNADFDVD-W  225

Query  120  NMCDVKMPLKDGEFTKNLAE  139
            +   V MPL D +FT  L +
Sbjct  226  SYRKVVMPLSDEDFTDKLKK  245

>PYIR_13252
Length=236

 Score = 137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 85/139 (61%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   +TG   LGHRH+WE+ +VWIDNP   N  IL VS SA  GYSK +PPKA
Sbjct  105  MYSWYFPKDSPLTG---LGHRHDWEHVVVWIDNPNAANPKILAVSPSAHSGYSKYAPPKA  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+DY   V+  N AL  T D GE Q LI WDQL   A+ AL NT       N
Sbjct  162  GTVDGTSAKVDYTSKVVI-NHALDSTTDAGEQQPLIMWDQLTAAARSALENT-------N  213

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+KDG F   LA 
Sbjct  214  FGDANVPMKDGNFMNKLAN  232

>PITG_22053
Length=245

 Score = 137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 6/138 (4%)

Query  1    MYAWYFPKGRKITGGAGL-GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPK  59
            MYAWYFPKGR      GL GHRH WEY +VW D P   NS+I GVSMSA  G++K++PP 
Sbjct  107  MYAWYFPKGRY-----GLTGHRHYWEYVVVWTDTPTSTNSSIQGVSMSAGVGHAKATPPM  161

Query  60   AKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
             K++ GSS+KLD Y+S +    AL+ T++ GE QDLITWDQ+ V A+  LN+   D  +W
Sbjct  162  LKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQDLITWDQMTVSARYTLNSDALDGNVW  221

Query  120  NMCDVKMPLKDGEFTKNL  137
                 ++P KD  F K L
Sbjct  222  LTNIDEVPFKDTIFLKRL  239

>PYIR_13251
Length=236

 Score = 137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 85/137 (62%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ +VWIDNPA+ N TIL V+ SA  GY K +PPKA
Sbjct  105  MYSWYFPKDSPFTG---LGHRHDWEHVVVWIDNPAVANPTILAVTPSAHSGYEKYAPPKA  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+DY   V+  N AL  T D GE Q LI WDQL   A+ AL NT       N
Sbjct  162  GTVDGTSAKVDYTSKVVI-NHALDSTTDAGEKQPLIMWDQLTAAARSALENT-------N  213

Query  121  MCDVKMPLKDGEFTKNL  137
              D  +P+KDG F   L
Sbjct  214  FGDANVPMKDGNFMTKL  230

>PITG_19938
Length=245

 Score = 137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 93/142 (65%), Gaps = 6/142 (4%)

Query  1    MYAWYFPKGRKITGGAGL-GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPK  59
            MYAWYFPKGR      GL GHRH WEY +VW D+    +S+I GVSMSA  G++K++PP 
Sbjct  107  MYAWYFPKGRY-----GLTGHRHYWEYVVVWADSSTSTSSSIQGVSMSAGVGHAKATPPM  161

Query  60   AKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
             K++ GSSVKLD Y+S +    AL+ T++ GETQDLITWDQ+ V A+D LN+   D  +W
Sbjct  162  LKYIHGSSVKLDSYFSFLGSKAALQLTKETGETQDLITWDQMTVAARDTLNSDTLDGNVW  221

Query  120  NMCDVKMPLKDGEFTKNLAETL  141
                 ++P KD  F K L +  
Sbjct  222  LTNKDEVPFKDTIFLKRLEDAF  243

>PYU1_G001737
Length=133

 Score = 132 bits (333),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 64/113 (57%), Positives = 77/113 (68%), Gaps = 3/113 (3%)

Query  136  NLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFK  195
            NL +TL  A   S TT+HI+GWR C  F KA +V +AMQ+LYPD + F  H F DRDAF+
Sbjct  24   NLQDTLVRAG--SGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFR  81

Query  196  QWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVA  248
             WL  SKD F  HFGA S A+TH +SPFVW SN  +FVGGCD LLA  R  ++
Sbjct  82   AWLDVSKDDFATHFGATSPALTHTSSPFVW-SNAGEFVGGCDALLATIRGSIS  133

>PYU1_G014259
Length=244

 Score = 136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 130/233 (56%), Gaps = 20/233 (9%)

Query  276  VTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGL  334
            ++ T ++  +++  YDY  +VIG GSGG+A S+ AAS+   +V V++  +         L
Sbjct  21   ISSTRSLSSQQQDEYDY--LVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------L  69

Query  335  GGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGE--GKGATFDWKQLVSNVDSY  392
            GGTCVNVGC+PKK+M+ ++ +   +H D+ ++G+    G+  G+  +F W +L    D+Y
Sbjct  70   GGTCVNVGCVPKKIMYLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAY  129

Query  393  IKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQL  452
            +  +N  Y+  L +  V       +F     +E+       K++  +++++AVGG+P   
Sbjct  130  VLRLNGIYERNLANSKVDLLQGTAAFNAQGNVEV-----DGKEVKAKNILIAVGGKPLIP  184

Query  453  TCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR  505
              PG E+ I SD  F + +  P K  VVGA Y+A+E AG L G+G D  +  R
Sbjct  185  DIPGKEHCIDSDGFFEL-EVLPKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>PHYRA_74310
Length=249

 Score = 136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 91/140 (65%), Gaps = 2/140 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+ T     GHRH W Y IVW D+ + DNSTILGVSMSA  G+ K++PPK+
Sbjct  107  MYAWYFPKGRQYTSKYRAGHRHYWSYGIVWTDSSSPDNSTILGVSMSAGVGFGKATPPKS  166

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+V DG++VK D ++S       ++ T   G TQ LITW+Q+   A+ AL + D+D   W
Sbjct  167  KYVIDGTTVKFDSFWSFWGSKLGVKLTTKEGATQALITWEQMTEEARTALTDADFDVD-W  225

Query  120  NMCDVKMPLKDGEFTKNLAE  139
            +   V MP+ D  FTK L +
Sbjct  226  SFRKVVMPMSDDVFTKKLKK  245

>PHYRA_52440
Length=243

 Score = 135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 92/139 (66%), Gaps = 4/139 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR        GHR+ WEYAIVW D+ + DNST+LGVSMSA  G+ K++PP  
Sbjct  107  MYAWYFPKGRY----GVTGHRNYWEYAIVWTDSTSPDNSTLLGVSMSAGVGHDKTTPPML  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K+++GSSVKL+ ++S++    AL  T+  GE QDLITWDQL V A++ LN+   D  +W 
Sbjct  163  KYMNGSSVKLNSHFSLLGSKAALELTKKEGEFQDLITWDQLTVAARETLNSDALDGNVWL  222

Query  121  MCDVKMPLKDGEFTKNLAE  139
                ++P KD  F   L +
Sbjct  223  SNKDEVPFKDDIFVDRLED  241

>PHYSO_526832
Length=249

 Score = 135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 87/140 (62%), Gaps = 0/140 (0%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKG +  G     HRH W Y ++WIDNP  +N  ILGV +  + G  + +PP A
Sbjct  107  MYAWYFPKGFEQRGKINYSHRHLWLYLVLWIDNPENENPAILGVWLRTAGGNERRTPPDA  166

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K +DGSS+K+DYY S   G T ++ TE+ GE QDLITW+Q+   A+ AL   D+D     
Sbjct  167  KFLDGSSLKVDYYKSSWHGKTGIQLTENPGEFQDLITWEQMTEEARIALTEADFDGHWQE  226

Query  121  MCDVKMPLKDGEFTKNLAET  140
              D+ +P  DGEFT NL + 
Sbjct  227  RKDLDVPFIDGEFTVNLKKA  246

>SPRG_19943
Length=343

 Score = 137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 135/258 (52%), Gaps = 18/258 (7%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YD +V+G GSGG++ +  A ++G KV V++           GLGGTCVNVGC+PKK+M  
Sbjct  21   YDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTCVNVGCVPKKIMFN  77

Query  352  SSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKY  411
            ++L  E +H   A + +        GA FDW  + +  D+Y+K +N  Y   +    V  
Sbjct  78   AALHAEMLHSARA-YAFKGVQDIQFGA-FDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  135

Query  412  ENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKK  471
                  F+D HT+E+   R      T +H+++AVGG P     PG E+AISSD  F + +
Sbjct  136  VMGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-E  189

Query  472  TAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYME-----  525
            T P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   ME     
Sbjct  190  TQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEMEHAGKE  249

Query  526  -VQAGIEFIRKTVPESIT  542
             VQ  ++ +   V E++ 
Sbjct  250  KVQTAMKLVCIGVEETVV  267

 Score = 40.4 bits (93),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (2%)

Query  704  VKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTL  763
            +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  255  MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  313

>PITG_04267
Length=279

 Score = 135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 92/141 (65%), Gaps = 2/141 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKG +       GHRH W YAI+W D+P  DNSTILGVSMS S GY K S PKA
Sbjct  137  MYAWYFPKGPQFVLRFDTGHRHFWSYAILWTDDPNHDNSTILGVSMSGSRGYVKESSPKA  196

Query  61   KH-VDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+ V G++VKLD Y S   G  AL+ T+ +GETQDLITW+QL   A DAL   D+++   
Sbjct  197  KYIVKGTTVKLDSYASFWMGVQALQLTKKLGETQDLITWEQLTDEACDALTEFDFESDP-  255

Query  120  NMCDVKMPLKDGEFTKNLAET  140
            +   V MPL D  FT  L ++
Sbjct  256  SRAMVVMPLGDDNFTPILKDS  276

>PHYRA_74343
Length=249

 Score = 134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 90/140 (64%), Gaps = 2/140 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+ T     GHRH W Y IVW D+ + DNSTILGVSMSA  G+ K++PPK+
Sbjct  107  MYAWYFPKGRQYTSAYRTGHRHYWSYGIVWTDSSSPDNSTILGVSMSAGVGFGKATPPKS  166

Query  61   KH-VDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+ VDG++VK D + S       ++ T   GE QDLITW+Q+   A+ AL + D+D   W
Sbjct  167  KYVVDGTTVKFDSFRSFWGSKMGVKLTTKEGEMQDLITWEQMTEEARTALTDADFDVD-W  225

Query  120  NMCDVKMPLKDGEFTKNLAE  139
            ++  V MP+ D  F   L +
Sbjct  226  SVRKVVMPMSDDVFMTKLKK  245

>HYAP_12621
Length=501

 Score = 140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 129/480 (27%), Positives = 211/480 (44%), Gaps = 36/480 (8%)

Query  291  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  350
            DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  351  QSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVK  410
             S+ +  T  H+  ++G +  +      T ++ Q++   +  ++++    +       V 
Sbjct  86   HSTHLLHTAQHEFKSYGIDAPN-----VTANFPQMMKAKEKAVRTLTAGIESLFSKNKVT  140

Query  411  YENFLGSFLDPHTLEL-WHPRKGTKQITTRHVVVAVGGR----PKQLTCPGAEYAISSDD  465
            Y   +G       + +    R+G   +T +++++A G      P       A   + S  
Sbjct  141  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  200

Query  466  IFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYM  524
               + +  P   +VVGA  + LE     K +G  V V+        G D+    +  + +
Sbjct  201  ALALTRV-PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKLL  259

Query  525  EVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEET---FDTVLNATGRDPDVAKL  581
            + Q G+EF   T    +T  E    +V  TTE     + +    DTVL ATGR    A L
Sbjct  260  KKQ-GLEFQFGT---KVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAGL  315

Query  582  GLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNS  640
            GL++ G++  +K GRI   +  QT  P +FAIGDVI    L   A + G      +    
Sbjct  316  GLEQMGIQ-TDKQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGKH  374

Query  641  TVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsse  700
               ++Y  +   ++T  E+   G +EE+      E NV  +     P+  +      +  
Sbjct  375  G-HVNYGAIPNVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PMMANSRARTVAEA  428

Query  701  sCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
               VKV+ D   DK  +G H +  NAGE+     + ++ G   + +  T   HPT +EAF
Sbjct  429  DGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  487

>PYU1_G011237
Length=235

 Score = 132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 85/139 (61%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ +VWIDNPA  N TIL VS SA  GY K +PPKA
Sbjct  104  MYSWYFPKDSPFTG---LGHRHDWEHVVVWIDNPANANPTILAVSPSAHSGYEKYAPPKA  160

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+DY  +++  N AL  T   GE Q LI W+Q+   A+ AL NTD       
Sbjct  161  GTVDGTSAKVDYSSTIVI-NHALDSTTTAGEKQPLIMWEQMTQAARTALENTD-------  212

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+KDG F   LA 
Sbjct  213  FGDANVPMKDGNFMTKLAN  231

>PYVX_22467
Length=236

 Score = 131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 85/139 (61%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ +VWI NPA+D+ T+  VS SA  GYS   PP +
Sbjct  105  MYSWYFPKDSPSTG---LGHRHDWEHVVVWISNPAVDSPTVYAVSTSAHSGYSIYYPPSS  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K+D Y+ ++  N A R T   GETQDLI WDQ+   A+ AL NTD       
Sbjct  162  SYMDGNSAKID-YFKIVVINHAFRMTSSAGETQDLIMWDQMTDAARIALENTD-------  213

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P KDG F   LA 
Sbjct  214  FGDANVPFKDGNFMTKLAS  232

>PHYKE_7568
Length=372

 Score = 134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 87/138 (63%), Gaps = 11/138 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   +TG    GHRH+WE+ +VW++NPA+ +  IL VS SA  GY+   PP +
Sbjct  1    MYSWYFPKDSPLTG---FGHRHDWEHIVVWLNNPAITSPEILAVSTSAHSGYTVYYPPDS  57

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K+D YYSV+  N A R T D GETQDLI WDQL   AQ AL +TD+      
Sbjct  58   DYLDGNSAKID-YYSVLLINHAFRMTSDAGETQDLIMWDQLTDAAQTALEDTDF------  110

Query  121  MCDVKMPLKDGEFTKNLA  138
              D  +P KD  F   LA
Sbjct  111  -GDANVPFKDANFETKLA  127

 Score = 108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 78/137 (57%), Gaps = 10/137 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK   +    GLGHRH+WE  +VW+D+  LD   I+ +S SA  GY+   PP +
Sbjct  240  MYSWYMPKDETL---PGLGHRHDWEACVVWLDDITLDEPNIVALSASAHSGYNVYYPPSS  296

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG S K++Y  S I  + +L  T   GETQDLI WDQL   A+ AL +TD+ +    
Sbjct  297  SYLDGDSAKIEYSSSYIVIDHSLSATSTAGETQDLIMWDQLTDAARAALEDTDFGS----  352

Query  121  MCDVKMPLKDGEFTKNL  137
                 +P K+  F   L
Sbjct  353  ---ANVPFKEANFQTKL  366

>PHYCA_11951
Length=234

 Score = 129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 85/139 (61%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK       +G GHRH+WE+ +VW+DNPA+ +  IL VS SA  GY+   PP +
Sbjct  103  MYSWYFPKDSP---SSGFGHRHDWEHIVVWLDNPAVASPKILAVSTSAHSGYTVYYPPNS  159

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             +++G S K+D YYS++  N A R T D GETQ+LI WDQ+   A+ AL NTD       
Sbjct  160  NYLNGKSAKID-YYSILLINHAFRMTSDAGETQNLIMWDQMTDAARTALQNTD-------  211

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P KDG F   LA 
Sbjct  212  FGDANVPFKDGNFESKLAN  230

>PHYCA_118674
Length=281

 Score = 130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 88/140 (63%), Gaps = 3/140 (2%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKG +       GHRH W YAIVW  +P  +NST+LGVSMS+S GY K +PPK+
Sbjct  140  MYAWYFPKGNEFQANFDSGHRHYWSYAIVWTGSPNPENSTVLGVSMSSS-GYGKKAPPKS  198

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+V DG++VK D Y S      A+R T+  GE QDLITW+QL   A+ AL+  D+     
Sbjct  199  KYVIDGTTVKFDSYVSFWASKQAIRLTKKEGEAQDLITWEQLTQEARTALSEADFKAES-  257

Query  120  NMCDVKMPLKDGEFTKNLAE  139
                V MPLKD  F+  L +
Sbjct  258  TFSKVVMPLKDDVFSSILKK  277

>PYU1_G011231
Length=238

 Score = 129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 84/139 (60%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ +VWIDNPA  N TIL VS SA  GY K +PPKA
Sbjct  107  MYSWYFPKDSPFTG---LGHRHDWEHVVVWIDNPANANPTILAVSPSAHSGYEKYAPPKA  163

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+DY   ++  N AL  T   GE Q LI W+Q+   A+ AL NT        
Sbjct  164  GTVDGTSAKVDYTSKIVI-NHALDSTTAAGEKQPLIMWEQMTQAARTALENT-------G  215

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+KDG F   LA+
Sbjct  216  FGDANVPMKDGNFMDKLAK  234

>PHYSO_507736
Length=236

 Score = 129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 85/139 (61%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK       +G GHRH+WE+ +VW++NPA+ +  +L VS SA  GY+   PP +
Sbjct  105  MYSWYFPKDSP---ASGFGHRHDWEHIVVWLNNPAVTSPELLAVSTSAHSGYTTYYPPSS  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K+D YY+V+  N A R T D GETQDLI WDQL   A+ AL NTD       
Sbjct  162  SYLDGNSAKID-YYNVLLINHAFRMTSDSGETQDLIMWDQLTDAARTALENTD-------  213

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P KD  F   LA 
Sbjct  214  FGDANVPFKDANFETKLAN  232

>PITG_04248
Length=245

 Score = 129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 89/139 (64%), Gaps = 4/139 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWY PKGR          RH WE A+VWID+PAL NSTILGVS++    +   +P + 
Sbjct  107  MYAWYLPKGRNTK----YQRRHFWEAAVVWIDDPALANSTILGVSLNYGRRHKSKAPLER  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            ++++GS+VKL+ Y    +    LR+T+  GETQ LITW+QL   A+DAL+N  ++T L+ 
Sbjct  163  RYLEGSNVKLESYKGYGKPRPRLRFTQLKGETQHLITWEQLTKEARDALSNAKFNTGLFK  222

Query  121  MCDVKMPLKDGEFTKNLAE  139
                +MPLKDG F K L +
Sbjct  223  RTKREMPLKDGVFEKRLKD  241

>PHYSO_249751
Length=238

 Score = 128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 87/139 (63%), Gaps = 10/139 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   +TG   LGHRH+WE+ IVWIDNPA  N+TIL ++ SA  GYS  +PP A
Sbjct  105  MYSWYFPKDNPVTG---LGHRHDWEHVIVWIDNPASSNATILAMTPSAHSGYSTYAPPPA  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+SVK++Y  S +  N  L  T   GETQ+LI W+ +   A+ ALN TD+ +    
Sbjct  162  TMVDGTSVKVEYTSSKVVINHHLEGTSTAGETQNLIMWEDMTDAARYALNTTDFGS----  217

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P+KDG F   L +
Sbjct  218  ---ANVPMKDGNFISKLGK  233

>PPTG_07661
Length=223

 Score = 127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 88/147 (60%), Gaps = 7/147 (5%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKG         GHRH W  AIVW DN   DNSTILGVSMS S GY K   PK 
Sbjct  73   MYAWYFPKGAFRASKYNRGHRHFWSSAIVWTDNTNPDNSTILGVSMSGSKGYVKKPSPKT  132

Query  61   KHVD-GSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+++ G+++KLD Y      N ALR T+  G TQDL+TW+QL   A+DAL+  D+D    
Sbjct  133  KYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDEARDALSKFDFDADTS  192

Query  120  NM------CDVKMPLKDGEFTKNLAET  140
            +         V MPL+DG FT  L E+
Sbjct  193  DAIFFSSGATVVMPLEDGVFTSILEES  219

>PHYKE_7566
Length=260

 Score = 129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 84/137 (61%), Gaps = 10/137 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   ITG   LGHRH+WE+ IVW+D+  L N +I+ VS SA  GY+   PPK+
Sbjct  128  MYSWYFPKDSPITG---LGHRHDWEHVIVWVDDITLTNPSIVAVSPSAHSGYNIYYPPKS  184

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG S K+DY  S +  N AL  T D GETQDLI WDQL   A+ AL NTD+      
Sbjct  185  GTIDGYSAKVDYSSSYLVVNHALDSTSDAGETQDLIMWDQLTDAARTALENTDFG-----  239

Query  121  MCDVKMPLKDGEFTKNL  137
              D  +P+KD  F   L
Sbjct  240  --DANVPMKDANFQAKL  254

>PHYCA_118551
Length=245

 Score = 128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 90/139 (65%), Gaps = 4/139 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PKGR     A    RH WE A+VWID+P+L NSTILGVS++  + +   +P ++
Sbjct  107  MYSWYLPKGRP----AKYQRRHLWETAVVWIDDPSLANSTILGVSLNYGWRHKTMAPIES  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            + +D S VKL+ Y         LR+T  VGETQDLITW+QL V A++AL+N ++D+ L  
Sbjct  163  EFLDDSRVKLESYRGFSYPRPKLRFTTHVGETQDLITWEQLTVEAREALSNAEFDSGLIK  222

Query  121  MCDVKMPLKDGEFTKNLAE  139
                +MPLKDG F K L +
Sbjct  223  TTRREMPLKDGVFEKRLKD  241

>PYIR_13275
Length=237

 Score = 127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 83/139 (60%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ +VWIDNP   +  IL +S SA  GY K +PPK 
Sbjct  106  MYSWYFPKDSPFTG---LGHRHDWEHVVVWIDNPDAASPVILAISPSAHSGYEKYAPPKT  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+D Y S++  N AL  T   GE Q LI WDQL   A+ AL NTD+      
Sbjct  163  DTVDGNSAKVD-YKSIVVINHALDSTTTAGEQQPLIMWDQLTAAARTALENTDFG-----  216

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+KDG F   +A 
Sbjct  217  --DANVPMKDGNFMTKIAN  233

>PYU1_G011230
Length=238

 Score = 128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 84/139 (60%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   ITG   LGHRH+WE+ +VWIDNP   N  IL +S SA  GY K +PPKA
Sbjct  107  MYSWYFPKDSPITG---LGHRHDWEHVVVWIDNPKAANPKILAISPSAHSGYQKYAPPKA  163

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+DY   ++  N AL  T   GE Q LI W+Q+   A+ AL NT +      
Sbjct  164  GTVDGTSAKVDYTSKIVI-NHALDSTTAAGEKQPLIMWEQMTQAARTALENTGFG-----  217

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+KDG F   LA+
Sbjct  218  --DANVPMKDGNFMDKLAK  234

>PHYRA_72438
Length=236

 Score = 127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK       +G GHRH+WE+ +VW++NPA+ +  IL VS SA  GY+   PP +
Sbjct  105  MYSWYFPKDSP---ASGFGHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPPDS  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K+D YYSV+  N A R T D GETQDLI WDQL   A+ AL +TD       
Sbjct  162  DYLDGNSAKID-YYSVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTD-------  213

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P KD  F   LA 
Sbjct  214  FGDANVPFKDTNFETKLAN  232

>PPTG_17245
Length=257

 Score = 128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 88/147 (60%), Gaps = 7/147 (5%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKG         GHRH W  AIVW DN   DNSTILGVSMS S GY K   PK 
Sbjct  107  MYAWYFPKGAFRASKYNRGHRHFWSSAIVWTDNTNPDNSTILGVSMSGSKGYVKKPSPKT  166

Query  61   KHVD-GSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+++ G+++KLD Y      N ALR T+  G TQDL+TW+QL   A+DAL+  D+D    
Sbjct  167  KYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDEARDALSKFDFDADTS  226

Query  120  NM------CDVKMPLKDGEFTKNLAET  140
            +         V MPL+DG FT  L E+
Sbjct  227  DAIFFSSGATVVMPLEDGVFTSILEES  253

>PPTG_15233
Length=235

 Score = 127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 85/139 (61%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK       +G GHRH+WE+ +VW++NPA+ +  IL VS SA  GY+   PP +
Sbjct  104  MYSWYFPKDSP---ASGFGHRHDWEHIVVWLNNPAVTSPEILAVSTSAHSGYTVYYPPSS  160

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K+D YYSV+  N + R T D GETQDLI WDQL   A+ AL +TD       
Sbjct  161  DYLDGNSAKID-YYSVLLINHSFRMTSDSGETQDLIMWDQLTDAARTALEDTD-------  212

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P KD  F   LA 
Sbjct  213  FGDANVPFKDANFETKLAN  231

>PYU1_G011235
Length=238

 Score = 127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 84/139 (60%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   ITG   LGHRH+WE+ +VWIDNP   N  IL +S SA  GY K +PPKA
Sbjct  107  MYSWYFPKDSPITG---LGHRHDWEHVVVWIDNPKAANPKILAISPSAHSGYQKYAPPKA  163

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+DY   ++  N AL  T   GE Q LI W+Q+   A+ AL NTD+      
Sbjct  164  GTVDGTSAKVDYTSKIVI-NHALDSTTAAGEKQPLIMWEQMTDAARSALENTDFG-----  217

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P+KDG F   LA+
Sbjct  218  --KANVPMKDGNFMNKLAK  234

>PPTG_15231
Length=258

 Score = 127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 10/133 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   +TG   LGHRH+WE+ +VW+D+  LD+ +I+ VS SA  GY+   PP++
Sbjct  126  MYSWYFPKDSPVTG---LGHRHDWEHVVVWVDDIKLDSPSIIAVSPSAHSGYNIYYPPES  182

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG S K+DY  S +  N AL  T D GETQDLI WDQL   A+ AL NTD+      
Sbjct  183  NTIDGYSAKVDYSSSWVVINHALDSTTDAGETQDLIMWDQLTDAARTALENTDF------  236

Query  121  MCDVKMPLKDGEF  133
              D  +P+KDG F
Sbjct  237  -GDANVPMKDGNF  248

>PHYRA_71308
Length=236

 Score = 127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 84/139 (60%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK       +G GHRH+WE+ +VW++NPA+ +  IL VS SA  GY+   PP  
Sbjct  105  MYSWYFPKDSP---ASGFGHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPPDL  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K+D YYSV+  N A R T D GETQDLI WDQL   A+ AL +TD       
Sbjct  162  DYLDGNSAKID-YYSVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTD-------  213

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P KD  F   LA 
Sbjct  214  FGDANVPFKDTNFETKLAN  232

>PHYRA_72385
Length=237

 Score = 127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 86/139 (62%), Gaps = 10/139 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   +TG   LGHRH+WE+ +VW+D+  LD+ +I+ VS SA  GY+   PP++
Sbjct  105  MYSWYFPKDSPVTG---LGHRHDWEHVVVWVDDITLDSPSIIAVSPSAHSGYNIYYPPES  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG S K+DY  S +  N AL  T D GE+QDLI WDQL   A+ AL NTD+      
Sbjct  162  NTIDGYSAKVDYSSSWVVVNHALDSTSDSGESQDLIMWDQLTDAARTALENTDF------  215

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+KDG F   L  
Sbjct  216  -GDANVPMKDGNFLTKLGN  233

>PPTG_19506
Length=223

 Score = 126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 88/147 (60%), Gaps = 7/147 (5%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKG         GHRH W  AIVW DN   DNSTILGVSMS S GY K   PK 
Sbjct  73   MYAWYFPKGAFRASKYNRGHRHFWSSAIVWTDNTNPDNSTILGVSMSGSKGYVKKPSPKT  132

Query  61   KHVD-GSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+++ G+++KLD Y      N ALR T+  G TQDL+TW+QL   A+DAL+  D+D    
Sbjct  133  KYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDEARDALSKFDFDADTS  192

Query  120  NM------CDVKMPLKDGEFTKNLAET  140
            +         V +PL+DG FT  L E+
Sbjct  193  DAIFFSSGATVVIPLEDGVFTSILEES  219

>PPTG_07660
Length=216

 Score = 124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 90/141 (64%), Gaps = 2/141 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWY PK  +       GHRH W Y++VW D+P  DNSTILGVSMS S GY K   PK 
Sbjct  73   MYAWYLPKAAQFMLKFDTGHRHFWLYSMVWTDSPNPDNSTILGVSMSGSRGYVKKPSPKT  132

Query  61   KHVD-GSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K+++ G+++KL+ Y     G  ALR T+  GETQDL+TW+QL   A+DAL+  D+++   
Sbjct  133  KYIEKGTTIKLESYVGFWMGVQALRLTKKSGETQDLVTWEQLTDEARDALSEFDFESDP-  191

Query  120  NMCDVKMPLKDGEFTKNLAET  140
            ++  V MPLKD  F   L ++
Sbjct  192  SISMVVMPLKDDVFRSILKDS  212

>PHYRA_74306
Length=245

 Score = 124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 87/139 (63%), Gaps = 4/139 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WY PKGR          RH WE A+VWID+PAL NSTILGVSM+  +   + +P K 
Sbjct  107  MYTWYLPKGRSTRHQ----RRHFWETAVVWIDDPALANSTILGVSMNYGWRSKEQTPVKV  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K++DGSSVKL+ Y +       L++T++ G+ QDLITW+QL   A+DAL+  D+DT L  
Sbjct  163  KYLDGSSVKLESYRAYGFPKPRLQFTQEDGQFQDLITWEQLTEEARDALSTADFDTYLIE  222

Query  121  MCDVKMPLKDGEFTKNLAE  139
                +MPLKD  F   L +
Sbjct  223  QKKREMPLKDDIFEYRLKD  241

>PHYKE_5753
Length=238

 Score = 124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 82/137 (60%), Gaps = 10/137 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   +TG   +GHRH+WE+ +VWIDNPA++N TIL V+ SA  GYS  +PP  
Sbjct  105  MYSWYFPKDNPVTG---MGHRHDWEHVVVWIDNPAMENPTILAVTPSAHSGYSTYAPPDP  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+ Y  S I  N  L  T   GE QDLI W  L   A++ALN  D++     
Sbjct  162  STVDGASAKVQYTSSWIVINHHLDTTSTAGEFQDLIMWGDLTDAARNALNTADFEA----  217

Query  121  MCDVKMPLKDGEFTKNL  137
                 +P+KDG F   L
Sbjct  218  ---ANVPMKDGNFESKL  231

>PPTG_17049
Length=255

 Score = 124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 90/144 (63%), Gaps = 7/144 (5%)

Query  2    YAWYFPKGRKITGGAGL--GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPK  59
            YAWY PKG +   G  +  GHRH W Y  VWI+NPA++N+ ILGVSMS   G+   +P  
Sbjct  109  YAWYLPKGYERFSGLSMVEGHRHFWGYVTVWINNPAVENAYILGVSMSGQLGHDTQAPVD  168

Query  60   AKHVDGSSVKLDYYYSVI---RGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116
             K VDGS++KL++   V+   +G   LR  E VG+ QDLITWDQL   A+D+LN  ++D+
Sbjct  169  KKCVDGSTLKLEFDGHVMDGAKGKQGLRCVEAVGKFQDLITWDQLTEAARDSLNTYNFDS  228

Query  117  TLWNMCDVKMPLKDGEFTKNLAET  140
               +M  V  PLKDG FT  L  T
Sbjct  229  IGRDMGTV--PLKDGVFTNLLNST  250

>PHYRA_71310
Length=237

 Score = 123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 85/139 (61%), Gaps = 10/139 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   +TG   LGHRH+WE+ +VW+D+  LD+ +I+ VS SA  GY+   PP++
Sbjct  105  MYSWYFPKDSPVTG---LGHRHDWEHVVVWVDDITLDSPSIIAVSPSAHSGYNIYYPPES  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG S K+DY  S +  N AL  T D GE+QDLI W QL   A+ AL NTD+      
Sbjct  162  NTIDGYSAKVDYSSSWVVVNHALDSTSDSGESQDLIMWGQLTDAARTALGNTDF------  215

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+KDG F   L  
Sbjct  216  -GDAHVPMKDGNFLTKLGN  233

>PYVX_21248
Length=502

 Score = 129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 116/437 (27%), Positives = 199/437 (46%), Gaps = 28/437 (6%)

Query  334  LGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYI  393
            LGGTC+NVGCIP K +  S+ +  +  HD A +G  V     +G   +   ++   +  +
Sbjct  70   LGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEV-----EGVKANLGGMMKAKEKAV  124

Query  394  KSINFKYKVELRSKYVKYENFLGSFLDPHTLEL-WHPRKGTKQITTRHVVVAVGGRPKQL  452
             ++    +   +   V Y    G  +  + + +  +  KG + +T +++++A G  P  L
Sbjct  125  TTLTGGIESLFKKNKVTYIKGHGKIVGKNEVAVALNDDKGNQTVTAKNIMIATGSEPAPL  184

Query  453  ---TCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILL  509
                   +++ I            P   +VVGA  + LE     K +G   KV V   L 
Sbjct  185  PPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KVTVVEFLD  242

Query  510  R---GFDQDMANKIGEYMEVQAGIEFIRKT-VPESITKLENGQLLVKWTTEDDESCEETF  565
            R   G D +++ +  + ++ Q G+EF   T V  S  K +N  L V+ +     +  E  
Sbjct  243  RACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVEPSAGGSAASIEC-  300

Query  566  DTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPV  624
            DTVL ATGR P    LGL++ G++  +K GR+   +  +T  PNI+A GDVI    L   
Sbjct  301  DTVLVATGRRPFTEGLGLEQMGIQ-TDKQGRVEVDSHFRTQIPNIYAFGDVIKGAMLAHK  359

Query  625  AIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEED-SNERFGEDNVEVYHK  683
            A + G      + +     ++YD +   ++T  E    G +EE+  NE         Y+ 
Sbjct  360  AEEEG-VACAEIISGKHGHVNYDAIPGVIYTTPEVASVGKTEEELKNEGV------TYNV  412

Query  684  NFVPLewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTY  743
               P+  +      +    +VK++ D   D+ ++G H +  NAGE+     L ++ G + 
Sbjct  413  GKFPMMANSRARTIAEADGFVKILADKATDR-ILGVHIIAGNAGEMVAEGVLGLEYGASS  471

Query  744  DQMVDTVGIHPTTAEAF  760
            + +  T   HPT +EAF
Sbjct  472  EDIARTCHAHPTLSEAF  488

>PHYRA_74356
Length=244

 Score = 122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 85/139 (61%), Gaps = 5/139 (4%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWY PKG           RH WE A+VWID+PAL NSTILGVSM+        +P +A
Sbjct  107  MYAWYLPKG-----NYKYQRRHYWETAVVWIDDPALSNSTILGVSMNYGRRSEFETPVQA  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            + +DGSSVKLD Y         L++T++ GE QDLITW+QL   A+DAL+  D+D  L+ 
Sbjct  162  RFLDGSSVKLDSYRGYGYPKPRLQFTQEEGEFQDLITWEQLTEEARDALSTADFDGPLFK  221

Query  121  MCDVKMPLKDGEFTKNLAE  139
                KMPLKDG F   L +
Sbjct  222  KKKRKMPLKDGIFEFRLKD  240

>PYIW_25259
Length=246

 Score = 122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 84/139 (60%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ +VWIDNPA  N  IL V+ SA  GY K +PPK+
Sbjct  115  MYSWYFPKDSPFTG---LGHRHDWEHVVVWIDNPANANPAILAVTPSAHSGYKKYAPPKS  171

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K++ Y ++I  N AL  T   GE Q LI WDQL   A+  L NTD+ +    
Sbjct  172  GTVDGNSAKVE-YKAIIVINHALDSTTTGGEQQPLIMWDQLTDAARSGLENTDFGS----  226

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P+KDG F   +A 
Sbjct  227  ---ANVPMKDGNFMTKVAN  242

>PITG_16866
Length=238

 Score = 122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 10/133 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   +TG   LGHRH+WE+ +VW+D+  L++ +++ VS SA  GY+   PP++
Sbjct  106  MYSWYFPKDSPLTG---LGHRHDWEHVVVWVDDIKLNSPSVIAVSPSAHSGYNIYHPPES  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG S K+DY  S +  N AL  T D GETQ+LI WDQL   A+ AL NTD+      
Sbjct  163  NTIDGYSTKVDYSSSWLVINHALDSTTDAGETQNLIMWDQLTDAARTALENTDF------  216

Query  121  MCDVKMPLKDGEF  133
              D  +P+KDG F
Sbjct  217  -GDANVPMKDGNF  228

>PHYCA_122048
Length=236

 Score = 122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 82/139 (59%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ +VWIDNP + N TIL  S SA  GYS  +PP +
Sbjct  105  MYSWYFPKDSPSTG---LGHRHDWEHVVVWIDNPDVANPTILATSPSAHSGYSFYAPPSS  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+SVK++ Y S    N AL  T   GETQDLI WDQL   A+ ALN TD       
Sbjct  162  DSVDGTSVKVN-YESNWPINHALDMTSKSGETQDLIMWDQLSEAARYALNTTD-------  213

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P+ DG F   L +
Sbjct  214  FGKANVPMNDGNFVAKLGK  232

>PHYRA_72386
Length=245

 Score = 121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 81/137 (59%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP + N  IL VS SA  GYSK +PP A
Sbjct  114  MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPDVPNPIILAVSPSAHSGYSKYAPPGA  170

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S K+ Y  S    N AL  T D GE QDLI W+Q+  +A+ ALN         N
Sbjct  171  DILDGTSAKIRYESSYPM-NHALDATTDAGEFQDLIMWEQMSDLARQALNTM-------N  222

Query  121  MCDVKMPLKDGEFTKNL  137
              D  +P+ DG F   L
Sbjct  223  FGDANVPMNDGNFVGKL  239

>PHYRA_72344
Length=245

 Score = 121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 81/137 (59%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP + N  IL VS SA  GYSK +PP A
Sbjct  114  MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPDVPNPIILAVSPSAHSGYSKYAPPGA  170

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S K+ Y  S    N AL  T D GE QDLI W+Q+  +A+ ALN         N
Sbjct  171  DILDGTSAKIRYESSYPM-NHALDATTDAGEFQDLIMWEQMSDLARQALNTM-------N  222

Query  121  MCDVKMPLKDGEFTKNL  137
              D  +P+ DG F   L
Sbjct  223  FGDANVPMNDGNFVGKL  239

>PHYSO_249691
Length=225

 Score = 120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 83/139 (60%), Gaps = 10/139 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   I+G   LGHRH+WE+ +VW+D+  L + +I+ VS SA  GY+   PP++
Sbjct  93   MYSWYFPKDSPISG---LGHRHDWEHVVVWVDDITLASPSIIAVSPSAHNGYNIYYPPES  149

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG S K+DY  S +  N AL  T D GETQDLI WDQL   A+ AL NTD       
Sbjct  150  GTIDGYSAKVDYSSSWLVVNHALDSTSDAGETQDLIMWDQLTDTARTALENTD-------  202

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+KD  F   L  
Sbjct  203  FGDANVPMKDANFQMKLGN  221

>PHYKE_9680
Length=498

 Score = 127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 136/499 (27%), Positives = 223/499 (45%), Gaps = 39/499 (8%)

Query  275  TVTETPAVPMEEET---SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTS  331
            +V    A PM   T   S +YD+VVIGGG GG   + +AA  G K   ++        + 
Sbjct  12   SVAMRSAAPMTARTFSSSSEYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SR  63

Query  332  WGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDS  391
              LGGTC+NVGCIP K +  S+ +  T  HD  ++G +       G   ++ Q++   + 
Sbjct  64   GKLGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAP-----GVKANFPQMMKAKEK  118

Query  392  YIKSINFKYKVELRSKYVKYENFLGSFLDPHTLEL-WHPRKGTKQITTRHVVVAVGGR--  448
             +K++    ++  +   V Y    G       + +     KG + +  +++++A G    
Sbjct  119  AVKTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVT  178

Query  449  --PKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVM-VR  505
              P       A   I S     +K+  P   +VVGA  + LE     K +G  V V+  +
Sbjct  179  PLPPVPVDNEAGKIIDSTGALVLKRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQ  237

Query  506  SILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEET-  564
                 G D++   +  + ++ Q G++F   T    +T  E    +VK TTE  +  +E  
Sbjct  238  DAACPGMDKECVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEAS  293

Query  565  --FDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPEL  621
               DTVL ATGR    A LGL++ G++  +K GR+   +  +T  P IFAIGDVI    L
Sbjct  294  IECDTVLVATGRRAYTAGLGLEQMGIQ-TDKLGRVEVDDAFRTQVPGIFAIGDVIKGAML  352

Query  622  TPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVY  681
               A + G      +       ++Y  +   ++T  E+   G +EE+      E NV  +
Sbjct  353  AHKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF  411

Query  682  HKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  741
                 P+  +      +     VKV+ D   DK  +G H +  NAGE+     +A++ G 
Sbjct  412  -----PMMANSRARTVAEADGLVKVLSDKKTDKM-LGVHIIASNAGEMIAEGVIALEYGA  465

Query  742  TYDQMVDTVGIHPTTAEAF  760
            + + +  T   HPT +EA 
Sbjct  466  SSEDIARTCHAHPTLSEAL  484

>PHYRA_76249
Length=326

 Score = 123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 82/139 (59%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP ++N  IL V+ SA  GYSK  PP A
Sbjct  195  MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPDVENPKILAVTPSAHSGYSKQVPPNA  251

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+SVK++ Y S    N AL  T   G+ QDLI WDQL   A+ ALN+  W      
Sbjct  252  DSVDGTSVKVE-YKSKWPINHALESTSQGGDFQDLIMWDQLSENARRALNSVPWG-----  305

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D   P+ DG F   L +
Sbjct  306  --DANTPMNDGNFQNKLGK  322

>PHYRA_42876
Length=213

 Score = 120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 80/137 (58%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP ++N  IL V+ SA  GYSK  PP A
Sbjct  84   MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPDVENPKILAVTPSAHSGYSKQVPPNA  140

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K++ Y S    N AL  T   G+ QDLI WDQL   A+ ALN+  W      
Sbjct  141  DSVDGTSAKVE-YKSKWPINHALESTSQGGDFQDLIMWDQLSENARRALNSVPW------  193

Query  121  MCDVKMPLKDGEFTKNL  137
              D   P+ DG F   L
Sbjct  194  -GDANTPMNDGNFLPKL  209

>PITG_04200
Length=247

 Score = 120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 87/138 (63%), Gaps = 5/138 (4%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWY PKGR     +    RH WE A+VWID+PAL NSTILGVS++         P + 
Sbjct  107  MYAWYLPKGR----SSKYQRRHFWEAAVVWIDDPALANSTILGVSLNYGRRQKSEVPLEL  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL-W  119
            + +DGS+VKL+ Y    R    L++T+  GETQDLITW+QL   A+D L++ +++T L +
Sbjct  163  QFLDGSNVKLESYRGFGRPRPRLQFTQLEGETQDLITWEQLTDEARDGLSDAEFNTGLFF  222

Query  120  NMCDVKMPLKDGEFTKNL  137
                 +MPLKDG F K L
Sbjct  223  KRTRREMPLKDGVFEKRL  240

>PHYSO_527352
Length=245

 Score = 120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 85/140 (61%), Gaps = 5/140 (4%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            +YAWYFPKGR        GHRH W YAI+W D+P  D STILGVS+   F   KS+ P A
Sbjct  109  VYAWYFPKGRDFEHSFKRGHRHYWLYAILWTDSPNPDTSTILGVSVPNGF-RDKSAAPDA  167

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            + V DG ++K D Y S   G   L  TE  G+TQDLITW+QL   A+ AL+N ++D    
Sbjct  168  QFVIDGKTIKFDSYRSFTTGRQDLGLTEKTGDTQDLITWEQLTEEARTALSNMNFDGP--  225

Query  120  NMCDVKMPLKDGEFTKNLAE  139
                + +P+KDG+F + LA 
Sbjct  226  -RQKIVVPMKDGDFAERLAR  244

>PHALS_09942
Length=496

 Score = 125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 138/487 (28%), Positives = 213/487 (44%), Gaps = 44/487 (9%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            +S +YD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  26   SSSEYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
             +  S+ +  T  H+  N+G +         T ++ Q++   D  +K++    +   +  
Sbjct  78   ALLHSTHLLHTAQHEFKNYGIDAPE-----VTANFPQMMKAKDKAVKTLTSGIESLFKKN  132

Query  408  YVKYENFLGSFLDPHTLEL-WHPRKGTKQITTRHVVVAVGGR----PKQLTCPGAEYAIS  462
             V Y    G       + +  H  KG + +  +++++A G      P       A   + 
Sbjct  133  KVTYIKGSGKISAQGEVSVALHDHKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIVD  192

Query  463  SDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSIL---LRGFDQDMANK  519
            S     +K+  P   +VVGA  + LE     K +G   KV V   L     G D+     
Sbjct  193  STGALELKRI-PDHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDDACTGMDKGSVKD  249

Query  520  IGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTE-----DDESCEETFDTVLNATGR  574
              + ++ Q G+EF   T    +T  E    +VK TTE     D  S E   DTVL ATGR
Sbjct  250  FIKLLKKQ-GLEFKFGT---KVTASEINGDVVKLTTEPSQGGDAASIE--CDTVLVATGR  303

Query  575  DPDVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLS  633
                A LGL++ G++  +K GRI      +T  P IFAIGDVI    L   A + G    
Sbjct  304  RAFTAGLGLEQMGIQ-TDKFGRIEVDEAFRTQVPGIFAIGDVIKGAMLAHKAEEEG-IAC  361

Query  634  RRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewsls  693
              +       ++Y  +   ++T  E+   G +EE+      E NV  +     P+  +  
Sbjct  362  AEIIAGKHGHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMANSR  416

Query  694  esrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  753
                      VKV+ D   DK  +G H +  NAGE+     + ++ G   + +  T   H
Sbjct  417  ARTVGESDGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDVARTSHAH  475

Query  754  PTTAEAF  760
            PT +EAF
Sbjct  476  PTLSEAF  482

>PHYCA_129784
Length=246

 Score = 120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 81/137 (59%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWI NP + N TIL V+ SA  GYSK +PP A
Sbjct  115  MYSWYFPKDSPSTG---LGHRHDWEHVIVWISNPDVPNPTILAVTPSAHSGYSKYAPPSA  171

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S+K+  Y S    N A   T + GE QDLI WDQ+   A++ALN         +
Sbjct  172  DTVDGTSIKV-RYESTYPMNHATDVTTEAGEFQDLIMWDQMTDAARNALNTV-------S  223

Query  121  MCDVKMPLKDGEFTKNL  137
              D  +P+ DG F   L
Sbjct  224  FGDANVPMNDGNFVPKL  240

>PPTG_07671
Length=246

 Score = 120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 83/140 (59%), Gaps = 4/140 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWY PKGR          RH WE A+VWID+PAL NSTILGVS++    ++   P + 
Sbjct  107  MYAWYLPKGRSTK----YQRRHYWEVAVVWIDDPALANSTILGVSLNYGRRHNSQVPVEE  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            +++ GS VKL+ +         LR+T+  GETQDLITW+QL   A+DAL+N  +   L  
Sbjct  163  QYLHGSRVKLESFKGFGVPRPRLRFTDLEGETQDLITWEQLTEEARDALSNAKFQRGLIK  222

Query  121  MCDVKMPLKDGEFTKNLAET  140
                 MPLKDG F K L + 
Sbjct  223  RLRGDMPLKDGVFEKRLEDA  242

>PHYCA_108039
Length=215

 Score = 119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 80/137 (58%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP ++N  IL V+ SA  GYSK  PP A
Sbjct  84   MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPDIENPKILAVTPSAHSGYSKQVPPSA  140

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+SVK+  Y S    N AL  T + GETQDLI W+QL   A  A+N+  W      
Sbjct  141  DCVDGTSVKVK-YESKWPINHALESTTEGGETQDLIMWNQLSENALRAMNSVTWG-----  194

Query  121  MCDVKMPLKDGEFTKNL  137
              D   P  DG F   L
Sbjct  195  --DANCPFCDGNFQAKL  209

>PITG_10839
Length=134

 Score = 116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 82/144 (57%), Gaps = 11/144 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  +GLGHRH+WE+ IVWIDNP +++  IL V+ SA  GYSK  PPK+
Sbjct  1    MYSWYFPKD---SPSSGLGHRHDWEHVIVWIDNPGIESPKILAVTPSAHDGYSKQVPPKS  57

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+SVK++ Y S    N AL  T   G+ QDLI WDQL   A+ A+N   W      
Sbjct  58   DCVDGTSVKVN-YESTWPVNHALESTSKGGDFQDLIMWDQLSENARRAMNGVGWGK----  112

Query  121  MCDVKMPLKDGEFTKNLAETLATA  144
                  P  DG F   L +    A
Sbjct  113  ---ANTPFNDGNFKSKLKKAWPFA  133

>SPRG_09825
Length=492

 Score = 125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 133/491 (27%), Positives = 214/491 (44%), Gaps = 52/491 (11%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            T  DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K
Sbjct  22   TGSDYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSK  73

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
             +  ++       HD  N G  V      G   D+ +L+++ D  +K +    +   +  
Sbjct  74   ALLSATHKYHAAQHDFKNVGIEV-----DGLRIDFAKLMASKDKSVKILTGGIEGLFKKN  128

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGR----PKQLTCPGAEYAISS  463
             V Y    G  +  + + +     G K ++T+++++A G      P       A   I S
Sbjct  129  KVDYIKGFGKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDS  188

Query  464  DDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEY  523
                 +K+  P   +V+G   + LE       +G  + V+           + A+KI   
Sbjct  189  TGALSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPT  236

Query  524  MEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDD------------ESCEETFDTVLNA  571
            M+ + G EF +K + +     + GQ +     E D            E+     DTVL A
Sbjct  237  MDFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVA  295

Query  572  TGRDPDVAKLGLDKAGVKLNEKTGRIWT--KNEQTSTPNIFAIGDVIDAPELTPVAIQAG  629
            TGR P    LGL++ G++  +K GRI     N +T+  NIFAIGD I+   L   A + G
Sbjct  296  TGRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEG  354

Query  630  RFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLe  689
                  +       ++Y+ +   V+T  E    G +EE+        NV  Y+    P+ 
Sbjct  355  ISCVESIAGGHG-HVNYNAIPGVVYTFPEVASVGKTEEE----LKAANV-AYNVGKFPMM  408

Query  690  wslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  749
             +           +VK++     DK ++G H +  NAGE+     L ++ G + + +  T
Sbjct  409  ANSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRT  467

Query  750  VGIHPTTAEAF  760
               HPT +EAF
Sbjct  468  CHAHPTLSEAF  478

>PHYSO_329843
Length=239

 Score = 118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 84/141 (60%), Gaps = 15/141 (11%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ +VWIDNP ++N TIL  S SA  GYS   PP A
Sbjct  108  MYSWYFPKDSPSTG---LGHRHDWEHVVVWIDNPDVENPTILSTSPSAHSGYSYYVPPSA  164

Query  61   KHVDGSSVKLDY--YYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL  118
              +DG+SVK++Y  ++ +   N AL  T + GE QDLI WDQL   A+ ALN T      
Sbjct  165  DSIDGTSVKVNYESHWPI---NHALDMTSESGEFQDLIMWDQLSDAARLALNTT------  215

Query  119  WNMCDVKMPLKDGEFTKNLAE  139
             +     +P+ DG F   L +
Sbjct  216  -SFGSANVPMNDGNFLTKLGK  235

>PHYSO_556052
Length=500

 Score = 124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 131/480 (27%), Positives = 214/480 (45%), Gaps = 36/480 (8%)

Query  291  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  350
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  33   DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  84

Query  351  QSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVK  410
             S+ +  T  HD  ++G +           ++ Q++   +  +K++    +   +   V 
Sbjct  85   HSTHLLHTAQHDFKSYGIDAPE-----VKANFPQMMKAKEKAVKTLTGGIESLFKKNKVT  139

Query  411  YENFLGSFLDPHTLEL-WHPRKGTKQITTRHVVVAVGGR----PKQLTCPGAEYAISSDD  465
            Y    G       + +  +  KG + +  +++++A G      P       A   I S  
Sbjct  140  YIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKIIDSTG  199

Query  466  IFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYM  524
               +K+  P   +VVGA  + LE     K +G  V V+  +     G D++   +  + +
Sbjct  200  ALSLKRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKLL  258

Query  525  EVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETF---DTVLNATGRDPDVAKL  581
            + Q G+EF   T    +T  E    +VK TTE  +  + +    DTVL ATGR    A L
Sbjct  259  KKQ-GLEFQFGT---KVTASEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGL  314

Query  582  GLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNS  640
            GL++ G++  +K GRI   +  +T  P IFAIGDVI    L   A + G      +    
Sbjct  315  GLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENIAGKH  373

Query  641  TVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtsse  700
               ++Y  +   ++T  E+   G +EE+      E NV  +     P+  +      +  
Sbjct  374  G-HVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMANSRARTVAES  427

Query  701  sCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
               VKV+ D   DK  +G H +  NAGE+     + ++ G   + +  T   HPT +EAF
Sbjct  428  DGLVKVLADKKTDKL-LGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  486

>PHYRA_72215
Length=499

 Score = 124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 132/482 (27%), Positives = 216/482 (45%), Gaps = 36/482 (7%)

Query  289  SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  348
            S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  30   SSDYDVVVIGGGPGGYVAAIKAAQLGFKTACVE--------SRGKLGGTCLNVGCIPSKA  81

Query  349  MHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408
            +  S+ +  T  HD  ++G +       G T ++ Q++   +  + ++    +   +   
Sbjct  82   LLHSTHLLHTAQHDFKSYGIDA-----PGVTANFPQMMKAKEKAVTTLTGGIESLFKKNK  136

Query  409  VKYENFLGSFLDPHTLEL-WHPRKGTKQITTRHVVVAVGGR----PKQLTCPGAEYAISS  463
            V Y    G       + +  +  KG + +  +++++A G      P       A   I S
Sbjct  137  VTYIKGYGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDS  196

Query  464  DDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGE  522
                 + +  P   +VVGA  + LE     K +G  V V+  +     G D++   +  +
Sbjct  197  TGALALTRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKEAVKEFTK  255

Query  523  YMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETF---DTVLNATGRDPDVA  579
             ++ Q G++F   T    +T  E    +VK TTE  +         DTVL ATGR    A
Sbjct  256  LLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGNAATIECDTVLVATGRRAFTA  311

Query  580  KLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYN  638
             LGL++ G++  +K GRI   +  +T  P IFAIGDVI    L   A + G      +  
Sbjct  312  GLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAG  370

Query  639  NSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrts  698
                 ++Y  +   ++T  E+   G +EE+      E NV  +     P+  +      +
Sbjct  371  KHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMANSRARTVA  424

Query  699  sesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  758
                 VKV+ D   DK ++G H +  NAGE+     +A++ G + + +  T   HPT +E
Sbjct  425  EADGLVKVLADKKTDK-MLGVHIIASNAGEMISEGVIALEYGASSEDIARTCHAHPTLSE  483

Query  759  AF  760
            AF
Sbjct  484  AF  485

>PYU1_G011236
Length=237

 Score = 118 bits (295),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 80/139 (58%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    T    LGHRH+WE+ +VWIDNP   +  IL VS SA  GY+K  PP  
Sbjct  106  MYSWYFPKDSPSTL---LGHRHDWEHVVVWIDNPDAASPKILAVSASAHSGYNKYHPPAT  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              + G+S K+D Y S++  N A   T   GETQ LI WDQ+ V A+ AL  TD+      
Sbjct  163  TTLAGNSAKID-YKSIVVLNHAFDMTTAAGETQPLIMWDQMTVAARTALETTDFG-----  216

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+KDG F   LA 
Sbjct  217  --DANVPMKDGNFMTKLAN  233

>PITG_15359
Length=496

 Score = 123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 133/485 (27%), Positives = 216/485 (45%), Gaps = 40/485 (8%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  26   SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
             +  S+ +  T  HD  ++G +           ++ Q++ + +  +K++    +   +  
Sbjct  78   ALLHSTHLLHTAQHDFKSYGIDAPE-----VKANFPQMMKSKEKAVKTLTGGIESLFKKN  132

Query  408  YVKYENFLGSFLDPHTLEL-WHPRKGTKQITTRHVVVAVGGR----PKQLTCPGAEYAIS  462
             V Y    G       + +  +  KG + +  +++++A G      P       A   I 
Sbjct  133  KVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIID  192

Query  463  SDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIG  521
            S     +K+  P   +VVGA  + LE     K +G  V V+        G D++   +  
Sbjct  193  STGALELKRV-PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEFT  251

Query  522  EYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTE-----DDESCEETFDTVLNATGRDP  576
            + ++ Q G++F   T    +T  E    +VK TTE     D  S E   DTVL ATGR  
Sbjct  252  KLLKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIE--CDTVLVATGRRA  305

Query  577  DVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRR  635
              + LGL++ G++  +K GRI   +  +T  P IFAIGDVI    L   A + G      
Sbjct  306  FTSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVEN  364

Query  636  LYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslses  695
            +       ++Y  +   ++T  E+   G +EE+      E NV  +     P+  +    
Sbjct  365  IAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMANSRAR  418

Query  696  rtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPT  755
              +     VKV+ D   DK  +G H +  NAGE+     + ++ G   + +  T   HPT
Sbjct  419  TIAEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPT  477

Query  756  TAEAF  760
             +EAF
Sbjct  478  LSEAF  482

>SDRG_06945
Length=492

 Score = 122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 131/491 (27%), Positives = 213/491 (43%), Gaps = 52/491 (11%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            T  DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K
Sbjct  22   TGSDYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSK  73

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
             +  ++       HD  N G  V      G   D+ +L+++ D  +K +    +   +  
Sbjct  74   ALLSATHKYHAAQHDFKNVGIEV-----DGLRIDFAKLMASKDKSVKILTGGIEGLFKKN  128

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGR----PKQLTCPGAEYAISS  463
             + Y    G  +  + + +     G K ++T+++++A G      P       A   I S
Sbjct  129  KIDYIKGFGKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDS  188

Query  464  DDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEY  523
                 +K+  P   +V+G   + LE       +G  + V+           + A+KI   
Sbjct  189  TGALSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPT  236

Query  524  MEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDD------------ESCEETFDTVLNA  571
            M+ + G EF +K + +     + GQ +     E D            E+     DTVL A
Sbjct  237  MDFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVA  295

Query  572  TGRDPDVAKLGLDKAGVKLNEKTGRIWT--KNEQTSTPNIFAIGDVIDAPELTPVAIQAG  629
            TGR P    LGL++ G++  +K GRI     N +T+  NIFAIGD I+   L   A + G
Sbjct  296  TGRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEG  354

Query  630  RFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLe  689
                  +       ++Y+ +   V+T  E    G +EE+        NV  +     P+ 
Sbjct  355  ISCVESIAGGHG-HVNYNAIPGVVYTFPEVASVGKTEEELKAAGVAYNVGKF-----PMM  408

Query  690  wslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  749
             +           +VK++     DK ++G H +  NAGE+     L ++ G + + +  T
Sbjct  409  ANSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRT  467

Query  750  VGIHPTTAEAF  760
               HPT +EAF
Sbjct  468  CHAHPTLSEAF  478

>PHYRA_71477
Length=238

 Score = 117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 82/140 (59%), Gaps = 15/140 (11%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WYFPK    T    LGHRH+WE+ +VWIDNP + N  +L VS SA  GYSK  PP A
Sbjct  107  MYTWYFPKDSPSTR---LGHRHDWEHVVVWIDNPDVSNPILLAVSPSAHSGYSKYVPPSA  163

Query  61   KHVDGSSVKLDY--YYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL  118
              VDG+SVK++Y  ++ V   N AL  T   GE QDLI W Q+   A+ ALN TD+   +
Sbjct  164  DSVDGTSVKINYESHWPV---NHALDTTSKSGEFQDLIMWHQMSDAARLALNTTDFGKAI  220

Query  119  WNMCDVKMPLKDGEFTKNLA  138
                   MP+ DG F   LA
Sbjct  221  -------MPMNDGSFLGKLA  233

>PHYSO_254223
Length=227

 Score = 116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 84/138 (61%), Gaps = 4/138 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR        GHRH WE  +VW+DNP  DNST+LGV M A   + K  P   
Sbjct  82   MYAWYFPKGRACKDDFKTGHRHFWEDVVVWVDNPNPDNSTLLGVPMYAGHRHIKVVPVDE  141

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K++ DG +VK   Y S+  G   +  TED GE QDLITW+QL V A+ AL+  ++     
Sbjct  142  KYLKDGKTVKFGSYKSL--GAQVVGLTEDYGEIQDLITWEQLTVEARTALSEANFHVDG-  198

Query  120  NMCDVKMPLKDGEFTKNL  137
             + +V +P+KDG+F K L
Sbjct  199  GVREVVVPIKDGQFEKTL  216

>PYIW_24350
Length=190

 Score = 115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 83/139 (60%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    T    LGHRH+WE+ +VWIDNP   +  IL VS SA  GY+K +PPK+
Sbjct  59   MYSWYFPKDSPSTL---LGHRHDWEHVVVWIDNPNAVSPKILAVSPSAHSGYNKYAPPKS  115

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K++ Y S++  N AL  T   GE Q LI WDQL   A+  L NTD+ +    
Sbjct  116  GTVDGNSAKVE-YKSIVVINHALDSTTTGGEQQPLIMWDQLTDAARSGLENTDFGSA---  171

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P+KDG F   +A 
Sbjct  172  ----NVPMKDGNFMTKVAN  186

>PPTG_13736
Length=236

 Score = 115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 84/141 (60%), Gaps = 15/141 (11%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP + N  IL V+ SA  GYSK +PPKA
Sbjct  105  MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPDVANPKILAVTPSAHSGYSKYAPPKA  161

Query  61   KHVDGSSVKLDY--YYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL  118
              V G++ K++Y  ++ V   N AL  T+  GETQ LI WDQ+   A+ +LN        
Sbjct  162  GTVSGNTAKINYESHWPV---NHALDSTDKGGETQPLIMWDQMTDAARRSLNTV------  212

Query  119  WNMCDVKMPLKDGEFTKNLAE  139
             +  D  +P+ DG F + +  
Sbjct  213  -SFGDANVPMNDGNFLRKIGN  232

>PHYCA_107869
Length=342

 Score = 118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 80/137 (58%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  +GLGHRH+WE+ IVWIDNP ++N  IL V+ SA  GYSK  PPKA
Sbjct  211  MYSWYFPKD---SPSSGLGHRHDWEHVIVWIDNPDIENPKILAVTPSAHSGYSKQVPPKA  267

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+SVK+  Y S    N AL  T + G+ QDLI WDQL   A+ A+N   W      
Sbjct  268  DCVDGTSVKVK-YESKWPVNHALDSTSEGGDFQDLIMWDQLSENARRAMNGVGWG-----  321

Query  121  MCDVKMPLKDGEFTKNL  137
                  P  DG F   L
Sbjct  322  --KANTPFNDGNFLPKL  336

>PPTG_15230
Length=252

 Score = 116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 81/137 (59%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWI+NP + +  IL V+ SA  GYSK +PP A
Sbjct  121  MYSWYFPKDSPSTG---LGHRHDWEHVIVWINNPDVPDPIILAVTPSAHSGYSKYAPPNA  177

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+SVK++ Y S    N A   T D GE QDLI WDQ+   A+ ALN         +
Sbjct  178  DTLDGTSVKVN-YESTYPMNHATDVTTDPGEFQDLIMWDQMTDAARLALNTV-------S  229

Query  121  MCDVKMPLKDGEFTKNL  137
              D  +P+ DG F   L
Sbjct  230  FGDANVPMNDGNFIPKL  246

>PYAR_20075
Length=469

 Score = 120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 130/475 (27%), Positives = 205/475 (43%), Gaps = 54/475 (11%)

Query  291  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  350
            +YDLVV+GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  30   EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  81

Query  351  QSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVK  410
             S+ +  T  HD   +G  V+         D+  ++ + +  +K++    +   +   V 
Sbjct  82   HSTHLFHTAQHDFKKYGIEVSD-----VQMDFGGMMKSKEKAVKTLTAGIESLFKKNKVT  136

Query  411  YENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMK  470
            Y    G                 K +    V VA+          G E  + S     +K
Sbjct  137  YIKGFG-----------------KIVAANEVAVALNDN------NGNETIVDSTGALALK  173

Query  471  KTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS-ILLRGFDQDMANKIGEYMEVQAG  529
            K AP   +V+G   + LE     K +G  V V+  +  +  G D ++  +  + ++ Q G
Sbjct  174  K-APEHLVVIGGGVIGLELGSVYKRLGSKVTVVEYADRVCPGLDLELGKEFAKLLKKQ-G  231

Query  530  IEFIRKTVPESITKLENGQLLVKWTTEDDESCEET---FDTVLNATGRDPDVAKLGLDKA  586
            ++   KT    +T  +     V  T E     E T    DTVL ATGR P    LGL++ 
Sbjct  232  LDLQFKT---KVTASQVNGDKVTLTVEPAAGGEATTIEADTVLVATGRRPFTNGLGLEQM  288

Query  587  GVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMD  645
            G++  +K GRI      +T  P+I+AIGDVI  P L   A + G      +       ++
Sbjct  289  GIQ-TDKMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIAGLHG-HVN  346

Query  646  YDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVK  705
            Y+ +   ++T  E    G +EE   E     NV  +     P+  +           +VK
Sbjct  347  YNAIPGVIYTHPEVASVGKTEEQLKEEGIAYNVGKF-----PMMANSRARAVGEGDGFVK  401

Query  706  VICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
            V+ D T DK ++G H +  NAGE+     L ++ G   + +  T   HPT +EAF
Sbjct  402  VLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHPTLSEAF  455

>PHYSO_477165
Length=132

 Score = 111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 79/139 (57%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  +GLGHRH+WE+ IVWIDNP L+N  IL VS SA  GYSK +PP A
Sbjct  1    MYSWYFPKD---SPSSGLGHRHDWEHVIVWIDNPNLENPKILAVSPSAHSGYSKYAPPNA  57

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+ VK++ Y S    N A   T   G+ QDLI W Q+   A+ ALN+  W      
Sbjct  58   DTLDGTHVKVN-YESQWPVNHATDVTTKGGDFQDLIMWSQMSENARRALNSVGW------  110

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P  DG F   L +
Sbjct  111  -GKANTPFNDGNFEPKLGK  128

>PHYKE_2376
Length=322

 Score = 116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 82/139 (59%), Gaps = 15/139 (11%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ I+WIDNP ++N  IL V+ SA  GYS   PP A
Sbjct  191  MYSWYFPKDSPSTG---LGHRHDWEHVIIWIDNPDVENPRILAVTPSAHSGYSTYRPPNA  247

Query  61   KHVDGSSVKLDY--YYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL  118
              +DG+S K++Y  ++ V   N AL  T + G+ QDLI WDQ+   A+ ALN   W    
Sbjct  248  DTLDGTSAKVNYESHWPV---NHALDSTSEGGDFQDLIMWDQMTDNARRALNEVSW----  300

Query  119  WNMCDVKMPLKDGEFTKNL  137
                D  +P+ DG F   L
Sbjct  301  ---GDANVPMNDGNFGPKL  316

>PHYCA_6835
Length=210

 Score = 112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 80/139 (58%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WYFPK       +G+GHRH+WE+ IVWIDNPA++N  IL V+ SA  GY K +PP A
Sbjct  78   MYCWYFPKDEP---SSGIGHRHDWEHVIVWIDNPAVENPKILAVTPSAHSGYHKYAPPNA  134

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG + K+  Y S    + AL  T + G+ QDLI WDQL   A+ ALN+        N
Sbjct  135  DTIDGVTTKV-AYDSKWPMDHALDSTSEAGDFQDLIMWDQLSENARRALNSV-------N  186

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P+ DG F   LA+
Sbjct  187  FGKANTPMNDGNFQPKLAK  205

>PHYCA_123621
Length=495

 Score = 119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 131/485 (27%), Positives = 212/485 (44%), Gaps = 40/485 (8%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            ++ DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  25   STNDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  76

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
             +  S+ +  T  HD  ++G +           ++ Q++   +  + ++    +   +  
Sbjct  77   ALLHSTHLLHTAQHDFKSYGIDAPE-----VKANFPQMMKAKEKAVTTLTGGIESLFKKN  131

Query  408  YVKYENFLGSFLDPHTLEL-WHPRKGTKQITTRHVVVAVGGR----PKQLTCPGAEYAIS  462
             V Y    G       + +  +  KG + +  +++++A G      P       A   I 
Sbjct  132  KVTYIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIID  191

Query  463  SDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIG  521
            S     + +  P   +VVGA  + LE     K +G  V V+        G D+    +  
Sbjct  192  STGALSLTRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEFT  250

Query  522  EYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTE-----DDESCEETFDTVLNATGRDP  576
            + ++ Q G++F   T    +T  E    +VK TTE     D  S E   DTVL ATGR  
Sbjct  251  KLLKKQ-GLDFKFST---KVTASEVNGDVVKLTTEPSKGGDASSIE--CDTVLVATGRRA  304

Query  577  DVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRR  635
              A LGL++ G++  +K GRI   +  +T  P IFAIGDVI    L   A + G      
Sbjct  305  FTAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVEN  363

Query  636  LYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslses  695
            +       ++Y  +   ++T  E+   G +EE+      E NV  +     P+  +    
Sbjct  364  IAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PMMANSRAR  417

Query  696  rtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPT  755
              +     VKV+ D   DK  +G H +  NAGE+     + ++ G   + +  T   HPT
Sbjct  418  TVAEADGLVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPT  476

Query  756  TAEAF  760
             +EAF
Sbjct  477  LSEAF  481

>PPTG_19331
Length=368

 Score = 116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 81/139 (58%), Gaps = 15/139 (11%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  +GLGHRH+WE+ IVWIDNP ++N  IL V+ SA  GYSK  PP A
Sbjct  235  MYSWYFPKD---SPSSGLGHRHDWEHVIVWIDNPDVENPKILAVTPSAHDGYSKQVPPNA  291

Query  61   KHVDGSSVKLDY--YYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL  118
              VDG+SVK+ Y  ++ +   N AL  T + G+ QDLI WDQL   A+ A+N   W    
Sbjct  292  DCVDGTSVKVKYESHWPI---NHALESTSEGGDFQDLIMWDQLSEDARRAMNGVGW----  344

Query  119  WNMCDVKMPLKDGEFTKNL  137
                    P  DG F   L
Sbjct  345  ---GKANTPFNDGNFKPKL  360

>PHYSO_249692
Length=248

 Score = 113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 82/137 (60%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWI+NP + +  IL V+ SA  GYSK SPP A
Sbjct  117  MYSWYFPKDSPSTG---LGHRHDWEHVIVWINNPDVPDPIILAVTPSAHSGYSKYSPPNA  173

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S+K++ Y S    N A   T + G+ QDLI WDQ+  +A+ ALN         +
Sbjct  174  DTLDGTSIKVN-YESNYPMNHATDVTTEGGDFQDLIMWDQMSDLARRALNEV-------S  225

Query  121  MCDVKMPLKDGEFTKNL  137
              D  +P+ DG F   L
Sbjct  226  FGDANVPMNDGNFVGKL  242

>PHYKE_7564
Length=473

 Score = 118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 81/137 (59%), Gaps = 10/137 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK   ++G   +GHRH+WE+ IVWIDNP   N TIL ++ SA  GYS  +PP A
Sbjct  340  MYSWYFPKDSPVSG---MGHRHDWEHVIVWIDNPENVNGTILAMTPSAHSGYSTYAPPPA  396

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+SVK++Y  + +  N  L  T   GE QDLI W  +   A+ ALN TD       
Sbjct  397  DMVDGASVKVEYTSTYLVINHHLEGTSTAGEMQDLIMWGDMTDAARYALNTTD-------  449

Query  121  MCDVKMPLKDGEFTKNL  137
              +  +P+KDG F   L
Sbjct  450  FGNANVPMKDGNFLPKL  466

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 66/110 (60%), Gaps = 3/110 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK          GHRH+WE+ +VWIDNP   N  IL ++ SA  GYS  +PP A
Sbjct  105  MYSWYFPKDEPQDF---TGHRHDWEHVVVWIDNPQNVNPRILAMTPSAHSGYSTYAPPDA  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALN  110
              +DG+SVK++Y  S +  +  L  T   GE QDLI W  +   A+++LN
Sbjct  162  DMIDGTSVKVEYTSSWLFIDHHLEGTSTAGEMQDLIMWSDMTDAARNSLN  211

>PHYRA_71931
Length=239

 Score = 112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 86/147 (59%), Gaps = 15/147 (10%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ +VWI NP ++N  IL VS SA  GYS    P A
Sbjct  106  MYSWYFPKDSPSTG---LGHRHDWEHVVVWITNPDVENPVILAVSPSAHSGYSYYVSPSA  162

Query  61   KHVDGSSVKLDY--YYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL  118
              +DG++VK++Y  ++ +   N AL  T + G+TQDLI WDQ+   A+++LN        
Sbjct  163  DTIDGTAVKVNYESHWPI---NHALDITTEGGDTQDLIMWDQMTDAARNSLNTV------  213

Query  119  WNMCDVKMPLKDGEFTKNLAETLATAS  145
             +  D  +P+ DG F   L +    AS
Sbjct  214  -SFGDANVPMNDGNFQNKLGKAWPWAS  239

>PHYCA_9358
Length=252

 Score = 113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 79/137 (58%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP +    IL V+ SA  GYS   PP A
Sbjct  120  MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPEIAEPKILAVTPSAHSGYSAQVPPDA  176

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              V+G+SVK++ Y S    N AL  T   G+ QDLI W+QL   A+ AL NTD       
Sbjct  177  DKVEGTSVKVN-YESKWPINHALGSTTKGGDYQDLIMWEQLTDAARLALENTD-------  228

Query  121  MCDVKMPLKDGEFTKNL  137
                 +P+KDG F   L
Sbjct  229  FGKANVPMKDGNFVGKL  245

>PHYCA_123779
Length=277

 Score = 113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 79/139 (57%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP +    ILGV+ SA  GYS   PP A
Sbjct  142  MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPEVPEPKILGVTPSAHSGYSSQVPPDA  198

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDGSSVK+  Y S    N AL  T + G+ QDLI W Q+   A++ L+ T W      
Sbjct  199  DKVDGSSVKVK-YLSKWPINHALESTGEGGDFQDLIMWTQMTDAAREGLSKTGW------  251

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P+ DG F   L +
Sbjct  252  -GKANVPMVDGNFEAKLGK  269

>PHYRA_71404
Length=245

 Score = 112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 81/139 (58%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   +GHRH+WE+ IVWIDNP ++N  IL V+ SA  GY K +PP A
Sbjct  114  MYSWYFPKDEPSTG---IGHRHDWEHVIVWIDNPDVENPKILAVTPSAHSGYHKYAPPNA  170

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG++ K+  Y S    + AL  + + G+ QDLI WDQL   A+ ALN+        N
Sbjct  171  DSIDGTTTKV-AYESHWPMDHALDSSSEAGDFQDLIMWDQLSENARRALNSV-------N  222

Query  121  MCDVKMPLKDGEFTKNLAE  139
              +  +P+ DG F   L  
Sbjct  223  FGNANVPMNDGNFQAKLGR  241

>PHYRA_72433
Length=245

 Score = 112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 81/139 (58%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   +GHRH+WE+ IVWIDNP ++N  IL V+ SA  GY K +PP A
Sbjct  114  MYSWYFPKDEPSTG---IGHRHDWEHVIVWIDNPDVENPKILAVTPSAHSGYHKYAPPNA  170

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG++ K+  Y S    + AL  + + G+ QDLI WDQL   A+ ALN+        N
Sbjct  171  DSIDGTTTKV-AYESHWPMDHALDSSSEAGDFQDLIMWDQLSENARRALNSV-------N  222

Query  121  MCDVKMPLKDGEFTKNLAE  139
              +  +P+ DG F   L  
Sbjct  223  FGNANVPMNDGNFQAKLGR  241

>PHYKE_7565
Length=198

 Score = 110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 83/140 (59%), Gaps = 11/140 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            +Y+WYFPK    TG   L HRH+WE+ +VWIDNP + N  IL VS SA  GYSK +PP A
Sbjct  67   IYSWYFPKDSPSTG---LIHRHDWEHIVVWIDNPDVANPRILAVSPSAHSGYSKYAPPNA  123

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+SVK++Y  S    N AL  T   G+ QDLI WDQ+  + + ALN+T       +
Sbjct  124  NNLDGNSVKINYESSYPM-NHALGVTTKEGDFQDLIMWDQMSDLTRKALNDT-------S  175

Query  121  MCDVKMPLKDGEFTKNLAET  140
              D  +P+ D  F   L + 
Sbjct  176  FGDANVPMNDCNFLGKLQKA  195

>PPTG_08017
Length=616

 Score = 117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 78/137 (57%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP +    IL V+ SA  GYS   PP A
Sbjct  483  MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPEIAEPKILAVTPSAHSGYSAQVPPDA  539

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+SVK+  Y S    N AL  T + G+ QDLI W+QL   A+ AL NT        
Sbjct  540  NKVDGNSVKVK-YLSKWPINHALESTGEAGDYQDLIMWEQLTDAARLALQNT-------G  591

Query  121  MCDVKMPLKDGEFTKNL  137
                 +P+KDG F   L
Sbjct  592  FGKANVPMKDGNFVSKL  608

>PHYSO_254112
Length=224

 Score = 109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 77/137 (56%), Gaps = 22/137 (16%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKG +  G + + HRH W +A+VWIDNPALDNSTIL VS               
Sbjct  107  MYAWYFPKGWQ--GASTVSHRHLWLHAVVWIDNPALDNSTILAVS---------------  149

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
                 + VKLD           L+ T D GE+QDLITWDQ+   A+ AL+  ++D  L+ 
Sbjct  150  -----TPVKLDASRGFWASKMLLKLTTDKGESQDLITWDQMTEEARTALSEANFDKHLFK  204

Query  121  MCDVKMPLKDGEFTKNL  137
              + K+P KDG FT  L
Sbjct  205  RKNTKVPFKDGVFTDKL  221

>PYU1_G011233
Length=239

 Score = 110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 79/140 (56%), Gaps = 10/140 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK   I    G+GHRH+WE  +VWIDNP   N  IL VS SA  GY K +PPKA
Sbjct  107  MYSWYMPKDTPI---PGIGHRHDWENVVVWIDNPNAANPKILAVSPSAHSGYEKYAPPKA  163

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+ Y  + +  + +L  T   GE Q LI W+QL   A+  L + D+      
Sbjct  164  GTVDGTSAKVIYSTTNLVMDHSLDSTTHAGEQQPLIMWEQLTDAARSTLQDYDFG-----  218

Query  121  MCDVKMPLKDGEFTKNLAET  140
              +  +P+KDG F   L ++
Sbjct  219  --NANVPMKDGNFMDKLGKS  236

>PPTG_15224
Length=246

 Score = 110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 81/140 (58%), Gaps = 4/140 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWY PKG           RH WE A+VWID+P+  NS+ILGV++++     K  P + 
Sbjct  107  MYAWYLPKGWAYRSP----RRHFWETAVVWIDDPSPTNSSILGVTLNSGLRRKKYVPVER  162

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            ++VDGSSV+L+      R    LR+T   GE+QDLI W+QL   A+ AL N ++DT  + 
Sbjct  163  QYVDGSSVQLESCKGRGRPRPMLRFTTISGESQDLIMWEQLTDKARYALANAEFDTGFFK  222

Query  121  MCDVKMPLKDGEFTKNLAET  140
                 MPLKD  F K L + 
Sbjct  223  KKRRNMPLKDDRFEKGLEDA  242

>PPTG_17409
Length=235

 Score = 109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 82/139 (59%), Gaps = 15/139 (11%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK       + LGHRH+WE  ++WI+NP + N  IL +  SA  GYS+ +PP A
Sbjct  104  MYSWYFPKDSP---SSSLGHRHDWENVVIWINNPDVPNPVILAICPSAHGGYSRYAPPDA  160

Query  61   KHVDGSSVKLDY--YYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL  118
              +DG+S K++Y  ++ +   N A   T + G+ QDLI WDQL   A+ AL +TD     
Sbjct  161  DTIDGTSAKVNYESHWPI---NHATDTTSEGGDFQDLIMWDQLTDAARTALQDTD-----  212

Query  119  WNMCDVKMPLKDGEFTKNL  137
                D  +P+K+G F  NL
Sbjct  213  --FGDANVPMKEGSFLSNL  229

>PHYSO_406265
Length=232

 Score = 109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 78/139 (56%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  +GLGHRH+WE+ IVWIDNP +    IL V+ SA  GYS   PP A
Sbjct  101  MYSWYFPKD---SPSSGLGHRHDWEHVIVWIDNPDMPEPKILAVTPSAHSGYSAQVPPDA  157

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG SVK++ Y S    N AL  T   G+ QDLI W Q+   A+ AL+NT       N
Sbjct  158  DKVDGPSVKVN-YESKWPINHALESTTKGGDYQDLIMWTQMTDAARQALDNT-------N  209

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P+  G F   L +
Sbjct  210  FGSANVPMNSGNFLGKLGK  228

>PHYSO_259736
Length=231

 Score = 109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 73/118 (62%), Gaps = 0/118 (0%)

Query  20   HRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKAKHVDGSSVKLDYYYSVIRG  79
            HRH W Y ++WIDNP   N  ILGV +  + G  +  PP AK +DGSS+K++YY S   G
Sbjct  108  HRHLWLYLVLWIDNPEAANPAILGVWLRTAGGNEQRVPPDAKFIDGSSLKVEYYKSSWHG  167

Query  80   NTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWNMCDVKMPLKDGEFTKNL  137
             T ++ TE+ GE QDL+TW+Q+   A+ AL   ++D       D+ +P  DGEFT NL
Sbjct  168  KTGIQLTENPGEFQDLVTWEQMTEEARIALTEANFDGHWQERKDLDVPFIDGEFTVNL  225

>PPTG_22174
Length=771

 Score = 115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 88/134 (66%), Gaps = 2/134 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKG       G GHRH W +AIVW D+P  DNSTILG SM+ +    K+S  K+
Sbjct  628  MYAWYFPKGANPVSVFGSGHRHYWLHAIVWTDSPNPDNSTILGASMAGTTNNEKTSTVKS  687

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            K++ +G+S+KLD +  +  G  ALR T+  GETQDLITW+QL   A+DAL++  ++++  
Sbjct  688  KYLANGTSLKLDSFVGLWTGIQALRLTKKSGETQDLITWEQLTDEARDALSDFSFESSES  747

Query  120  NMCDVKMPLKDGEF  133
                V MPL+D  F
Sbjct  748  REW-VVMPLRDSAF  760

>PPTG_08005
Length=759

 Score = 114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 80/139 (58%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP +    IL V+ SA  GYS   PP A
Sbjct  627  MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPEIAEPKILAVTPSAHSGYSAQVPPDA  683

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+SVK+  Y S    N AL  T + G+ QDLI W Q+   A++AL+ T       +
Sbjct  684  NKVDGTSVKV-KYLSKWPINHALESTGEGGDYQDLIMWGQMTDAAREALSRT-------S  735

Query  121  MCDVKMPLKDGEFTKNLAE  139
              D  +P+ DG F   L +
Sbjct  736  FGDANVPMNDGNFEPKLGK  754

>PHYCA_118356
Length=252

 Score = 107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 80/140 (57%), Gaps = 5/140 (4%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WY PKGR       L  RH WE A++WID+P L++S +LGVS++           K 
Sbjct  107  MYTWYLPKGR----SGKLQDRHFWETAVIWIDDPTLEDSKLLGVSLNYEDRRVSKIAIKG  162

Query  61   KHVDGSSV-KLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            +H++ S V K + Y +       LR+TE  G+TQDLITWDQLP  A+  L+ T + ++ +
Sbjct  163  RHLNASKVLKFESYEAEKSPKPRLRFTEKAGKTQDLITWDQLPAKARKGLSTTKFYSSPF  222

Query  120  NMCDVKMPLKDGEFTKNLAE  139
                 +MPLKD  F K L +
Sbjct  223  GSVKREMPLKDEVFLKRLKD  242

>CCI50816
Length=807

 Score = 113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 125/487 (26%), Positives = 202/487 (41%), Gaps = 44/487 (9%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YDL+VIG G     C+ +AA  G+ V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  352  SSL-IGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVK  410
            + L +    HH     G+   S   K  T D   ++  V+  I+S     +V+ +S  V 
Sbjct  82   AVLHLSGYRHH-----GFYGKSYSMKNVTID--DILYRVNRVIQSEVDLLRVQFKSARVD  134

Query  411  YENFLGSFLDPHTLELWHP-----RKGTKQITTRHVVVAVGGRPKQ-LTCP-GAEYAISS  463
            Y +    F D H + +         K TK++     +VA G RP      P   +    S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  464  DDIF-WMKKTAPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKI  520
            D I  W  +  P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  521  GEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAK  580
               M    G  F+     ES+ K   G L+   + +         D +L   GR  +   
Sbjct  255  THEMR-NHGARFLLGETIESVDKSSRGVLVGLKSGKKVHG-----DALLYVVGRQANTDG  308

Query  581  LGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNS  640
            L L+ AG+  N +         QT  P+IFA+GD I AP L   +++ GR  S  ++N  
Sbjct  309  LNLEAAGLSRNPRGLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNED  368

Query  641  T-------VQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewsls  693
                     Q+        ++T  E    G +E+    +  + N E+    +  L     
Sbjct  369  ESNDDSIPSQLKTGNFPYGIYTIPEISMVGHTEKQLTSQ--QINYEIGVAKYSELAKGQM  426

Query  694  esrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  753
               ++     +K++ D    K + G H +G  A E+     +A+ +G T     D V  +
Sbjct  427  SGASADG--MLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNY  483

Query  754  PTTAEAF  760
            PT AEA+
Sbjct  484  PTLAEAY  490

>PHYKE_4438
Length=339

 Score = 108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 80/139 (58%), Gaps = 15/139 (11%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ I+WI+NP + +  IL V+ SA  GYS  +PP A
Sbjct  207  MYSWYFPKDSPSTG---LGHRHDWEHVIIWINNPEVADPKILAVTPSAHSGYSTYAPPPA  263

Query  61   KHVDGSSVKLDY--YYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL  118
              +DG + K++Y  ++ V   N AL  T   G+ QDLI WDQL   A+ ALN  +W    
Sbjct  264  DSMDGVAAKVNYESFWPV---NHALGMTTKGGDFQDLIMWDQLTDNARRALNEVNWGA--  318

Query  119  WNMCDVKMPLKDGEFTKNL  137
                   +P+ DG F   L
Sbjct  319  -----ANVPMNDGNFGGKL  332

>PHYRA_45462
Length=181

 Score = 103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 78/137 (57%), Gaps = 12/137 (9%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK   +    GLGHRH+WE  +VW+D  +LD+  I+ +S SA  GY+   PP +
Sbjct  51   MYSWYMPKDETL---PGLGHRHDWEACVVWLD--SLDDQNIVALSASAHSGYNVYYPPSS  105

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             + DG S K++Y  S +  + +L  T   GETQDLI WDQL   A+ AL +TD+ +    
Sbjct  106  SYFDGDSAKIEYSSSYVVIDHSLSATSTAGETQDLIMWDQLTDAARTALEDTDFGS----  161

Query  121  MCDVKMPLKDGEFTKNL  137
                 +P K+  F   L
Sbjct  162  ---ANVPFKEANFETKL  175

>PHYKE_4946
Length=263

 Score = 106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 80/140 (57%), Gaps = 11/140 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  + LGHRH+WE+ +VWIDNP +    IL VS S   G+ K +PP A
Sbjct  132  MYSWYFPKD---SPSSRLGHRHDWEHVVVWIDNPEVLEPKILAVSPSYHSGHKKYAPPSA  188

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+SVK+ Y +S    N AL  T+  G+ QDLI WDQ+  +A+ ALN T        
Sbjct  189  DVIDGTSVKVKYEHSWPL-NHALDVTDKAGDFQDLIMWDQMTDLARVALNET-------K  240

Query  121  MCDVKMPLKDGEFTKNLAET  140
                 +P+ D  F + L + 
Sbjct  241  FGKANVPMNDHNFLRKLEQA  260

>PYIW_24688
Length=259

 Score = 105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 91/288 (32%), Positives = 143/288 (50%), Gaps = 35/288 (12%)

Query  284  MEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGC  343
            M  +T YDY  + IGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCV+ GC
Sbjct  1    MSADTVYDY--ISIGGGSGGMASARRAATFGAKVLV---VERGRKYGGAGLGGTCVHYGC  55

Query  344  IPKKLMHQSSLIGETMHHDSANFGWNV-ASGEGKGATFDWKQLVSNVDSYIKSINFKYKV  402
            +PKK+M  ++   E ++  +A++      + + +   FDW  + +  D+YI  +N  Y+ 
Sbjct  56   VPKKIMFNAATHVEHLNR-AADYSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYER  114

Query  403  ELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAIS  462
             L +  V     +   +  + +E+          T +H++VAVGG+P             
Sbjct  115  NLGNAQVDLVEGVAKLVAKNQVEV-----DGVVYTGKHILVAVGGKP-------------  156

Query  463  SDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFD---QDMAN  518
              D F+  +  P K  VVGA Y+A+E AG    +  D  +  R   +LR FD   +D+ N
Sbjct  157  --DGFFKLEAQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLIN  214

Query  519  KIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFD  566
            + GE    +AGI F+R +  E I K  +G L +      +E     FD
Sbjct  215  EEGE----KAGINFVRNSRIERIEKQADGSLTITAKVNGEEQVLAGFD  258

>PPTG_19330
Length=316

 Score = 107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 76/139 (55%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WYFPK    TG   +GHRH+WE+ IVWIDNP + N  IL V+ SA  GY K +PP  
Sbjct  185  MYCWYFPKDEPSTG---IGHRHDWEHVIVWIDNPEIANPKILAVTPSAHSGYHKYAPPNP  241

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG++ K+  Y S    + AL  T + G+ QDLI W QL   A  ALN   W      
Sbjct  242  DTIDGATTKVA-YESHWPMDHALGSTSEAGDFQDLIMWGQLSENASRALNAVYWG-----  295

Query  121  MCDVKMPLKDGEFTKNLAE  139
              +   P+ DG F   LA+
Sbjct  296  --NANTPMNDGNFLPKLAK  312

>CCA16670
Length=520

 Score = 110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 124/489 (25%), Positives = 205/489 (42%), Gaps = 48/489 (10%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YDL+VIG G     C+ +AA  G+ V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  352  SSL-IGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKS-INFKYKVELRSKYV  409
            + L +    HH     G+   S   K  T D   ++  V+  I+S ++F  + + +S  +
Sbjct  82   AVLHLSGYRHH-----GFYGKSYSMKHVTID--DILYRVNRVIQSEVDF-LRTQFKSARI  133

Query  410  KYENFLGSFLDPHTLELWHP-----RKGTKQITTRHVVVAVGGRPKQ---LTCPGAEYAI  461
             Y +    F D H + +         K TK++     +VA G RP     +   G +   
Sbjct  134  DYISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDG-KVIF  192

Query  462  SSDDIF-WMKKTAPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMAN  518
             SD I  W  +  P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ +
Sbjct  193  DSDQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIIS  252

Query  519  KIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDV  578
             +   M    G  F+   + ES+ K   G   V    +  +      D +L   GR  + 
Sbjct  253  TLTHEMR-NHGARFLLGEIIESVEKSSRG---VSVGLKSGKKVHG--DALLYVVGRQANT  306

Query  579  AKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYN  638
              L L+ AG+  N +         QT  P+IFA+GD I AP L   +++ GR  S  ++N
Sbjct  307  DGLNLEAAGLSRNPRGLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWN  366

Query  639  NSTV-------QMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLews  691
             +         Q+        ++T  E    G +E++      + N E+    +  L   
Sbjct  367  ENEANDDSIPSQLTTGNFPYGIYTIPEISMVGKTEKELTSL--KMNYEIGVAKYSELAKG  424

Query  692  lsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  751
                 ++     +K++ D    K   G H +G  A E+     +A+ +G T     D V 
Sbjct  425  QMSGASADGM--LKILFDPISLKLY-GVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVF  481

Query  752  IHPTTAEAF  760
             +PT AEA+
Sbjct  482  NYPTLAEAY  490

>PITG_22668
Length=519

 Score = 110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 76/139 (55%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   LGHRH+WE+ IVWIDNP L    IL VS SA  GYS   PP A
Sbjct  387  MYSWYFPKDSPSTG---LGHRHDWEHVIVWIDNPELAEPKILAVSPSAHGGYSAQVPPDA  443

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              V+G+SVK+  Y S    N AL  T + G+ QDLI W Q+   A++ L+ T        
Sbjct  444  NKVEGTSVKVK-YLSKWPINHALESTGEGGDYQDLIMWGQMTDAAREGLSRT-------G  495

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P+ DG F   L  
Sbjct  496  FGKANVPMNDGNFESKLGR  514

>PITG_22916
Length=248

 Score = 104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 77/140 (55%), Gaps = 1/140 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKG+  +      HRH+WE+ I+W D  +  +S+I GV+ +         P + 
Sbjct  106  MYAWYFPKGKGHSRKHHDEHRHDWEFGIIWFDRDSDTDSSIAGVTTNIGRDLHDEVPLQP  165

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             HV GS +KL+ Y +       LR T+  G+ QDLI W+QLP  AQ ALN+ D+DT    
Sbjct  166  VHVVGSHIKLESYSTFWSAKQGLRLTKKKGDIQDLIQWEQLPKAAQTALNDADFDTDK-A  224

Query  121  MCDVKMPLKDGEFTKNLAET  140
               V +P  D  F + +A +
Sbjct  225  KTPVVVPFNDNYFQEKVAAS  244

>PITG_23094
Length=237

 Score = 104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 10/137 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFP+   ++    +GHRH+WE+AIVW+D      + +L V++    GY    PPKA
Sbjct  104  MYAWYFPREFMVSP-VWVGHRHDWEHAIVWLDGLG-TRAEVLAVTVQQLLGYKTYKPPKA  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            KH+DGSS K+ Y + +I+    L  T + GE QDLI W+ +   AQ+AL +T +    W+
Sbjct  162  KHMDGSSAKIKYTW-LIQTQHYLSATTEAGEFQDLIMWENMTAAAQEALEDTKF---FWS  217

Query  121  MCDVKMPLKDGEFTKNL  137
                  P+ +G+F  N+
Sbjct  218  WA----PINEGQFQDNI  230

>PPTG_18464
Length=247

 Score = 104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 82/142 (58%), Gaps = 4/142 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            +YAWY+PKG   T     G RH W Y +VW D+P  ++STI GV++    GY    PPK 
Sbjct  107  VYAWYYPKGPVFTETGPPGQRHFWSYIVVWTDSPKPNHSTIQGVTIPTEVGYEMQVPPKE  166

Query  61   KHV-DGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
              + + ++VK++ Y +    N A++ T++ GE QDLITW+QL   A+  L+  D++   W
Sbjct  167  DFIFEQATVKVESYLN--SENQAVQLTDESGEIQDLITWEQLTDQARATLSEFDFNIK-W  223

Query  120  NMCDVKMPLKDGEFTKNLAETL  141
               D+ MPLKD  F+  L E  
Sbjct  224  AYVDMVMPLKDDVFSTILEEAF  245

>PHYRA_72345
Length=240

 Score = 103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 76/145 (52%), Gaps = 10/145 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK          GHRH+WE+ +VWIDNP   N  IL ++ SA  GYS  +PP A
Sbjct  105  MYSWYFPKDEPQDF---TGHRHDWEHVVVWIDNPQNTNPKILAMTPSAHSGYSTYAPPDA  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K++Y  S +  +  L  T   GETQDLI W  +   A+ ALN T       N
Sbjct  162  DMVDGTSCKVEYTSSWLFIDHHLEGTSTAGETQDLIMWGDMTDAARYALNTT-------N  214

Query  121  MCDVKMPLKDGEFTKNLAETLATAS  145
                  P+ DG F   L +    A+
Sbjct  215  FGKANTPMNDGNFLPKLGKAYPWAT  239

>PHYRA_52423
Length=193

 Score = 102 bits (254),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 70/113 (62%), Gaps = 4/113 (4%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WY PKGR          RH WE A+VWID+PAL NSTILGVS++  +   + +P   
Sbjct  84   MYTWYLPKGRPTK----YQRRHFWETAVVWIDDPALANSTILGVSLNYGWRSKEETPVAP  139

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTD  113
            + +DGSSVKL+ Y         L++T+  GE QDLITW+QL   A+DAL+  D
Sbjct  140  RFLDGSSVKLNSYRGYGFPKPRLQFTQIDGEFQDLITWEQLTEEARDALSTAD  192

>PHYSO_414520
Length=213

 Score = 101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 79/137 (58%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  + +GHRH+WE+ +VWI+NP +    ILG+S SA  GY K S P  
Sbjct  84   MYSWYFPKD---SPSSRMGHRHDWEHVVVWINNPDVPEPKILGISASAHSGYKKYSSPPP  140

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            +++DG+SVK++Y ++    N AL  T+  G  QDLI W+Q+   A+ ALN         +
Sbjct  141  ENLDGNSVKVNYEHAWPI-NHALDTTDKAGTFQDLIMWEQMTEDARRALNAV-------H  192

Query  121  MCDVKMPLKDGEFTKNL  137
                  P+ DG F   L
Sbjct  193  FGKANTPMNDGNFRHKL  209

>PHYSO_254099
Length=235

 Score = 102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 66/114 (58%), Gaps = 0/114 (0%)

Query  24   WEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKAKHVDGSSVKLDYYYSVIRGNTAL  83
            W Y ++WIDNP   N  ILGV +    G  +  PP AK +DGSS+KLDYY       T L
Sbjct  116  WLYMVIWIDNPEAINPAILGVCVRTEGGNEQRVPPDAKFLDGSSLKLDYYKRTWHRKTGL  175

Query  84   RYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWNMCDVKMPLKDGEFTKNL  137
            + T+D GE QDL+TW+Q+   A+  L   D+D       D+ +P  DGEFT NL
Sbjct  176  QLTKDKGEFQDLVTWEQMTEEARITLTEADFDDHWQERNDLDVPFIDGEFTVNL  229

>PPTG_15220
Length=236

 Score = 102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 81/138 (59%), Gaps = 12/138 (9%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNST-ILGVSMSASFGYSKSSPPK  59
            MYAWYFP+   ++    +GHRH+WE+AIVW+D+  LD S  +L V+     GY    PP+
Sbjct  104  MYAWYFPRDYMVSP-MWVGHRHDWEHAIVWLDS--LDTSAELLAVTAQHLLGYKTYKPPR  160

Query  60   AKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLW  119
            AKH+DGSSVKL Y + +I+    L  T   G+ QDL  W  +   AQDAL +T +    W
Sbjct  161  AKHMDGSSVKLKYTW-LIQTQHYLSATTKAGKFQDLAMWSNMTDAAQDALGSTKF---FW  216

Query  120  NMCDVKMPLKDGEFTKNL  137
            +    + P+ D +F  N+
Sbjct  217  S----QAPMNDAKFQSNI  230

>PHYRA_75425
Length=237

 Score = 102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 77/143 (54%), Gaps = 10/143 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK   + G   +GHRH+WE  +VW+D+  LD   I+ +S S    Y    PP +
Sbjct  105  MYSWYMPKDETLDG---VGHRHDWENCVVWLDDITLDEPNIVALSASYHSTYLYYYPPDS  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG S K++Y  S +  + +L  T   GETQDLI WDQL   A+ AL +TD+      
Sbjct  162  DYLDGDSAKIEYSTSWVLLDHSLSATSTSGETQDLIMWDQLTDAARTALEDTDFG-----  216

Query  121  MCDVKMPLKDGEFTKNLAETLAT  143
              D  +P K+  F   LA    T
Sbjct  217  --DANVPFKEANFETKLANAYYT  237

>PPTG_15234
Length=235

 Score = 102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 12/138 (9%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK   + G   LGHRH+WE  +VW+D  +LDN +I+ +S S    Y    PP +
Sbjct  105  MYSWYMPKDETLDG---LGHRHDWENCVVWLD--SLDNPSIVALSASYHSTYLYYYPPDS  159

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG S K++Y  S +  + +L  T  VGETQDLI WDQL   A+ AL +TD+      
Sbjct  160  DYLDGDSAKIEYSTSWVILDHSLSATSTVGETQDLIMWDQLTDAARTALEDTDF------  213

Query  121  MCDVKMPLKDGEFTKNLA  138
              D  +P K+  F   +A
Sbjct  214  -GDANVPFKETNFATKVA  230

>PHYKE_1224
Length=132

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 77/137 (56%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +   GLGHRH+WE+AIVWIDNP ++N  I+G + S+  GY K S   A
Sbjct  1    MYSWYFPKD---SPSPGLGHRHDWEHAIVWIDNPDVENPKIIGAATSSHNGYEKYSSVPA  57

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              ++G ++K++Y+      N  ++ T+ VG  QDL+ WDQ+   A+ ALN         +
Sbjct  58   SCLEGDALKVEYFCDWPM-NHEMQLTDTVGGFQDLVMWDQMTDEARQALNTV-------S  109

Query  121  MCDVKMPLKDGEFTKNL  137
                  P  DG F   L
Sbjct  110  FGKANCPFNDGNFGGKL  126

>PHYCA_129892
Length=234

 Score = 101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 79/143 (55%), Gaps = 12/143 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK   +    GLGHRH+WE  +VW+D  +L+N  ++ +S S    Y    PP +
Sbjct  104  MYSWYMPKDETL---PGLGHRHDWEACVVWLD--SLENPNVVALSASYHSTYLTYYPPDS  158

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K++Y  S +  + +L  T   GETQDLI WDQL   A+ AL +TD+      
Sbjct  159  GYLDGNSAKIEYSTSWVILDHSLSATSTSGETQDLIMWDQLTDAARTALEDTDFG-----  213

Query  121  MCDVKMPLKDGEFTKNLAETLAT  143
              D  +P KD  F   LA    T
Sbjct  214  --DANVPFKDANFETKLANAYYT  234

>PHYSO_490000
Length=241

 Score = 100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 76/139 (55%), Gaps = 10/139 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPK          GHRH+WE+ IV I+NP L+N TIL ++ SA  GYS  +PP A
Sbjct  108  MYAWYFPKDEPTDFD---GHRHDWEHVIVRINNPVLENPTILAMTPSAHSGYSTYAPPPA  164

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              V G+S K++Y  S I  +  L  T   GETQDLI W  L   A+ AL+ T       N
Sbjct  165  DMVSGTSCKVEYTSSWIFIDHHLEGTSTAGETQDLIMWSDLTDAARYALSTT-------N  217

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P+ +G F   L++
Sbjct  218  FGKADTPMNNGTFNWKLSK  236

>PHYRA_73883
Length=551

 Score = 105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 134/515 (26%), Positives = 216/515 (42%), Gaps = 60/515 (12%)

Query  285  EEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  344
            E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G +
Sbjct  39   ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTV  90

Query  345  PKKLMHQSSLIGETMHHDSANFGWNVASGEGKG-ATFDWKQLVSNVDSYIKSIN----FK  399
            P K   +++L      H +    +N  +G  K     D  Q V  V+     I      +
Sbjct  91   PSKTFREAALHLTGYRHKAF---YNGQAGPSKRFGVEDILQRVRKVEDAETDITRHQLMR  147

Query  400  YKVELRSKYVKY----ENFLGSFLDPHTLELWHPRKGT------KQITTRHVVVAVGGRP  449
              V+L +   ++    +N +    +         ++ T      + +T    +V VG RP
Sbjct  148  NGVQLINGTARFLPGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKFLVCVGTRP  207

Query  450  -KQLTCP-GAEYAISSDDIFWMK-KTAPGKTLVVGASYVALECAGFLKGM-GYDVKVM-V  504
             +    P   E    SD + W K KT P + +VVGA  V +E A  +  + G DV V+  
Sbjct  208  ARHPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDG  267

Query  505  RSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEET  564
            R  +L   D++++  +  Y   Q G  F+ +   +S+ K +NG++ V       ES +  
Sbjct  268  RKEILNMADKEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIFVHL-----ESGKTV  321

Query  565  F-DTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELT  622
              D +L   GR  +V  L L+  G+   +K GRI   N  QT+ P+I+A GD+I  P L 
Sbjct  322  VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAAPHIYAAGDIIGFPGLA  380

Query  623  PVAIQAGRFLSRRL-----YNNSTVQMDY-----DKVCT-----AVFTPIEYGCCGLSEE  667
              +++ GR  S  +      NN  +  D      D+V T      VF    Y    +S  
Sbjct  381  STSMEQGRLASVHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMV  440

Query  668  DSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVI-C-DTTRDKFVVGFHYLGPN  725
              NE+        Y       E             ++K+I C DT +   ++G H +G  
Sbjct  441  GKNEQQLTKEQTPYEVGMARYEELARGQMLGGVPGFLKIIFCPDTLK---ILGVHAIGEG  497

Query  726  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
            A E+     + M  G   +   + V  +PT AEA+
Sbjct  498  ATEIIHIGQVVMSTGGNLEYFRNAVFNYPTLAEAY  532

>PHYSO_468315
Length=255

 Score = 100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 76/139 (55%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WYFPK       +G+GHRH+WE+ +VWIDNP ++N  IL  + SA  GY K +PP A
Sbjct  122  MYCWYFPKDEP---SSGIGHRHDWEHVVVWIDNPDVENPKILAGTPSAHSGYHKYAPPNA  178

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG + K+  + S    + AL  T + G+ QDLI WDQL   A+ ALN+        +
Sbjct  179  GTVDGVTTKV-AFESHWPMDHALDSTTEGGDFQDLIMWDQLTDNARRALNSV-------S  230

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P+ DG F   L  
Sbjct  231  FGSADTPMNDGNFQAELGR  249

>H257_16541
Length=494

 Score = 105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 120/471 (25%), Positives = 200/471 (42%), Gaps = 54/471 (11%)

Query  309  EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGW  368
            +AA  G K   ++        +   LGGTC+NVGCIP K +   + +  +  H+  + G 
Sbjct  45   KAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALLHGTHLYHSAQHNFKSVGI  96

Query  369  NVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWH  428
             V +      + D+ QL+ + D  +K +    +   +   V Y    G  +    + +  
Sbjct  97   KVDN-----VSIDFDQLMKSKDKTVKILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVAL  151

Query  429  PRKGTKQITTRHVVVAVGGR-----PKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGAS  483
               G + + T+++++A G       P  +   G +  I S     +K+  P   +VVG  
Sbjct  152  NAGGNQTVNTKNILIATGSEVTPLPPVPVDNEGGKI-IDSTGALALKRV-PKHLVVVGGG  209

Query  484  YVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITK  543
             + LE       +G  + V+           + A+KI   M+ +   EF +    + +T 
Sbjct  210  VIGLEMGSVYGRLGSKITVV-----------EYADKICPTMDHEVTKEFQKLLTKQGMT-  257

Query  544  LENGQL---------LVKWTTEDDESCEET---FDTVLNATGRDPDVAKLGLDKAGVKLN  591
             + GQ          +V  T E     E T    D VL ATGR P  A LGL++ G++  
Sbjct  258  FKLGQKVTASKVDGDVVTLTVEPAAGGEATTIEADCVLVATGRRPFTAGLGLEEMGIQ-T  316

Query  592  EKTGRIWTK--NEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKV  649
            +K GRI     N QT+   IFAIGDVI+   L   A + G  +   +       ++YD +
Sbjct  317  DKFGRIKVNLSNFQTNVDGIFAIGDVIEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAI  375

Query  650  CTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVICD  709
               ++T  E    G +EE+        NV  Y+    P+  +           +VKV+  
Sbjct  376  PGVIYTFPEVASVGKTEEE----LKTANV-AYNVGKFPMMANSRARAVGETDGFVKVLAA  430

Query  710  TTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
               DK ++G H +  NAGE+     L ++ G + + +  T   HPT +EAF
Sbjct  431  KDDDK-ILGIHIIASNAGEMISEGVLGIEYGASAEDIGRTCHAHPTLSEAF  480

>PHALS_06162
Length=488

 Score = 104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 78/137 (57%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    T    LGHRH+WE+ IVWIDNP+L    IL V+ SA   Y+  SPP  
Sbjct  350  MYSWYFPKD---TAFPLLGHRHDWEHIIVWIDNPSLYKPRILAVASSAHSWYTVQSPPHT  406

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              V+G+SVK+  Y  +   N AL  T   GE QDLI W+QL   A+ +L   +     + 
Sbjct  407  DRVNGTSVKVK-YAGIWPLNHALTSTTKSGEYQDLIMWEQLTEAARQSLQQAN-----FG  460

Query  121  MCDVKMPLKDGEFTKNL  137
            M +V  P++DG F   L
Sbjct  461  MANV--PMRDGNFLDKL  475

>PHYCA_18373
Length=246

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 75/140 (54%), Gaps = 9/140 (6%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WY PKG           RH WE  +VWID+PA  NSTILGVS++      K +    
Sbjct  113  MYTWYLPKGS--------ASRHFWESVVVWIDDPAASNSTILGVSLNYGLQLKKETNIDP  164

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            K++ GSS+KLD +      N  LR TE  GE QDL+T+DQL   A  AL++ ++   L  
Sbjct  165  KYLSGSSLKLDSFPGFAINNPKLRLTELDGEFQDLVTFDQLTDAAGIALSHAEFSKGLIK  224

Query  121  MCDVKMPLKDGEFTKNLAET  140
                 MPL DG F + L + 
Sbjct  225  -AKTPMPLIDGVFNERLKDA  243

>PPTG_07089
Length=255

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 4/112 (4%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK       + +GHRH+WE+ +V+IDNP +    ILG S S   GY+K +P  A
Sbjct  122  MYSWYFPKD---APSSRMGHRHDWEHIVVFIDNPEVPEPKILGCSPSWHSGYNKYAPCPA  178

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNT  112
              +DGSSVK+ Y +S    N AL  T++ G+ QDLI WDQ+  +A+ ALN+T
Sbjct  179  DVIDGSSVKVKYEHSWPL-NHALDITKEAGDFQDLIMWDQMSDLARRALNDT  229

>PHYRA_71307
Length=237

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 77/138 (56%), Gaps = 10/138 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK   +    GLGHRH+WE  +VW+D+  LD   I+ +S S    Y    PP +
Sbjct  105  MYSWYMPKDETL---PGLGHRHDWENCVVWLDDITLDEPNIVALSASYHSTYLYYYPPDS  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K++Y  S +  + +L  T   GETQDLI W QL   A+ AL +TD+ +    
Sbjct  162  DYLDGNSAKIEYSTSWVILDHSLSATSTSGETQDLIMWGQLTDAARTALEDTDFGS----  217

Query  121  MCDVKMPLKDGEFTKNLA  138
                 +P K+G F   +A
Sbjct  218  ---ANVPFKEGNFATKVA  232

>PHYSO_334500
Length=235

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (58%), Gaps = 12/139 (9%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK   +    GLGHRH+WE  +VW+D+  LD+ +I+ +S S    Y    PP +
Sbjct  105  MYSWYMPKDETL---PGLGHRHDWEACVVWLDS--LDDPSIVALSASYHSTYLTYYPPDS  159

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K++Y  S +  + +L  T   GETQDLI WDQL   A+ AL +TD+ +    
Sbjct  160  DYLDGNSAKIEYSTSWVILDHSLSATSTAGETQDLIMWDQLTDAARTALEDTDFGS----  215

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P K+  F   +A+
Sbjct  216  ---ANVPFKEANFATKVAK  231

>PHYCA_12462
Length=177

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 1/76 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+       GHRH W YAIVW+D+   DNSTILGVSMSA  GYSK + PK+
Sbjct  101  MYAWYFPKGRQYISKYRFGHRHYWSYAIVWMDSDVPDNSTILGVSMSAGVGYSKETLPKS  160

Query  61   KH-VDGSSVKLDYYYS  75
            K+ VDG++VK + Y S
Sbjct  161  KYVVDGTTVKFESYNS  176

>PHYRA_46230
Length=212

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 77/140 (55%), Gaps = 11/140 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  +G+GHRH+WE+ +V+IDNP +    I+G S S+  GY K +P   
Sbjct  84   MYSWYFPKD---SPSSGMGHRHDWEHVVVFIDNPDVAEPKIMGCSASSHNGYKKYAPCPP  140

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+SVK+ Y +S    N  L  T D G  QDLI WDQ+   A+ ALN         +
Sbjct  141  WVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQDLIMWDQMTEDARRALNGV-------H  192

Query  121  MCDVKMPLKDGEFTKNLAET  140
              D   P+ DG F   L + 
Sbjct  193  FGDANTPMNDGNFIPKLEKA  212

>PHYCA_123205
Length=177

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 1/76 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPKGR+       GHRH W YAIVW+D+   DNSTILGVSMSA  GYSK + PK+
Sbjct  101  MYAWYFPKGRQYISKYRFGHRHYWSYAIVWMDSDVPDNSTILGVSMSAGVGYSKETLPKS  160

Query  61   KH-VDGSSVKLDYYYS  75
            K+ VDG++VK + Y S
Sbjct  161  KYVVDGTTVKFESYNS  176

>PHYSO_397673
Length=224

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 72/139 (52%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +   GLGHRH+WE+ IVWIDNP      IL V+ SA   Y K +PP A
Sbjct  93   MYSWYFPKD---SPSHGLGHRHDWEHVIVWIDNPDASEPKILAVTPSAHGDYQKYAPPNA  149

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K+  Y S    N  L  T D GE QDLI W Q+   A+ A N+        +
Sbjct  150  NTVDGTSAKV-VYESHWPMNHELSVTSDSGEFQDLIMWSQMSENARRAFNSV-------S  201

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P+ D  F   L +
Sbjct  202  FGKANTPMNDWGFEDRLGK  220

>PHYSO_329114
Length=236

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 8/102 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    T    LGHRH+WE+ +VWIDNPA+ N  IL V+ SA  GYSK +PPKA
Sbjct  106  MYSWYFPKDSPSTT---LGHRHDWEHVVVWIDNPAVANPKILAVTPSAHSGYSKYAPPKA  162

Query  61   KHVDGSSVKLDY--YYSVIRGNTALRYTEDVGETQDLITWDQ  100
              V G++ K++Y  ++ V   N AL  T+  G+ QDLI W+Q
Sbjct  163  GTVTGNTAKVNYESHWPV---NHALDSTDVGGDAQDLIMWEQ  201

>PITG_18935
Length=480

 Score = 102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 130/484 (27%), Positives = 212/484 (44%), Gaps = 54/484 (11%)

Query  288  TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  347
            +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  26   SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  348  LMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
             +  S+ +  T  HD  ++G +           ++ Q++ + +  +K++    ++  +  
Sbjct  78   ALLHSTHLLHTAQHDFKSYGIDAPE-----VKANFPQMMKSKEKAVKTLTGGIELLFKKN  132

Query  408  YVKYENFLGSFLDPHTLEL-WHPRKGTKQITTRHVVVAVGGR----PKQLTCPGAEYAIS  462
             V Y    G       + +  +  KG + +  +++++A G      P       A   I 
Sbjct  133  KVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIID  192

Query  463  SDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGE  522
            S     +K+  P   +VVGA    +E   FL                 G D++   +  +
Sbjct  193  STGALELKRV-PEHLVVVGAGVTVVE---FLDAA------------CPGSDKEAVKEFTK  236

Query  523  YMEVQAGIEFIRKTVPESITKLENGQLLVKWTTE-----DDESCEETFDTVLNATGRDPD  577
             ++ Q G++F   T    +T  E    +VK TTE     D  S E   DTVL ATGR   
Sbjct  237  LLKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIE--CDTVLVATGRRAF  290

Query  578  VAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRL  636
             + LGL++ G++  +K GRI   +  +T  P IFAIGDVI    L   A + G      +
Sbjct  291  TSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENI  349

Query  637  YNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesr  696
                   ++Y  +   ++T  E+   G +EE+      E NV  +     P+  +     
Sbjct  350  AGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMANSRART  403

Query  697  tssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  756
             +     VKV+ D   DK  +G H +  NAGE+     + ++ G   + +  T   HPT 
Sbjct  404  IAEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTL  462

Query  757  AEAF  760
            +EAF
Sbjct  463  SEAF  466

>PHYSO_334487
Length=258

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 74/139 (53%), Gaps = 10/139 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY WYFPK     G    GHRH+WE+ IVWIDNP ++N  I+ ++ SA  GYS  + P A
Sbjct  105  MYCWYFPKDEPQDG---TGHRHDWEHVIVWIDNPDVENPKIMAMTPSAHSGYSTYALPPA  161

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              VDG+S K++Y  S +  +  L  T   GE QDLI W  L   A+ ALN T       +
Sbjct  162  DMVDGTSCKVEYTSSWLFIDHHLEGTSTAGEFQDLIMWSDLTDGARLALNTT-------S  214

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P+ DG F   + +
Sbjct  215  FGKANTPMNDGNFLPKIQK  233

>PHYSO_560790
Length=237

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 14/135 (10%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYA--IVWIDNPALDNSTILGVSMSASFGYSKSSPP  58
            MY+WY PK   +TG   LGHRH+WE    +VW+D  +LDN +I+ +S S    Y    PP
Sbjct  105  MYSWYMPKDETLTG---LGHRHDWEACNCVVWLD--SLDNPSIVALSASYHSTYLYYYPP  159

Query  59   KAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTL  118
             + ++DG+S K++Y  S +  + +L  T   GETQDLI WDQL   A+ AL +TD+    
Sbjct  160  DSDYLDGNSAKIEYSTSWVILDHSLSATSTAGETQDLIMWDQLTDAARTALEDTDFG---  216

Query  119  WNMCDVKMPLKDGEF  133
                D  +P K+  F
Sbjct  217  ----DANVPFKEANF  227

>PYAR_16840
Length=536

 Score = 102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 126/512 (25%), Positives = 212/512 (41%), Gaps = 74/512 (14%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YDLVVIG G     C+ E+A  G++V V+D        T  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  352  SSL-IGETMHHDSANFGWNVASGEGKGATFD--WKQLVSNVDSYIKSINFKYKVELRSKY  408
            + L +    HH     G+   S   K  T D    ++   VDS +  I    K +L++  
Sbjct  89   AVLHLSGYRHH-----GFYGKSYSMKTVTIDDILYRVKRVVDSEVDVI----KAQLKAAR  139

Query  409  VKYENFLGSFLDPHTLELW-------HPRKGTKQITTRHVVVAVGGRPKQ--LTCPGAEY  459
            + Y   L  F + H + +               ++     ++A G RP    L     + 
Sbjct  140  IDYLPGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKV  199

Query  460  AISSDDIF-WMKKTAPGKTLVVGASYVALECAGFLKGM-GYDVKVM-----VRSILLRGF  512
             + SD I     +  P   +VVGA  + +E A  L  + G+ V V+     VR++L    
Sbjct  200  ILDSDQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---  256

Query  513  DQDMA------------------NKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWT  554
             +DM+                  ++I   ++ +  ++  R  + E+I K+E     VK  
Sbjct  257  SRDMSLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVF  316

Query  555  TEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGD  614
                +    + D +L   GR      L L+  G+  N++      K  QT  P+I+A+GD
Sbjct  317  LTSGKVT--SGDALLYTVGRQASTDGLNLEAVGLGRNKRGLLTVNKAYQTEKPHIYAVGD  374

Query  615  VIDAPELTPVAIQAGRFLSRRLYNNS---TVQMDYDKVCTAVFTPIEYGCCGLSEED-SN  670
             I AP L   +++ GR  +  ++      T Q++       ++T  E    G +E+  ++
Sbjct  375  CIGAPSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTS  434

Query  671  ERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVIC--DTTRDKFVVGFHYLGPNAGE  728
            E+    N E+    +  L               +K++   DT R   V G H +G  A E
Sbjct  435  EKV---NYEIGLAKYSELAKGQMSGGAFGM---LKILFDPDTLR---VHGVHAIGEGATE  485

Query  729  VTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
            +     +A+ +G +     D V  +PT AEA+
Sbjct  486  IIHIGQVAIAMGCSLTYFRDAVFNYPTLAEAY  517

>PHYCA_69457
Length=213

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 76/137 (55%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +   GLGHRH+WE+AIV+IDNP +    IL  S+S+  GY K +P   
Sbjct  84   MYSWYFPKD---SPSPGLGHRHDWEHAIVFIDNPDVPEPKILACSVSSHSGYKKYNPCPP  140

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S+K+ Y +S    N  L  T D G  QDLI W+Q+   A+ ALN+        N
Sbjct  141  WVIDGTSLKVRYKHSWPT-NHDLDTTGDGGSFQDLIMWNQMTEDARRALNSV-------N  192

Query  121  MCDVKMPLKDGEFTKNL  137
                  P  DG+F   L
Sbjct  193  FGSANTPFNDGKFMPKL  209

>PHYRA_52960
Length=223

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 77/139 (55%), Gaps = 10/139 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK + +    GLG+RH+WE  +VWI N  L+   I+ +S+S    Y    P   
Sbjct  92   MYSWYMPKDQTL---PGLGYRHDWEACVVWISNITLEEPNIVALSVSYHSTYQTYYPLDK  148

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             +++G S K++Y  S +  + +L  T   GETQDLI WDQL   A+ AL +TD+      
Sbjct  149  DYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQDLIMWDQLTAAARTALEDTDFG-----  203

Query  121  MCDVKMPLKDGEFTKNLAE  139
                ++P KD  F + LA+
Sbjct  204  --GARVPFKDANFKEKLAK  220

>PHYRA_52955
Length=223

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 77/139 (55%), Gaps = 10/139 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK + +    GLG+RH+WE  +VWI N  L+   I+ +S+S    Y    P   
Sbjct  92   MYSWYMPKDQTL---PGLGYRHDWEACVVWISNITLEEPNIVALSVSYHSTYQTYYPLDK  148

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             +++G S K++Y  S +  + +L  T   GETQDLI WDQL   A+ AL +TD+      
Sbjct  149  DYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQDLIMWDQLTAAARTALEDTDFG-----  203

Query  121  MCDVKMPLKDGEFTKNLAE  139
                ++P KD  F + LA+
Sbjct  204  --GARVPFKDANFKEKLAK  220

>PHYCA_133455
Length=175

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 75/139 (54%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   +GHRH+WE+AIV+IDNP +    IL  S+S+  GY K +P   
Sbjct  44   MYSWYFPKDSPSTG---MGHRHDWEHAIVFIDNPDVPEPKILACSVSSHAGYKKYNPCPP  100

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S+K+ Y +     N  L  T D G  QDLI WDQ+   A+ ALN+        +
Sbjct  101  WVIDGTSLKVRYKHGWPL-NHDLDTTGDAGTFQDLIMWDQMTEDARRALNSV-------H  152

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P  DG F   L +
Sbjct  153  FGSANTPFNDGNFKPKLEK  171

>PHYSO_334498
Length=229

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 73/123 (59%), Gaps = 4/123 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPK         LGHRH+WE+A++WIDNP +    ILGVS S+  GY K +   A
Sbjct  108  MYAWYFPKDM---ASFDLGHRHDWEHAVIWIDNPDVAEPKILGVSASSHAGYEKVTTIPA  164

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              ++G+SV L+ Y S    +  LR+T   GE Q LI W QL   A+ +L+ TD+ + L  
Sbjct  165  GSLNGTSVLLN-YESTWPVDHELRFTTKGGEYQPLIMWTQLTDAARVSLSTTDFGSALMP  223

Query  121  MCD  123
            M D
Sbjct  224  MTD  226

>H310_02523
Length=494

 Score = 101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 114/460 (25%), Positives = 196/460 (43%), Gaps = 32/460 (7%)

Query  309  EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGW  368
            +AA  G K   ++      +GT   LGGTC+NVGCIP K +   + +     HD  + G 
Sbjct  45   KAAQLGLKTACVE-----ARGT---LGGTCLNVGCIPSKALLHGTHLYHAAQHDFKSVGI  96

Query  369  NVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWH  428
             V +      + D+ QL+ + +  +K +    +   +   V Y    G  +    L +  
Sbjct  97   KVDN-----VSIDFNQLMKSKEKTVKILTGGIEGLFKKNKVDYVKGFGKIVAKGQLSVAL  151

Query  429  PRKGTKQITTRHVVVAVGGR-----PKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGAS  483
               G + + T+++++A G       P  +   G +   S+  +    K  P   +VVG  
Sbjct  152  NGGGNQTLHTKNILIATGSEVTPLPPVPVDNEGGKIVDSTGALSL--KRIPNHLVVVGGG  209

Query  484  YVALECAGFLKGMGYDVKVMVRS-ILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESIT  542
             + LE       +G  + V+  +  +    D ++  +  + +  Q     + + V  S  
Sbjct  210  VIGLEMGSVYGRLGSKITVVEYADKICPTMDHELTKEFQKLLTKQGMTFKLGQKVTASKV  269

Query  543  KLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTK--  600
              +   L V+     D +  E  D VL ATGR P  A LGL+  G++  ++ GRI     
Sbjct  270  DGDTVTLTVEPAAGGDATTIEA-DCVLVATGRRPYTAGLGLEDMGIQ-TDRFGRIKVNLS  327

Query  601  NEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYG  660
            N QT+   I+AIGDVI+   L   A + G  +   +       ++YD +   ++T  E  
Sbjct  328  NFQTNVDGIYAIGDVIEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAIPGVIYTFPEVA  386

Query  661  CCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVICDTTRDKFVVGFH  720
              G +EE+        NV  Y+    P+  +           +VKV+     DK ++G H
Sbjct  387  SVGKTEEE----LKAANV-AYNVGKFPMMANSRARAVGETDGFVKVLAAKDDDK-ILGIH  440

Query  721  YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
             +  NAGE+     L ++ G + + +  T   HPT +EAF
Sbjct  441  IIASNAGEMISEGVLGIEYGASAEDIGRTCHAHPTLSEAF  480

>PHYCA_504445
Length=548

 Score = 101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 136/534 (25%), Positives = 223/534 (42%), Gaps = 75/534 (14%)

Query  277  TETPA--VPM-----EEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  329
            TE PA   P+     E   S  +DL+VIG G  G  C+ ++A  G+ V ++D        
Sbjct  24   TEAPAENKPLTDALRELRASEHFDLIVIGSGPAGQKCAIDSAKSGKSVAIID--------  75

Query  330  TSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKG-ATFDWKQLVSN  388
                +GG CV+ G +P K   +++L      H +    +N   G  K     D  Q V  
Sbjct  76   KRDMMGGVCVHTGTVPSKTFREAALHLTGYRHKAF---YNGHGGPSKRFGVEDILQRVRK  132

Query  389  VDSYIKSIN----FKYKVEL---RSKYVKYENFLGSFLDPHTLELW--HPRKGTKQITTR  439
            V+     I      +  V+L    ++++   N + + L   + E      R  +  I  R
Sbjct  133  VEDAETDITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAQRHSSADICKR  192

Query  440  -----HVVVAVGGRP-KQLTCP-GAEYAISSDDIFWMK-KTAPGKTLVVGASYVALECAG  491
                   +V VG RP ++   P   E    SD + W K KT P + ++VGA  V +E A 
Sbjct  193  VLTADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYAS  252

Query  492  FLKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQL  549
             +  + G DV V+  R  +L   D++++  +  Y   Q G  F+     +S+ K   G++
Sbjct  253  MMTIIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLTGETIKSVEKTAKGEV  311

Query  550  LVKWTTEDDESCEETF-DTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTP  607
             V       ES +    D +L   GR  +V  L L+  G++  +K GRI   N  QT+ P
Sbjct  312  FVHL-----ESGKTVVGDGLLYTVGRQGNVEGLNLEAVGLE-PDKRGRIKVDNNFQTAVP  365

Query  608  NIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQM----------DYDKVCT------  651
            +I+A GD+I  P L   +++ GR  S  +  + T+            D D+V T      
Sbjct  366  HIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKTLNTKELSDDKKMDDPDRVRTRMRSGE  425

Query  652  ----AVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVI  707
                 ++T  E    G +E+   +   +   EV    +  L              ++K+I
Sbjct  426  VFPFGIYTVPEISMVGKNEQQLTKE--QVPYEVGKARYEELARGQMLGGVPG---FLKII  480

Query  708  -CDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
             C  T    ++G H +G  A E+     + M  G   +   + V  +PT AEA+
Sbjct  481  FCPETLK--ILGVHAIGEGATEIIHIGQVVMSTGGDLEYFRNAVFNYPTLAEAY  532

>PYVX_20512
Length=528

 Score = 101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 123/497 (25%), Positives = 200/497 (40%), Gaps = 53/497 (11%)

Query  291  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  350
            DYDLVVIG G     C+ E+A  G++V ++D            +GG CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  88

Query  351  QSSL-IGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYV  409
            ++ L +    HH     G+   S   K  T D   ++  V   + S     K +L++  V
Sbjct  89   EAVLHLSGYRHH-----GFYGKSYSMKNITID--DILYRVQRVVASEVDVIKAQLKAARV  141

Query  410  KYENFLGSFLDPHTLELWHPRKGT----------------KQITTRHVVVAVGGRPKQ--  451
             Y     SF  PH L +      +                 ++     ++A G RP    
Sbjct  142  DYIAGTASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNP  201

Query  452  LTCPGAEYAISSDDIFWMK-KTAPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSIL  508
            L     +    SD I   +    P   +VVGA  + +E A  +  + G+ V V+  R  +
Sbjct  202  LVPVDGKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDI  261

Query  509  LRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTV  568
            L   D ++ + +   M  + G  F+     +SI K E G   VK      +    T D +
Sbjct  262  LSFCDTEIISNLMYEMRSK-GARFLLGETIKSIEKSERG---VKVFFNSGKVA--TADAL  315

Query  569  LNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQA  628
            L   GR      L L+  G+  N +      KN QT   +I+A GD I AP L   +++ 
Sbjct  316  LYTVGRQASTDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQ  375

Query  629  GRFLSRRLYNN-----STVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHK  683
            GR  +  ++++     ST Q+D       ++T  E    G +E+   +     N EV   
Sbjct  376  GRLAACHMWDDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQQLTKE--GVNYEVGIA  433

Query  684  NFVPLewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTY  743
             +  L         +     + + C  + + F  G H +G  A E+     +A+ +G + 
Sbjct  434  KYSELAKGQMTGAIAGGMLKI-LFCPDSLELF--GVHAIGEGATEIIHIGQVAIAMGCSL  490

Query  744  DQMVDTVGIHPTTAEAF  760
                + V  +PT AEA+
Sbjct  491  TYFRNAVFNYPTLAEAY  507

>PHYCA_69479
Length=213

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +   GLGHRH+WE+AIV+IDNP +    IL  S+S+  GY K +P   
Sbjct  84   MYSWYFPKD---SPSPGLGHRHDWEHAIVFIDNPDVPEPKILACSVSSHSGYKKYNPCPP  140

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S+K+ Y ++    N  L  T D G  QDLI W+Q+   A+ ALN+        N
Sbjct  141  WVIDGTSLKVRYKHAWPM-NHDLDTTGDGGSFQDLIMWNQMTEDARRALNSV-------N  192

Query  121  MCDVKMPLKDGEFTKNL  137
                  P  DG F   L
Sbjct  193  FGSANTPFNDGRFMPKL  209

>PHYCA_576423
Length=234

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 77/139 (55%), Gaps = 12/139 (9%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WY PK   + G    GHRH+WE  +VW+D  +LD  +I+ +S S    Y+   PP +
Sbjct  104  MYSWYMPKDETLDG---QGHRHDWENCVVWLD--SLDRPSIVALSASYHSTYNYYYPPSS  158

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
             ++DG+S K+ Y  S I  + +L  T   GE QDLI WDQL   A+ AL +TD+ +    
Sbjct  159  SYLDGNSAKIQYSTSWIVLDHSLSATSTAGEIQDLIMWDQLTDAARTALEDTDFGS----  214

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P K+  F   LA+
Sbjct  215  ---ANVPFKEDNFIAKLAK  230

>HYAP_09243
Length=266

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 4/126 (3%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPK   +     +GHRH+WE  +V+I++P     TILG S S   GY K +P   
Sbjct  128  MYAWYFPKDSPMLL---MGHRHDWENVVVFINDPDEVEPTILGCSTSWHSGYIKYAPCPT  184

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              ++GSSV + Y +S    N AL  T+D G  QDLI W Q+P +A+ ALN+TD+   +  
Sbjct  185  DSINGSSVMIKYEHSFPL-NHALNITKDAGAYQDLIMWHQMPDLARRALNDTDFGKAITP  243

Query  121  MCDVKM  126
            M D+  
Sbjct  244  MNDLNF  249

>PYU1_G011605
Length=524

 Score = 100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 117/485 (24%), Positives = 202/485 (42%), Gaps = 34/485 (7%)

Query  291  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  350
            DYDLVVIG G     C+ E+A  G++V ++D            +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFR  91

Query  351  QSSL-IGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYV  409
            ++ L +    HH      +++ +       +  K++V++    IK+     +VE    + 
Sbjct  92   EAVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYIPGFA  151

Query  410  KYEN--FLGSFLDPHTLELWHPRKGTKQITTRHV---VVAVGGRPKQ-LTCP-GAEYAIS  462
            ++EN   +    DP T E     + T  ++       ++A G RP      P   +    
Sbjct  152  RFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPIDGKVIFD  211

Query  463  SDDIFWMK-KTAPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANK  519
            SD I     +  P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + 
Sbjct  212  SDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFCDNEIISN  271

Query  520  IGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVA  579
            +   M  + G  F+       + K  NG      T   +     + D +L   GR     
Sbjct  272  LTYEMRSK-GARFLLGETINRVEKTGNG-----VTVYLNSGKVTSADAMLYTVGRQASTD  325

Query  580  KLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN  639
             L L+   +  N +      K+ QT  P+I+A+GD I AP L   +++ GR  +  +++ 
Sbjct  326  GLNLEAVNLSRNPRGLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLAACHMWDQ  385

Query  640  S----TVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslses  695
                 T Q++       ++T  E    G +E+   +     N E+    +  L       
Sbjct  386  EEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKE--GVNFEIGIAKYSELAKGQMSG  443

Query  696  rtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPT  755
             T+     +K++ D T  K   G H +G  A E+     +A+ +G +     D V  +PT
Sbjct  444  STAGG--MLKILFDPTTLKL-FGVHAIGEGATEIIHIGQVAIAMGCSVTYFRDAVFNYPT  500

Query  756  TAEAF  760
             AEA+
Sbjct  501  LAEAY  505

>H310_07641
Length=548

 Score = 100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 130/519 (25%), Positives = 214/519 (41%), Gaps = 74/519 (14%)

Query  289  SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  348
            S  +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K 
Sbjct  38   SEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKT  89

Query  349  MHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKY  408
              ++ L      H    F  N  +    G     ++++  V    ++     + +L    
Sbjct  90   FREAVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEEAETDLTRNQLTRNG  147

Query  409  VKYENFLGSFL-------------DPHTLELWHPRKGTKQITTR-----HVVVAVGGRPK  450
            +   N    FL             D +T +    R     I  R      V++AVG RP 
Sbjct  148  IILINGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPA  207

Query  451  QLTCPGAEY----AISSDDIFWMK-KTAPGKTLVVGASYVALECAGFLKGM-GYDVKVM-  503
            +   P  EY       SD + W      P + +VVGA  + +E A  +  + G  V V+ 
Sbjct  208  R--HPDLEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVID  265

Query  504  VRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLE---NGQLLVKWTTEDDES  560
             R  +L   D+++++ +  YM  Q G  F+ +   ESI K+E   + +++V  T+     
Sbjct  266  GRKEILDMADKEVSDALCYYMR-QRGSRFLTE---ESILKVETKDDSEVVVHLTS----G  317

Query  561  CEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPE  620
                 D +L   GR  +VA L L+  G+  N++       N QT+ P+I+A GD I  P 
Sbjct  318  KVIMGDALLYTQGRQGNVAGLDLEAVGLSANKRGILEVNNNFQTAVPHIYAAGDCIGYPA  377

Query  621  LTPVAIQAGRFLS---------RRLYNNSTV--------QMDYDKVCT-AVFTPIEYGCC  662
            L   +++ GR  S          +L  ++ V        +M   +V    ++T  E    
Sbjct  378  LASTSMEQGRLASVHMRTSEPTNKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMV  437

Query  663  GLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVI-CDTTRDKFVVGFHY  721
            G SE    ++  ++N+  Y       E             ++K+I C TT    ++G H 
Sbjct  438  GKSE----QQLSKENIP-YEVGIARYEELAKGQMLGGMPGFLKLIFCPTTLK--LLGVHA  490

Query  722  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
            +G  A E+     + M  G T +   + V  +PT AEA+
Sbjct  491  IGEGATEIIHIGQVVMSTGGTMEYFRNAVFNYPTLAEAY  529

>PHYCA_108409
Length=282

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 75/139 (54%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    TG   +GHRH+WE+AIV+IDNP +    IL  S+S+  GY K +P   
Sbjct  151  MYSWYFPKDSPSTG---MGHRHDWEHAIVFIDNPDVPEPKILACSVSSHAGYKKYNPCPP  207

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S+K+ Y +     N  L  T D G  QDLI WDQ+   A+ ALN+        +
Sbjct  208  WVIDGTSLKVRYKHGWPL-NHDLDTTGDAGTFQDLIMWDQMTEDARRALNSV-------H  259

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P  DG F   L +
Sbjct  260  FGSANTPFNDGNFKPKLEK  278

>PYAP_19280
Length=512

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 123/493 (25%), Positives = 209/493 (42%), Gaps = 53/493 (11%)

Query  292  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  351
            YDLVVIG G     C+ E+A  G++V V+D      +G+S  +GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE  81

Query  352  SSL-IGETMHHDSANFGWNVASGEGKGATFD--WKQLVSNVDSYIKSINFKYKVELRSKY  408
            + L +    HH     G+   S   K  T D    ++   VDS +  I    K +L++  
Sbjct  82   AVLHLSGYRHH-----GFYGKSYSMKTVTIDDILYRVKRVVDSEVDVI----KAQLKAAR  132

Query  409  VKYENFLGSFLDPHTLELWH------------PRKGTKQITTRHVVVAVGGRPKQ--LTC  454
            V Y      F + H + +               R  T+ +     ++A G RP    L  
Sbjct  133  VDYIPGFARFENDHEISIVREPTETNPEEEEPARLATR-LQADKFLIACGTRPAHSPLVP  191

Query  455  PGAEYAISSDDIFWMK-KTAPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRG  511
               +    SD I     +  P   +VVGA  + +E A  L  + G+ V V+  R  +L  
Sbjct  192  IDGKVVFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSF  251

Query  512  FDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNA  571
             D ++ + +   M V+ G  F+   + ESI K+E     VK      +    + D +L  
Sbjct  252  CDNEVVSMLQHEMRVK-GARFL---LGESIQKVEKTAKGVKVLLNSGKVT--SADALLYT  305

Query  572  TGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRF  631
             GR  +   L ++  G+  N++      K+ QT   +I+A+GD I AP L   +++ GR 
Sbjct  306  VGRQANTDGLNIEAVGLSRNQRGLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRL  365

Query  632  LSRRLYNN----STVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVP  687
             +  +++     +T Q++       ++T  E    G +E+       + N E+    +  
Sbjct  366  AACHMWDGNCDIATSQLENGNYPYGIYTIPEISMVGKTEQQLTAE--KVNYEIGIAKYSE  423

Query  688  LewslsesrtssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  747
            L        + +    +    DT +   + G H +G  A E+     +A+ +G +     
Sbjct  424  LAKGQMGGGSHNGILKILFDPDTLK---LHGVHAIGEGATEIIHIGQVAIAMGCSLTYFR  480

Query  748  DTVGIHPTTAEAF  760
            D V  +PT AEA+
Sbjct  481  DAVFNYPTLAEAY  493

>PPTG_00938
Length=550

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 135/534 (25%), Positives = 222/534 (42%), Gaps = 75/534 (14%)

Query  277  TETPA--VPM-----EEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  329
            TE PA   P+     E   S  +DL+VIG G  G  C+ ++A  G+ V ++D        
Sbjct  26   TEAPAENRPLTDTLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------  77

Query  330  TSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKG-ATFDWKQLVSN  388
                LGG CV+ G +P K   +++L      H +    +N  +G  K     D  Q V  
Sbjct  78   KRDMLGGVCVHTGTVPSKTFREAALHLTGYRHKAF---YNGQAGPSKRFGVEDILQRVRK  134

Query  389  VDSYIKSIN----FKYKVEL---RSKYVKYENFLGSFLDPHTLELWHPRKG-------TK  434
            V++    I      +  V+L    ++++     + + L   + E     K         +
Sbjct  135  VENAETDITRHQLLRNGVQLINGTARFLPGSKNMVAVLSNESYETATDAKRHSSADICKR  194

Query  435  QITTRHVVVAVGGRP-KQLTCP-GAEYAISSDDIFWMK-KTAPGKTLVVGASYVALECAG  491
             +T    +V VG RP ++   P   E    SD++ W K K+ P + ++VGA  V +E A 
Sbjct  195  VLTADKFLVCVGTRPARRPDIPFDGETIFDSDELLWGKVKSVPRRLIIVGAGVVGMEYAS  254

Query  492  FLKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQL  549
             +  + G DV V+  R  +L   D+ ++  +  Y   Q G  F+     +S+ K   G++
Sbjct  255  MMTIIPGTDVTVIDGRQEILNMADKQVSEALC-YSMTQTGTRFLTGETIKSVEKSPKGEV  313

Query  550  LVKWTTEDDESCEETF-DTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTP  607
             V       ES +    D +L   GR  +V  L L+  G+   +K GRI   N  QT+ P
Sbjct  314  FVHL-----ESGKTVVGDGLLYTVGRQGNVEGLNLEAVGLS-PDKRGRIKVDNNFQTAVP  367

Query  608  NIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQ----------MDYDKVCT------  651
            +I+A GD+I  P L   +++ GR  S  +  +  +            D D+V T      
Sbjct  368  HIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGE  427

Query  652  ----AVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVI  707
                 ++T  E    G +E    ++  ++ V  Y       E             ++K+I
Sbjct  428  VFPFGIYTVPEISMVGKNE----QQLTKEQVP-YEVGVARYEELARGQMLGGVPGFLKII  482

Query  708  -CDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
             C  T   F  G H +G  A E+     + M  G T +   + V  +PT AEA+
Sbjct  483  FCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  534

>PHYCA_69480
Length=213

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 76/139 (55%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  + +GHRH+WE+AIV+IDNP +    IL  S+S+  GY K +P   
Sbjct  84   MYSWYFPKD---SPSSRMGHRHDWEHAIVFIDNPDVPEPKILACSVSSHSGYKKYNPCPP  140

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S+KL Y +S    N  L  T D G  QDLI WDQ+   A+ ALN+        +
Sbjct  141  WVIDGTSLKLRYKHSWPI-NHDLDTTGDSGTFQDLIMWDQMTEDARRALNSV-------S  192

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P  DG F   L +
Sbjct  193  FGKANTPFNDGSFKPKLEK  211

>PHYCA_69477
Length=213

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 77/139 (55%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  + +GHRH+WE+AIV+IDNP +    IL  S+S+  GY K +P   
Sbjct  84   MYSWYFPKD---SPSSRMGHRHDWEHAIVFIDNPDVPEPKILACSVSSHSGYKKYNPCPP  140

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S+K+ Y +S    N  L  T D G  QDLI WDQ+   A+ ALN+  +   +  
Sbjct  141  WVIDGTSLKVRYKHSWPI-NHDLDTTGDAGTFQDLIMWDQMTEDARRALNSVSFGKAM--  197

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P  DG F   L +
Sbjct  198  -----TPFNDGSFKPKLEK  211

>HYAP_05562
Length=207

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 85/156 (54%), Gaps = 11/156 (7%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            ++AWYFPK     G   +GHRH+WE+A +W++NP  + S ILGV+   S G  +++  K 
Sbjct  56   IFAWYFPKDSVRDG---VGHRHDWEWATIWLNNPEANVSEILGVTTIGSRGPKRTNKLKR  112

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
            ++ +G +VKLDY     R   AL  + + G+ Q LI WDQ+   ++ ALN     T  WN
Sbjct  113  ENRNGDTVKLDYRDHGRRHYIAL--SGNDGQLQPLIMWDQMTEASRCALN-----TVGWN  165

Query  121  MCDVKMPLKDGEFTKNLAETLATASNSSVTTFHISG  156
               + MPL D  F  NLA    T + S   +  I G
Sbjct  166  KHRL-MPLADRVFDNNLATAYGTPATSGDESEEIQG  200

>PHYRA_41766
Length=209

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 75/138 (54%), Gaps = 11/138 (8%)

Query  3    AWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKAKH  62
            +WYFPK    +  +G+GHRH+WE+ +V+IDNP +    I+G S S+  GY K +P     
Sbjct  83   SWYFPKD---SPSSGMGHRHDWEHVVVFIDNPDVAEPKIMGCSASSHNGYKKYAPCPPWV  139

Query  63   VDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWNMC  122
            +DG+SVK+ Y +S    N  L  T D G  QDLI WDQ+   A+ ALN         +  
Sbjct  140  IDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQDLIMWDQMTEDARRALNGV-------HFG  191

Query  123  DVKMPLKDGEFTKNLAET  140
            D   P+ DG F   L + 
Sbjct  192  DANTPMNDGNFIPKLEKA  209

>H257_01186
Length=496

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 117/484 (24%), Positives = 205/484 (42%), Gaps = 44/484 (9%)

Query  291  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  350
            +YDL+VIG G  GL C+ E+A  G+ V ++D         S  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  351  QSSLIGETMHHDSANFGWNVASGEGKGATFD---WKQLVSNVDSYIKSINFKYKVELRSK  407
            ++ L      H S   G+N     GK  + +      ++  V+  + S     + +L++ 
Sbjct  80   EAVL------HLS---GFNHHGFYGKSYSRERITLSDILHRVNVVVSSEMDVIRAQLKAA  130

Query  408  YVKYENFLGSFLDPHTLELWHPRKGTKQITTR--HVVVAVGGRPKQ--LTCPGAEYAISS  463
            +V+       F + + + + +     + +  R    ++A G  P    +     E  + S
Sbjct  131  HVQIIPGKARFENANEVSVENGTVHREAMIYRGKKFLIACGTYPAHSPVVPVDGEVILDS  190

Query  464  DDIFWMKK-TAPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANKI  520
            D I    K   P   +VVGA  + +E A  L  + G  V V+  R  +L   D ++ + +
Sbjct  191  DGILEASKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSAL  250

Query  521  GEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETF-DTVLNATGRDPDVA  579
               M    G  F+     +S+T++  G         D  S + +F + +L   GR  +  
Sbjct  251  KMEMR-HKGARFLLGETIQSVTRVAKG------VRVDFASGKSSFAEALLYCVGRQANTD  303

Query  580  KLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNN  639
             L L+  G+  N++      K  QTS P+I+A GD I AP L   +++ GR  +  ++++
Sbjct  304  ALNLEGVGLAKNKRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHH  363

Query  640  S---TVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesr  696
                T Q+D       ++T  E    G +E+   +     N  V    +  L   +    
Sbjct  364  EDQPTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKE--GRNYAVGMAKYSELAKGMMAGG  421

Query  697  tssesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  756
                   +K++ D    + V+G H +G  A E+     +AM +        D V  +PT 
Sbjct  422  QKGA---LKILFDPD-TQSVLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFNYPTL  477

Query  757  AEAF  760
            AEA+
Sbjct  478  AEAY  481

>PHYCA_507156
Length=132

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 75/139 (54%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  + +GHRH+WE+AIV+IDNP +    IL  S+S+  GY K +P   
Sbjct  1    MYSWYFPKD---SPSSRMGHRHDWEHAIVFIDNPDVPEPKILACSVSSHSGYKKYNPCPP  57

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S+K+ Y ++    N  L  T D G  QDLI WDQ+   A+ ALN         +
Sbjct  58   WVIDGTSLKVRYKHAWPM-NHDLDTTGDSGTFQDLIMWDQMTEDARRALNAV-------H  109

Query  121  MCDVKMPLKDGEFTKNLAE  139
                  P  DG F   L +
Sbjct  110  FGSANTPFNDGNFKPKLEK  128

>PHYRA_54327
Length=219

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 4/112 (4%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +  +G+GHRH+WE+ +V+IDNP L    ILG S+S+  GY K +P   
Sbjct  90   MYSWYFPKD---SPASGMGHRHDWEHVVVFIDNPDLPEPKILGCSVSSHDGYKKYNPCPP  146

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNT  112
              +DG+SVK+ Y +S    N  L  T D G  QDLI W+Q+   A+ ALN T
Sbjct  147  WVIDGTSVKVRYKHSWPL-NHDLDTTGDGGTFQDLIMWNQMTDNARRALNET  197

>PHALS_13513
Length=240

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 1/110 (1%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MYAWYFPK     G    G RH W +AIVW D    +NS+ILGV+MSA  G  K +  K+
Sbjct  106  MYAWYFPKAAVHIGRGVSGRRHYWLHAIVWTDEENPNNSSILGVTMSAGIGLLKRTKIKS  165

Query  61   KH-VDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDAL  109
             + + G+++KL  Y S      AL++T  +GETQDLITW+QL   A+ AL
Sbjct  166  HYIIGGTTLKLMSYVSFWGRRLALKFTVKLGETQDLITWEQLSHEARKAL  215

>PPTG_13769
Length=349

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 78/137 (57%), Gaps = 11/137 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            MY+WYFPK    +   GLGHRH+WE AIV+IDNP +    ILG S+S+  GY++ +P   
Sbjct  217  MYSWYFPKD---SPSHGLGHRHDWEEAIVFIDNPDVSEPKILGCSVSSHGGYARHAPCPP  273

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
              +DG+S+K+ Y +S  + N  L  T D G+ QDLI W Q+   A+ ALN   + +    
Sbjct  274  WVIDGTSLKVRYKHSWPK-NHDLAITGDGGKFQDLIMWGQMTNDARRALNAVSFGS----  328

Query  121  MCDVKMPLKDGEFTKNL  137
                  P KDG F   +
Sbjct  329  ---ANTPFKDGTFQDKI  342

>PHALS_06084
Length=260

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 76/139 (55%), Gaps = 11/139 (8%)

Query  1    MYAWYFPKGRKITGGAGLGHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKA  60
            M++WYFPK         LGHRH+WE  +++ID+P +    ILG SMS    Y K +P   
Sbjct  128  MFSWYFPKDSPF---PLLGHRHDWENVVIFIDSPKVPLPKILGCSMSYHSEYIKFAPCPT  184

Query  61   KHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWN  120
               +G+SVK+ Y  S    N AL  TE  G  QDLI W+QLP + + +LN+TD+ +    
Sbjct  185  FATNGTSVKVKYEDS-FPLNHALNVTEKEGTFQDLIMWNQLPPIVRKSLNDTDFGS----  239

Query  121  MCDVKMPLKDGEFTKNLAE  139
                 +P+ D  F K + E
Sbjct  240  ---ANVPMNDWNFLKKVEE  255

>PYIW_25190
Length=206

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 95/185 (51%), Gaps = 4/185 (2%)

Query  581  LGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDV-IDAPELTPVAIQAGRFLSRRLYNN  639
            LGL+  GVKLN+    +    E TS   I+AIGD  I   ELTPVAI AGR L+ RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  640  ST-VQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLewslsesrts  698
                 + Y ++ T VF+    G  G +E  + E+FG  NV+ Y   FV L  ++++    
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMADPDHK  121

Query  699  sesCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  758
             ++  +K++     +  V   H  G  A E+ Q  G+AMK+  T     + V IHPT +E
Sbjct  122  GKTA-MKLVTVGEDEVVVG-VHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTASE  179

Query  759  AFTTL  763
               T+
Sbjct  180  ELVTM  184

>PHALS_12028
Length=579

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 134/519 (26%), Positives = 216/519 (42%), Gaps = 76/519 (15%)

Query  289  SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  348
            S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G IP K 
Sbjct  33   SEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTIPSKT  84

Query  349  MHQSSLIGETMHHDSANFGWNVASGEGKG-ATFDWKQLVSNVDSYIKSINFKYKVELRSK  407
              +++L      H +    +N   G  K     D  Q V  V+S    I    + +L   
Sbjct  85   FREAALHLTGYRHKAF---YNGQGGPSKRFGVEDILQRVKKVESAETDIT---RHQLLRN  138

Query  408  YVKYENFLGSFL--DPHTLELWH----------PRKGTKQITTR-----HVVVAVGGRP-  449
             V+  N    FL    H + +             R  +  I  R       ++ VG RP 
Sbjct  139  GVQLINGTARFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFLLCVGTRPA  198

Query  450  KQLTCP-GAEYAISSDDIFWMK-KTAPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VR  505
            ++   P   E    SD + W K K+ P + +VVGA  + +E A  +  + G DV V+  R
Sbjct  199  RRADIPFDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDAR  258

Query  506  SILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETF  565
              +L   D +++  +   M  Q G  F+   V +S+ K   G++ V       ES +   
Sbjct  259  KEILNMADNEVSEALCFSM-AQTGTRFLTGEVIKSVEKSAMGEVFVHL-----ESGKTVV  312

Query  566  -DTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNE-QTSTPNIFAIGDVIDAPELTP  623
             D +L   GR  +V  L L+  G+ + +K G+I   N  QT+ P+I+A GD+I  P L  
Sbjct  313  GDGLLYTVGRQGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLAS  371

Query  624  VAIQAGRFLSRRL-----YNNSTVQMDY-----DKVCT----------AVFTPIEYGCCG  663
             +++ GR  S  +      N+  +  D      D+V T           ++T  E    G
Sbjct  372  TSMEQGRLASVHMRTSQPLNDQKISDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVG  431

Query  664  LSEEDSNERFGEDNVEVYHKNFVPLewslsesrtssesCYVKVI-C-DTTRDKFVVGFHY  721
             +E    ++  ++ V  Y       E             ++K+I C DT +   V+G H 
Sbjct  432  KNE----QQLTKEGVP-YEVGVARYEELAKGQMLGGVPGFLKIIFCPDTLK---VLGVHA  483

Query  722  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAF  760
            +G  A E+     + M    T +   + V  +PT AEA+
Sbjct  484  IGEGATEIIHIGQVLMSTDGTLEYFRNAVFNYPTLAEAY  522

Lambda      K        H        a         alpha
   0.318    0.134    0.414    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 62747661798

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40