Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_8390534611301306052e-81
PHYRA_81105534612011095229e-68
PPTG_17123147532011095054e-65
PHYCA_537323449662001094984e-64
PITG_18452147538561095023e-59
PYVX_18173449665001094108e-48
PHYSO_35340153461146783668e-45
HYAP_07096534612511083601e-42
PHALS_0648053461159713071e-35
PYU1_G00173993203266972872e-31
PYU1_G00173853461226952512e-26
PYIW_1878893203244962416e-25
PYU1_G00174014752206972126e-21
PPTG_1004821314190971969e-19
PHYCA_1436910979248971991e-18
PPTG_1526423128194971961e-18
PPTG_1736623913194971961e-18
PPTG_1063552856199971961e-18
PYIR_2508985404262971991e-18
PHYCA_12942514752204971952e-18
PHYSO_477820568762021001952e-18
PHYRA_8419072013206971943e-18
PHYRA_8110756876202971933e-18
PITG_1352010979171971905e-18
PHYKE_838914752204971925e-18
PYIW_1879185404194981916e-18
PHYCA_10255045705268971956e-18
PHYSO_536424606911971071916e-18
PHYSO_507031586531971071916e-18
PHYCA_51140956876204971891e-17
PPTG_1063610979246971912e-17
PHYRA_8563110979228971902e-17
PHYKE_344623128199971863e-17
PHYSO_34159910979185971854e-17
PHYRA_8110614752202971855e-17
PHYCA_10285224206195971855e-17
PHYCA_10262472013195971846e-17
PPTG_1063472013208971848e-17
PHYKE_838856876205971849e-17
PHYSO_49997823128174971829e-17
PHYSO_50157582077174971829e-17
PYU1_G00174456876213971841e-16
PYU1_G00174293204213971822e-16
PPTG_1064345705250971842e-16
PPTG_1712214752204971813e-16
PPTG_1712156876202971794e-16
PYIR_2662614752212981761e-15
PYU1_G00174185404199971751e-15
PYIR_2654686605239981762e-15
PYAP_2227893204289981773e-15
PYAR_2409693203227971735e-15
PYAP_2227393203268751738e-15
PHYRA_8286423128193971682e-14
PHALS_00498109791991051682e-14
PHYSO_34159652856231761682e-14
PHYKE_771810979220971673e-14
PYVX_1817485404204971673e-14
PHALS_03284309411881051645e-14
PHYSO_28408614752204971655e-14
PYAP_2227985404223981665e-14
PHYSO_24667645705187951621e-13
PHYSO_343376532371721091601e-13
PYVX_1817656876201971576e-13
PYIW_1879293204125961502e-12
PPTG_1425444576188761462e-11
PITG_1845014752203971445e-11
PPTG_0882086622501131456e-11
PHYCA_51081744576188761392e-10
PHYSO_41764944576185761383e-10
PPTG_1425546937268761404e-10
PHYKE_918544576281761396e-10
PITG_104998662323961362e-09
PHYCA_1436852856219741332e-09
PHYSO_52790860064174761303e-09
PHYCA_5369341305983761301e-08
PHYRA_8794174106157891242e-08
PHYRA_8615172836170891243e-08
PHYSO_26273246937188761243e-08
PHYSO_25416846284170861217e-08
PYIW_187905687686811168e-08
PHYSO_34036952676200781087e-06
PITG_198181564314759981e-04
PYAP_181319917222648982e-04
PYVX_181795346114753962e-04
PHYSO_3423645298319457890.002
PHYKE_8104771358654850.002
PYVX_181751475214753860.004
PYVX_161387861955955860.009
PYIW_21964977526582840.015
PHYKE_9024739829957770.12
PHYSO_5339036046520857770.12
PYVX_146625108654056770.14
PHYSO_5337476045120657760.16
PPTG_031535977331461750.26
PITG_08202683819158730.33
PHYRA_736065719836669710.85
PPTG_14221447827558700.97
PHYCA_151253717433457701.0
PITG_11944978230294701.1
PYU1_G0002199261141557701.2
PPTG_203762527518658691.3
PHYCA_1126153088319658691.5
PHYCA_196121885661073691.5
PHYRA_781613757137362691.6
PYIW_191518319124899681.7
PHYCA_5342965267130968682.0
PHYSO_3403335267128458672.3
PHYSO_5336826044627857672.5
PYU1_G013346971088532642.7
PHYSO_340332447829558672.8
PHYCA_127270447827958672.9
PPTG_062533717430357663.3
PHYRA_80631739832055663.4
PHYSO_5212105957816832663.4
PHYRA_78689683829658663.7
PITG_197141558151568664.3
PHYSO_483955423532057664.3
PPTG_046226969627359654.6
PHYSO_4381035572123859654.8
PYAP_15000592546542655.4
PITG_05271447827858645.8
PHYSO_5241015977330864646.4
PHYRA_781765977331264646.5
PHYCA_10471978230994647.3
PYU1_G001527977927861637.9
PYU1_G001523977627861637.9
H310_05643123786131670648.1
PHYKE_6001447828957638.1
PYVX_22510977859685648.2
PHYCA_123316977631663638.3
PYU1_G001526978033461638.8
PYIW_274778239918055638.8
PYIR_164438239927556639.3
PHYCA_527245464133941639.5
PITG_08895740119657629.6
SPRG_10799412761620639.7
PYIR_16435423330456639.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_8390

Length=130
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_8390                                                            237        2e-81
PHYRA_81105                                                           205        9e-68
PPTG_17123                                                            199        4e-65
PHYCA_537323                                                          196        4e-64
PITG_18452                                                            197        3e-59
PYVX_18173                                                            162        8e-48
PHYSO_353401                                                          145        8e-45
HYAP_07096                                                            143        1e-42
PHALS_06480                                                           122        1e-35
PYU1_G001739                                                          115        2e-31
PYU1_G001738                                                          101        2e-26
PYIW_18788                                                            97.4       6e-25
PYU1_G001740                                                          86.3       6e-21
PPTG_10048                                                            80.1       9e-19
PHYCA_14369                                                           81.3       1e-18
PPTG_15264                                                            80.1       1e-18
PPTG_17366                                                            80.1       1e-18
PPTG_10635                                                            80.1       1e-18
PYIR_25089                                                            81.3       1e-18
PHYCA_129425                                                          79.7       2e-18
PHYSO_477820                                                          79.7       2e-18
PHYRA_84190                                                           79.3       3e-18
PHYRA_81107                                                           79.0       3e-18
PITG_13520                                                            77.8       5e-18
PHYKE_8389                                                            78.6       5e-18
PYIW_18791                                                            78.2       6e-18
PHYCA_102550                                                          79.7       6e-18
PHYSO_536424                                                          78.2       6e-18
PHYSO_507031                                                          78.2       6e-18
PHYCA_511409                                                          77.4       1e-17
PPTG_10636                                                            78.2       2e-17
PHYRA_85631                                                           77.8       2e-17
PHYKE_3446                                                            76.3       3e-17
PHYSO_341599                                                          75.9       4e-17
PHYRA_81106                                                           75.9       5e-17
PHYCA_102852                                                          75.9       5e-17
PHYCA_102624                                                          75.5       6e-17
PPTG_10634                                                            75.5       8e-17
PHYKE_8388                                                            75.5       9e-17
PHYSO_499978                                                          74.7       9e-17
PHYSO_501575                                                          74.7       9e-17
PYU1_G001744                                                          75.5       1e-16
PYU1_G001742                                                          74.7       2e-16
PPTG_10643                                                            75.5       2e-16
PPTG_17122                                                            74.3       3e-16
PPTG_17121                                                            73.6       4e-16
PYIR_26626                                                            72.4       1e-15
PYU1_G001741                                                          72.0       1e-15
PYIR_26546                                                            72.4       2e-15
PYAP_22278                                                            72.8       3e-15
PYAR_24096                                                            71.2       5e-15
PYAP_22273                                                            71.2       8e-15
PHYRA_82864                                                           69.3       2e-14
PHALS_00498                                                           69.3       2e-14
PHYSO_341596                                                          69.3       2e-14
PHYKE_7718                                                            68.9       3e-14
PYVX_18174                                                            68.9       3e-14
PHALS_03284                                                           67.8       5e-14
PHYSO_284086                                                          68.2       5e-14
PYAP_22279                                                            68.6       5e-14
PHYSO_246676                                                          67.0       1e-13
PHYSO_343376                                                          66.2       1e-13
PYVX_18176                                                            65.1       6e-13
PYIW_18792                                                            62.4       2e-12
PPTG_14254                                                            60.8       2e-11
PITG_18450                                                            60.1       5e-11
PPTG_08820                                                            60.5       6e-11
PHYCA_510817                                                          58.2       2e-10
PHYSO_417649                                                          57.8       3e-10
PPTG_14255                                                            58.5       4e-10
PHYKE_9185                                                            58.2       6e-10
PITG_10499                                                            57.0       2e-09
PHYCA_14368                                                           55.8       2e-09
PHYSO_527908                                                          54.7       3e-09
PHYCA_536934                                                          54.7       1e-08
PHYRA_87941                                                           52.4       2e-08
PHYRA_86151                                                           52.4       3e-08
PHYSO_262732                                                          52.4       3e-08
PHYSO_254168                                                          51.2       7e-08
PYIW_18790                                                            49.3       8e-08
PHYSO_340369                                                          46.2       7e-06
PITG_19818                                                            42.4       1e-04
PYAP_18131                                                            42.4       2e-04
PYVX_18179                                                            41.6       2e-04
PHYSO_342364                                                          38.9       0.002
PHYKE_8104                                                            37.4       0.002
PYVX_18175                                                            37.7       0.004
PYVX_16138                                                            37.7       0.009
PYIW_21964                                                            37.0       0.015
PHYKE_9024                                                            34.3       0.12 
PHYSO_533903                                                          34.3       0.12 
PYVX_14662                                                            34.3       0.14 
PHYSO_533747                                                          33.9       0.16 
PPTG_03153                                                            33.5       0.26 
PITG_08202                                                            32.7       0.33 
PHYRA_73606                                                           32.0       0.85 
PPTG_14221                                                            31.6       0.97 
PHYCA_15125                                                           31.6       1.0  
PITG_11944                                                            31.6       1.1  
PYU1_G000219                                                          31.6       1.2  
PPTG_20376                                                            31.2       1.3  
PHYCA_112615                                                          31.2       1.5  
PHYCA_19612                                                           31.2       1.5  
PHYRA_78161                                                           31.2       1.6  
PYIW_19151                                                            30.8       1.7  
PHYCA_534296                                                          30.8       2.0  
PHYSO_340333                                                          30.4       2.3  
PHYSO_533682                                                          30.4       2.5  
PYU1_G013346                                                          29.3       2.7  
PHYSO_340332                                                          30.4       2.8  
PHYCA_127270                                                          30.4       2.9  
PPTG_06253                                                            30.0       3.3  
PHYRA_80631                                                           30.0       3.4  
PHYSO_521210                                                          30.0       3.4  
PHYRA_78689                                                           30.0       3.7  
PITG_19714                                                            30.0       4.3  
PHYSO_483955                                                          30.0       4.3  
PPTG_04622                                                            29.6       4.6  
PHYSO_438103                                                          29.6       4.8  
PYAP_15000                                                            29.6       5.4  
PITG_05271                                                            29.3       5.8  
PHYSO_524101                                                          29.3       6.4  
PHYRA_78176                                                           29.3       6.5  
PHYCA_10471                                                           29.3       7.3  
PYU1_G001527                                                          28.9       7.9  
PYU1_G001523                                                          28.9       7.9  
H310_05643                                                            29.3       8.1  
PHYKE_6001                                                            28.9       8.1  
PYVX_22510                                                            29.3       8.2  
PHYCA_123316                                                          28.9       8.3  
PYU1_G001526                                                          28.9       8.8  
PYIW_27477                                                            28.9       8.8  
PYIR_16443                                                            28.9       9.3  
PHYCA_527245                                                          28.9       9.5  
PITG_08895                                                            28.5       9.6  
SPRG_10799                                                            28.9       9.7  
PYIR_16435                                                            28.9       9.8  

>PHYKE_8390
Length=130

 Score = 237 bits (605),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/130 (100%), Positives = 130/130 (100%), Gaps = 0/130 (0%)

Query  1    MKHtlplllltllpllttGQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGV  60
            MKHTLPLLLLTLLPLLTTGQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGV
Sbjct  1    MKHTLPLLLLTLLPLLTTGQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGV  60

Query  61   NTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSG  120
            NTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSG
Sbjct  61   NTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSG  120

Query  121  YTMDGPCWKK  130
            YTMDGPCWKK
Sbjct  121  YTMDGPCWKK  130

>PHYRA_81105
Length=201

 Score = 205 bits (522),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)

Query  19   GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
            GQRRL A LGEGQIVL PPPFFIVDGLDFQGMALAYLQEQGVNTSIE QGWM  HGY SL
Sbjct  25   GQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASL  84

Query  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            R+MLDDE+LY+VTEEA+FDCGLTSPKTETQLIPTNS+FQ+SGYT+DGPC
Sbjct  85   RSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPC  133

>PPTG_17123
Length=201

 Score = 199 bits (505),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)

Query  19   GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
            GQRRL A LGEGQ+VL PPPFF+VDGLDFQGMALAYLQEQGVNTSIE Q WM  HGY SL
Sbjct  25   GQRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSL  84

Query  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            RAMLDDE+LYKVTEEA+F+CGLTSP+TETQ IPTN++FQTSGYT+DGPC
Sbjct  85   RAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPC  133

>PHYCA_537323
Length=200

 Score = 196 bits (498),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)

Query  19   GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
            GQRRL A LGEGQ+V  PPPFFIVDGLDFQGMALAYLQEQGVNTSIE Q WM  HGY SL
Sbjct  24   GQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSL  83

Query  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            RAMLDDE+LY+VTEEA+F+CGLTSPKTETQ IPTN++FQTSGYT+DGPC
Sbjct  84   RAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPC  132

>PITG_18452
Length=856

 Score = 197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)

Query  19   GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
            GQRRL A LGEGQIVL PPPFF+VDGLDFQGMALAYLQEQG+NTSIE Q WM   GY SL
Sbjct  680  GQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSL  739

Query  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            RAMLDDE+LYKVTEEA+F+CGLTSP+TETQ IPTN++FQTSGYT+DGPC
Sbjct  740  RAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPC  788

>PYVX_18173
Length=500

 Score = 162 bits (410),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 0/109 (0%)

Query  19   GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
             QRRL + LGEGQ+VL PPPFF+VDG+D++G  +AYL++QGV+T+IE Q W+   GY +L
Sbjct  26   AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85

Query  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            RA++DD+ LY VTEE LFDCGLT P TETQ IPTN +F TSGYT+DGPC
Sbjct  86   RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPC  134

 Score = 85.5 bits (210),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+V+ P P + V+G D +   LA+L+ Q  +T+ +  G+++++G+DSLRA +DD++LY V
Sbjct  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               A F CG T P    Q IP +   +++GYT DGPC
Sbjct  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPC  331

>PHYSO_353401
Length=146

 Score = 145 bits (366),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 0/78 (0%)

Query  50   MALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQL  109
            MALAYLQEQGVNTSIE Q WM  HGY SLRAMLDDE+LYKVTEEALFDCGLTSPKTETQ 
Sbjct  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60

Query  110  IPTNSTFQTSGYTMDGPC  127
            IP+NS+FQTSGYT+DGPC
Sbjct  61   IPSNSSFQTSGYTLDGPC  78

>HYAP_07096
Length=251

 Score = 143 bits (360),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 1/108 (1%)

Query  21   RRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRA  80
            +RL ++L EGQ+VL P P FIVD    QG ALAYLQEQG++TSIE Q W   HGY SLRA
Sbjct  76   QRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRA  135

Query  81   MLDDEALYKVTEEALFDCGLTSPKTET-QLIPTNSTFQTSGYTMDGPC  127
            MLDD++LY V+++A+FDCG TS  +ET Q IPTN T ++SGYT+DGPC
Sbjct  136  MLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPC  183

>PHALS_06480
Length=159

 Score = 122 bits (307),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)

Query  19  GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
           G RRL+A LGEGQ+VL P PF++VDGLDFQGMALAYL+EQG+NTSIE Q WM  H Y+SL
Sbjct  23  GYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSL  82

Query  79  RAMLDDEALYK  89
           RAMLDD+ LYK
Sbjct  83  RAMLDDDMLYK  93

>PYU1_G001739
Length=266

 Score = 115 bits (287),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+++ P PFF+VDG D Q   LA+L+ QGVNTS +  G+M   GY +LRA++DDE LY+V
Sbjct  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              +ALF+CG T P  E+Q IPT  T +++GYT DGPC
Sbjct  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPC  121

>PYU1_G001738
Length=226

 Score = 101 bits (251),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 0/95 (0%)

Query  33   VLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTE  92
            VL P PF++VDG + Q   +A+L+EQG+ TS +   +M   GY +LRAMLDD+ LY V  
Sbjct  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84

Query  93   EALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            +AL +CG T P  E+Q IP  + F ++GY ++GPC
Sbjct  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPC  119

>PYIW_18788
Length=244

 Score = 97.4 bits (241),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 64/96 (67%), Gaps = 2/96 (2%)

Query  33   VLQPPPFFIVDGLDFQGMA-LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVT  91
            V  P PFF++DG D++  A +A L++Q V TS +  G++   GY SLRAMLDDE LY V 
Sbjct  30   VTYPEPFFLLDG-DYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  88

Query  92   EEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             +++F+CG T P  E+Q IPTN   + +GY  DGPC
Sbjct  89   IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPC  124

>PYU1_G001740
Length=206

 Score = 86.3 bits (212),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 57/97 (59%), Gaps = 2/97 (2%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+V+ P P F V   D +   LA+L+ QG  T+ +   +  S GY SLRA +DD+  YKV
Sbjct  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               A F+CG T+     Q IP N  F+T+GYT DGPC
Sbjct  89   NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPC  123

>PPTG_10048
Length=190

 Score = 80.1 bits (196),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +I D  D Q   LA+L+ QG  T  + + W   +GY +LR  ++  A Y V
Sbjct  26   QVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFME-HAKYTV  84

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            TE A F CG T+PK   Q IP     +++GYT +GPC
Sbjct  85   TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPC  121

>PHYCA_14369
Length=248

 Score = 81.3 bits (199),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 54/97 (56%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  +  D +   LA+L+ QG  T  +   W N +GY SLR  +D  A Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  88   TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  124

>PPTG_15264
Length=194

 Score = 80.1 bits (196),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 54/97 (56%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVLQP P +  D  D +   LA+L+ QG  T  +   W   +GY +LR  +D  A Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            TE A + CG T PK   Q IP     +++GYT DGPC
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPC  121

>PPTG_17366
Length=194

 Score = 80.1 bits (196),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 54/97 (56%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVLQP P +  D  D +   LA+L+ QG  T  +   W   +GY +LR  +D  A Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            TE A + CG T PK   Q IP     +++GYT DGPC
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPC  121

>PPTG_10635
Length=199

 Score = 80.1 bits (196),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  +  D +   LA+L+ QG  T  + + W + +GY SLR  +D  A Y+V
Sbjct  12   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEV  70

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  71   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  107

>PYIR_25089
Length=262

 Score = 81.3 bits (199),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 0/97 (0%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V+ P P F V     Q   LA+L+ QG  T+ +   +  + GY +LRA +DD++ YKV
Sbjct  29   QYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAYKV  88

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             + A F+CG T      Q IP+ ST +++GYT DGPC
Sbjct  89   ADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPC  125

>PHYCA_129425
Length=204

 Score = 79.7 bits (195),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 2/97 (2%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D  D +   LA+L+ QG  T  +  GW  S+GY +LRA +D  A Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T+ A + CG T+ K   Q IP + T +++GYT DGPC
Sbjct  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPC  123

>PHYSO_477820
Length=202

 Score = 79.7 bits (195),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 1/100 (1%)

Query  28   GEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEAL  87
            G  Q+VL P P +  D    +   LA+L++QG  T  +   W   +GYDSLRA  +D A 
Sbjct  23   GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRA-FNDGAS  81

Query  88   YKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            Y V + A F CG T+   E Q IP ++  +++GYT DGPC
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPC  121

>PHYRA_84190
Length=206

 Score = 79.3 bits (194),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  D  D +   LA+L+ +G  T  +   W   +GY SLR  +D+ A Y V
Sbjct  12   QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSV  70

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T  A F CG T PK   Q IP ++  +++GYT DGPC
Sbjct  71   TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPC  107

>PHYRA_81107
Length=202

 Score = 79.0 bits (193),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D    +   LA+L++QG +T  +   W   +GYDSLRA  DD A Y V
Sbjct  26   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTV  84

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            ++ A F CG T    + Q IP  +  +++GYT DGPC
Sbjct  85   SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPC  121

>PITG_13520
Length=171

 Score = 77.8 bits (190),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 53/97 (55%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +     D +   LA+L+ QG  T  + + W + +GY SLR  +D  A Y V
Sbjct  29   QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T  A F CG T PK   Q IP     +++GYT DGPC
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPC  124

>PHYKE_8389
Length=204

 Score = 78.6 bits (192),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W  ++GY +LRA +D  A Y V
Sbjct  28   QVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AKYTV  86

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T+ A + CG T+     Q IP+ +  +++GYT DGPC
Sbjct  87   TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPC  123

>PYIW_18791
Length=194

 Score = 78.2 bits (191),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 55/98 (56%), Gaps = 1/98 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V  P P + V         L++L++ GV TS    G+M   GY +LRA++DD  LYK 
Sbjct  23   QAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLYKT  82

Query  91   TEEA-LFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               A  F CG T P   +Q+IP +ST +T+GYT  GPC
Sbjct  83   NSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPC  120

>PHYCA_102550
Length=268

 Score = 79.7 bits (195),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 52/97 (54%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D  D Q   LA+L+ QG  T  +   W N +GY SLR  + D A Y V
Sbjct  29   QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFM-DRAKYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               A F CG T P    Q IP  +  +++GYT DGPC
Sbjct  88   RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPC  124

>PHYSO_536424
Length=197

 Score = 78.2 bits (191),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 1/107 (1%)

Query  21   RRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRA  80
            RR   ++   QIVL P P +  +  + +   LA+L+ +G  T  +   W   +GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  81   MLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             +D  A Y VT  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPC  119

>PHYSO_507031
Length=197

 Score = 78.2 bits (191),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 1/107 (1%)

Query  21   RRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRA  80
            RR   ++   QIVL P P +  +  + +   LA+L+ +G  T  +   W   +GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  81   MLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             +D  A Y VT  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPC  119

>PHYCA_511409
Length=204

 Score = 77.4 bits (189),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D    +   LA+L++QG  T  +   W   +GYDSLRA  +D A Y V
Sbjct  28   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTV  86

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            ++ A F CG T+   + Q IP  +  +++GYT DGPC
Sbjct  87   SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPC  123

>PPTG_10636
Length=246

 Score = 78.2 bits (191),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  +  D +   LA+L+ QG  T  +   W N + Y SLR  +D+ A Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  124

>PHYRA_85631
Length=228

 Score = 77.8 bits (190),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D  D +   LA+L+ +G  T  +   W + +GY SLR  +D+ A Y V
Sbjct  29   QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             + A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  88   ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  124

>PHYKE_3446
Length=199

 Score = 76.3 bits (186),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  D  + +   LA+L+ QG  T  +   W   +GY +LRA +D  A Y+V
Sbjct  29   QIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMD-MAKYQV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            TE A + CG T P    Q IP     +++GYT DGPC
Sbjct  88   TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPC  124

>PHYSO_341599
Length=185

 Score = 75.9 bits (185),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  +  + +   LA+L+ QG  T  +   W   +GY SLR  +D  A Y V
Sbjct  12   QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDV  70

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPC  107

>PHYRA_81106
Length=202

 Score = 75.9 bits (185),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 54/97 (56%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W  S+GY +LRA +D  A Y V
Sbjct  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             + A + CG T+     Q IP  +  +++GYT DGPC
Sbjct  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPC  124

>PHYCA_102852
Length=195

 Score = 75.9 bits (185),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  +  D +   LA+L+ +G  T  +   W   +GY SLR  +D  A Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            TE A F CG T P    Q IP  +  +++GYT DGPC
Sbjct  88   TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPC  124

>PHYCA_102624
Length=195

 Score = 75.5 bits (184),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 52/97 (54%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D  D Q   L +L+  G  T  +   W   +GY SLR  +D+ A Y V
Sbjct  29   QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN-AKYPV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            +E A F CG T P    Q IP  +  +++GYT DGPC
Sbjct  88   SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPC  124

>PPTG_10634
Length=208

 Score = 75.5 bits (184),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  +  + +   LA+L+ +G  T  +   W   +GY SLR  LD+ A Y V
Sbjct  29   QIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDN-AKYPV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T+ A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  88   TDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  124

>PHYKE_8388
Length=205

 Score = 75.5 bits (184),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D    +   LA+L++QG +T  +   W + +GY SLRA  +D+A Y V
Sbjct  29   QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRA-FNDDASYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            ++ A F CG T      Q IP ++  +++GYT DGPC
Sbjct  88   SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPC  124

>PHYSO_499978
Length=174

 Score = 74.7 bits (182),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVLQP P +  +  + +   LA+L+ QG  T  + + W   +GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T+ A F CG T PK   Q IP     +++GYT DGPC
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPC  124

>PHYSO_501575
Length=174

 Score = 74.7 bits (182),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVLQP P +  +  + +   LA+L+ QG  T  + + W   +GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T+ A F CG T PK   Q IP     +++GYT DGPC
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPC  124

>PYU1_G001744
Length=213

 Score = 75.5 bits (184),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V+ P P F V     Q   LA+L+ QG  T+ +   +  + GY SLRA +DD+  YKV
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKV  88

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               A F CG T    + Q IP   T +++GYT DGPC
Sbjct  89   AAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPC  124

>PYU1_G001742
Length=213

 Score = 74.7 bits (182),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V+ P P F V     Q   LA+L+ QG  T+++   +  + GY +LRA +DD   YKV
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKV  88

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               A F CG T    + Q IP   T +++GYT DGPC
Sbjct  89   AAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPC  124

>PPTG_10643
Length=250

 Score = 75.5 bits (184),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  +  D +   LA+L+ QG     +   W   +GY SLR  +D  A Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMD-RAKYEV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T  A F CG T+PK   Q IP     +++GYT DGPC
Sbjct  88   TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPC  124

>PPTG_17122
Length=204

 Score = 74.3 bits (181),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 2/97 (2%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D  D +   LA+L+ QG  T  +  GW  ++GY +LR  + D A Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFM-DRAKYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T+ A + CG T+     Q IP + T +++GYT DGPC
Sbjct  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPC  123

>PPTG_17121
Length=202

 Score = 73.6 bits (179),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL   P +  D  D +   LA+L++QG  T  +   W   +GYDSLRA  +D A Y V
Sbjct  26   QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRA-FNDGASYTV  84

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            ++ A   CG T+   + Q IP  +  +++GYT DGPC
Sbjct  85   SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPC  121

>PYIR_26626
Length=212

 Score = 72.4 bits (176),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 2/98 (2%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V+ P P F     +     LA+L+ QG  T+ +  G++ S GY +LRA +DD+  YKV
Sbjct  29   QSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKV  88

Query  91   TEE-ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                A F+CG T+   + Q IP   T +++GYT DGPC
Sbjct  89   DAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPC  125

>PYU1_G001741
Length=199

 Score = 72.0 bits (175),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 52/97 (54%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V+ P P F V     Q   LA+L+ QG  T+ +   +  + GY +LRA +DD+  Y V
Sbjct  28   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               A F+CG T      Q IP   T +++GYT DGPC
Sbjct  88   ASGADFECGWTKLDGTRQSIPAG-TIRSTGYTHDGPC  123

>PYIR_26546
Length=239

 Score = 72.4 bits (176),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 59/98 (60%), Gaps = 1/98 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQ-GVNTSIETQGWMNSHGYDSLRAMLDDEALYK  89
            Q+V+ P P + ++G   Q   +AYL+ Q G + + +  G+++S G+ ++R  +D++ LY+
Sbjct  29   QMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKLYR  88

Query  90   VTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               +A F CG T    E Q IP N   +T+GYT +GPC
Sbjct  89   PVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPC  126

>PYAP_22278
Length=289

 Score = 72.8 bits (177),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 1/98 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V  P P F  +  +     LA+L+ QGV    +  G++ S G  +LR  +D++A YK+
Sbjct  26   QRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKI  85

Query  91   TEE-ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                A F+CG T+P    Q IP N   +++GYT DGPC
Sbjct  86   EARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPC  123

>PYAR_24096
Length=227

 Score = 71.2 bits (173),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 50/97 (52%), Gaps = 0/97 (0%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V  P   + V   +      A L++QG  T+ +   ++ ++ Y +LR  +D    YK 
Sbjct  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               A F+CG T PK   Q IP +  F+TSGYT +GPC
Sbjct  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPC  124

>PYAP_22273
Length=268

 Score = 71.2 bits (173),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 0/75 (0%)

Query  53   AYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPT  112
            A L+ QG  T+ +   +++++GY +LR  +D    YK  + A  +CG T P    Q IPT
Sbjct  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108

Query  113  NSTFQTSGYTMDGPC  127
            N  F+TSGYT +GPC
Sbjct  109  NGEFRTSGYTHEGPC  123

>PHYRA_82864
Length=193

 Score = 69.3 bits (168),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 2/97 (2%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W   +GY +LR  + D A Y V
Sbjct  29   QVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFM-DRAKYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            TE A + CG T P    Q IP  +  +++GYT DGPC
Sbjct  88   TEGADYFCGWTDPNGTPQPIPAGN-MRSTGYTHDGPC  123

>PHALS_00498
Length=199

 Score = 69.3 bits (168),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 1/105 (1%)

Query  23   LKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAML  82
            L  N+   QIVL P P +  +  D +   LA+L+ Q   T+ + Q +   + + +LR  +
Sbjct  21   LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  80

Query  83   DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            D+ A Y V + A   CG T P    Q IP N+  +++GYT DGPC
Sbjct  81   DN-AKYTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPC  124

>PHYSO_341596
Length=231

 Score = 69.3 bits (168),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 1/76 (1%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            LA+L+ QG  T  +   W + +GY SLR  +D +A Y VT  A F CG T PK   Q IP
Sbjct  42   LAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTVTSGADFSCGFTDPKGTPQPIP  100

Query  112  TNSTFQTSGYTMDGPC  127
                 +++GYT DGPC
Sbjct  101  AGDAMRSTGYTHDGPC  116

>PHYKE_7718
Length=220

 Score = 68.9 bits (167),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 51/97 (53%), Gaps = 1/97 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  D  D +   LA+L+ +G     +   W   +GY SLR  +D+ A Y V
Sbjct  33   QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYSV  91

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T  A   CG T P    Q IP  +  +++GYT DGPC
Sbjct  92   TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPC  128

>PYVX_18174
Length=204

 Score = 68.9 bits (167),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 3/97 (3%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V+ P P +     D     LA+L++QG  T  +   W  S+GY +LRA + D+A Y V
Sbjct  29   QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFM-DQASYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T+ A   CG T      Q IP N  F+++GYT DGPC
Sbjct  88   TDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPC  122

>PHALS_03284
Length=188

 Score = 67.8 bits (164),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 1/105 (1%)

Query  23   LKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAML  82
            L  N+   QI+L P P +  +  D +   LA+L+ Q   TS +  G++  + Y+SLR  L
Sbjct  7    LAPNVIAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFL  66

Query  83   DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               A Y VTE A  DCG T P    Q IP  +  + +GYT DG C
Sbjct  67   K-RANYTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLC  110

>PHYSO_284086
Length=204

 Score = 68.2 bits (165),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 52/97 (54%), Gaps = 2/97 (2%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D    +   LA+L+ QG  T  +   W    GY +LRA +D  A Y V
Sbjct  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-ASYTV  87

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             + A + CG T  K   Q IP + T +++GYT DGPC
Sbjct  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPC  123

>PYAP_22279
Length=223

 Score = 68.6 bits (166),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q +  P P    D  +     LA+L+ QGV  + +  G++   G  +LR  +D++A YKV
Sbjct  23   QRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKV  81

Query  91   TEE-ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                A F+CG T P    Q IP+N   +++GYT DGPC
Sbjct  82   EAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPC  119

>PHYSO_246676
Length=187

 Score = 67.0 bits (162),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 51/95 (54%), Gaps = 1/95 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  +    +   LA+L+ QG  T  +   W   +GY +LR  +D +A Y V
Sbjct  12   QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMD-KAKYDV  70

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDG  125
            T  A F CG T PK   Q IP  +  +++GYT DG
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG  105

>PHYSO_343376
Length=172

 Score = 66.2 bits (160),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 4/109 (4%)

Query  22   RLKANLGEGQIVLQPPPF---FIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
            R +A+L   +  L+  P    +  +  + +   LA+L+ QG  T  + + W   +GY +L
Sbjct  15   RKQASLAAVRAALRGRPVAAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTL  74

Query  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            R  +D    Y VT+ A F CG T PK   Q IP     +++GYT DGPC
Sbjct  75   RDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPC  122

>PYVX_18176
Length=201

 Score = 65.1 bits (157),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 2/97 (2%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V+ P P +  D  D     LA+L++QG +T  +   W + +GYDSLRA + D A Y V
Sbjct  26   QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFM-DGASYTV  84

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            T+ A   CG T+     Q +P +   +++GYT  GPC
Sbjct  85   TDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPC  120

>PYIW_18792
Length=125

 Score = 62.4 bits (150),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V  P P + V     Q   LA+L+ QG   + +   +  S GY +LR  +DD+  YKV
Sbjct  25   QYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKV  84

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGP  126
             +   F+CG +S K   Q IP     +++GYT DGP
Sbjct  85   -DGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGP  119

>PPTG_14254
Length=188

 Score = 60.8 bits (146),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            L++L+++G  T      +   +GY SLR  +D  A YKVTE A   CG T PK   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTDPKGIPQKIP  108

Query  112  TNSTFQTSGYTMDGPC  127
             + T +T+GYT DGPC
Sbjct  109  EDGTMRTTGYTHDGPC  124

>PITG_18450
Length=203

 Score = 60.1 bits (144),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 5/97 (5%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q+VL P P +  D  D +   L +L+ QG  T  +  GW  ++GY +LR  ++    Y V
Sbjct  29   QVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             + A + CG T+     Q  P +   +++GYT DGPC
Sbjct  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPC  120

>PPTG_08820
Length=250

 Score = 60.5 bits (145),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 56/113 (50%), Gaps = 5/113 (4%)

Query  19   GQRRLKANLGEGQIVLQPPPFFI--VDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYD  76
            G   L   +   Q++L+P P +   ++  D +   LA+L+ QG     +  GW    GY 
Sbjct  17   GSALLTLTVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYK  76

Query  77   SLRAMLDDEALY--KVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            +LR  +D  A Y   VT  A   CGLT  K   + IP +   +++GYT DGPC
Sbjct  77   NLRDFMD-RAKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPC  128

>PHYCA_510817
Length=188

 Score = 58.2 bits (139),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 1/76 (1%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            L++L+++G  T      +   +GY SLR  ++ +A YKV++ A   CG + PK   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSDPKGIPQQIP  108

Query  112  TNSTFQTSGYTMDGPC  127
            ++ T +TSGYT DGPC
Sbjct  109  SDGTMRTSGYTHDGPC  124

>PHYSO_417649
Length=185

 Score = 57.8 bits (138),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            L++L+++G  T      +   +GY SLR  ++  A YK+T+ A   CG T PK   Q IP
Sbjct  48   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTDPKGIPQQIP  106

Query  112  TNSTFQTSGYTMDGPC  127
             + T +TSGYT DGPC
Sbjct  107  EDGTMRTSGYTHDGPC  122

>PPTG_14255
Length=268

 Score = 58.5 bits (140),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            L++L+++G  T      +   +GY SLR  +D+ A Y VT+ A   CG T PK   Q IP
Sbjct  49   LSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQIP  107

Query  112  TNSTFQTSGYTMDGPC  127
             + T +TSGYT DGPC
Sbjct  108  EDGTMRTSGYTHDGPC  123

>PHYKE_9185
Length=281

 Score = 58.2 bits (139),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            L++L+++G+ T      +   + Y SLR  +D +A YKV++ A   CG T PK   Q IP
Sbjct  52   LSFLEKEGIKTQENFTQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTDPKGIPQQIP  110

Query  112  TNSTFQTSGYTMDGPC  127
             + T +TSGYT DGPC
Sbjct  111  EDGTMRTSGYTHDGPC  126

>PITG_10499
Length=323

 Score = 57.0 bits (136),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query  35   QPPPFFI--VDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDD-EALYKVT  91
            QP P +   ++  D +   LA+L+ QG     +  GW   +GY  LR  +D  + +  VT
Sbjct  3    QPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVT  62

Query  92   EEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              A   CGLT  K   + IP +   +++GYT DGPC
Sbjct  63   PGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPC  98

>PHYCA_14368
Length=219

 Score = 55.8 bits (133),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  +  D +   LA+L+ QG  T  +   W   + Y SLR  +D+ A Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDN-AKYTV  87

Query  91   TEEALFDCGLTSPK  104
            T+ A F CG T PK
Sbjct  88   TDGADFSCGFTDPK  101

>PHYSO_527908
Length=174

 Score = 54.7 bits (130),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            LA+L+ QG  T      +M  +GY SLR  +D+   Y VT+ A   CG T P    Q IP
Sbjct  49   LAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDN-GNYSVTKGADQACGWTDPNGIPQQIP  107

Query  112  TNSTFQTSGYTMDGPC  127
             + T +TSG+T D PC
Sbjct  108  EDGTMRTSGFTHDDPC  123

>PHYCA_536934
Length=983

 Score = 54.7 bits (130),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 1/76 (1%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            L++L+++G  T      +   +GY +LR  +D+ A Y VT+ A   CG + P    Q IP
Sbjct  66   LSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDN-AKYAVTDGADQACGWSDPNGIPQQIP  124

Query  112  TNSTFQTSGYTMDGPC  127
             + T +TSGYT DGPC
Sbjct  125  EDGTMRTSGYTHDGPC  140

>PHYRA_87941
Length=157

 Score = 52.4 bits (124),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (54%), Gaps = 3/89 (3%)

Query  38   PFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFD  97
            P   VD +  Q + L++L+++G  T      +   +GY SLR  LD +A YKV++ A   
Sbjct  4    PVTNVDAI--QLVILSFLEKEGFETQENFMQFQVDNGYTSLRDFLD-KAKYKVSDGADQA  60

Query  98   CGLTSPKTETQLIPTNSTFQTSGYTMDGP  126
            CG + PK   Q IP + T   SGYT D P
Sbjct  61   CGWSDPKGIPQQIPEDGTMSPSGYTHDAP  89

>PHYRA_86151
Length=170

 Score = 52.4 bits (124),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (54%), Gaps = 3/89 (3%)

Query  38   PFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFD  97
            P   VD +  Q + L++L+++G  T      +   +GY SLR  LD +A YKV++ A   
Sbjct  17   PVTNVDAI--QLVILSFLEKEGFETQENFMQFQVDNGYTSLRDFLD-KAKYKVSDGADQA  73

Query  98   CGLTSPKTETQLIPTNSTFQTSGYTMDGP  126
            CG + PK   Q IP + T   SGYT D P
Sbjct  74   CGWSDPKGIPQQIPEDGTMSPSGYTHDAP  102

>PHYSO_262732
Length=188

 Score = 52.4 bits (124),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 40/76 (53%), Gaps = 15/76 (20%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            LA+L+ QG  T               LR  +D+ A Y VTE A   CG T PK   Q IP
Sbjct  49   LAFLENQGFQTH--------------LRDFMDN-AKYTVTEGADQACGWTDPKGIAQQIP  93

Query  112  TNSTFQTSGYTMDGPC  127
            ++ T +TSGYT DGPC
Sbjct  94   SDGTMRTSGYTHDGPC  109

>PHYSO_254168
Length=170

 Score = 51.2 bits (121),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 6/86 (7%)

Query  42   VDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLT  101
            V+  D +   LA+L+ QG  T          +GY +LR  +D    Y VT+ A + CG T
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMD-RGKYTVTQGADYFCGWT  86

Query  102  SPKTETQLIPTNSTFQTSGYTMDGPC  127
            +PK   Q IP     +++GYT DGPC
Sbjct  87   NPKGTPQPIP-----RSTGYTHDGPC  107

>PYIW_18790
Length=86

 Score = 49.3 bits (116),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            + VL P P + V     Q   LA+L+ QG  T+ + + +    GY +LR  +DD+  YKV
Sbjct  3    RYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKV  62

Query  91   TEEALFDCGLTSPKTETQLIP  111
             +   F+CG ++ K   Q IP
Sbjct  63   -DGGDFECGWSTLKGTPQPIP  82

>PHYSO_340369
Length=200

 Score = 46.2 bits (108),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 41/78 (53%), Gaps = 15/78 (19%)

Query  50   MALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQL  109
            M LAY ++QG NTS     W  ++G+ +LR  +D+            +  +TSP    Q 
Sbjct  50   MPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNG-----------NYSVTSP----QQ  94

Query  110  IPTNSTFQTSGYTMDGPC  127
            IP ++  +T GYT DGPC
Sbjct  95   IPDDNIMRTYGYTRDGPC  112

>PITG_19818
Length=147

 Score = 42.4 bits (98),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 31/59 (53%), Gaps = 0/59 (0%)

Query  31  QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYK  89
           QIVL P P +     D +   LA+L+ QG     + + W + +GY SLR  +D   L++
Sbjct  27  QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFR  85

>PYAP_18131
Length=226

 Score = 42.4 bits (98),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query  82   LDDEALYKVTEE-ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPCW  128
            +DD+A YKV    A F+CG T P    Q IP N   +++G+T DG  W
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDGHVW  48

>PYVX_18179
Length=147

 Score = 41.6 bits (96),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 31/53 (58%), Gaps = 0/53 (0%)

Query  31  QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLD  83
           Q V+ P P +  +  D     LA+L++QG  T  +   W +++GYD+LRA +D
Sbjct  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81

>PHYSO_342364
Length=194

 Score = 38.9 bits (89),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN-STFQTSGYTMDGPC  127
            SH Y  LR +LD+ A+Y        +CG T+P    Q IPTN     + G    GPC
Sbjct  72   SHNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTGPC  122

>PHYKE_8104
Length=86

 Score = 37.4 bits (85),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  31  QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDD  84
           QIVL P P +  +  D +   LA+L+ +G     + + W   +GY SLR  +D+
Sbjct  29  QIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDN  82

>PYVX_18175
Length=147

 Score = 37.7 bits (86),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  31  QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLD  83
           Q V+ P P +     D     LA+L+ QG  T  +   W  ++GY +LR+ +D
Sbjct  29  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81

>PYVX_16138
Length=559

 Score = 37.7 bits (86),  Expect = 0.009, Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 28/55 (51%), Gaps = 7/55 (13%)

Query  74   GYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTS-GYTMDGPC  127
            G   +R++LDD ++Y        DCG T P    Q IPT+ST   S G    GPC
Sbjct  75   GVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVGPC  123

>PYIW_21964
Length=265

 Score = 37.0 bits (84),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 9/82 (11%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            +++  +   NT   T   + +  Y S+RA++DD+A++   +EA  +CG+TSP    Q +P
Sbjct  60   MSFTGDPASNTKAFTAA-LKASTYKSMRALVDDKAVF--IKEANKECGVTSPTGAKQPLP  116

Query  112  TN----STFQTSGYTMD--GPC  127
                  S   + G+T    GPC
Sbjct  117  DKYVEWSHSSSEGFTPSHQGPC  138

>PHYKE_9024
Length=299

 Score = 34.3 bits (77),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 29/57 (51%), Gaps = 3/57 (5%)

Query  72   SHGYDSLRAMLD-DEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            S GYDSL A +  ++ LY    +A  DCGLT  K   +     S    SG+T  GPC
Sbjct  76   SKGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPASKLTYSGFTHTGPC  130

>PHYSO_533903
Length=208

 Score = 34.3 bits (77),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN-STFQTSGYTMDGPC  127
            ++ +  L+ MLDD +LY        DCG T P    Q IPT+     + G    GPC
Sbjct  73   ANNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPC  123

>PYVX_14662
Length=540

 Score = 34.3 bits (77),  Expect = 0.14, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 29/56 (52%), Gaps = 9/56 (16%)

Query  74   GYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            G   +R++LDD ++Y        DCG T P    Q IPT+  +TF + G    GPC
Sbjct  75   GVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTDGKATF-SRGMVHVGPC  123

>PHYSO_533747
Length=206

 Score = 33.9 bits (76),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN-STFQTSGYTMDGPC  127
            ++ +  L+ MLDD +LY        DCG T P    Q IPT+     + G    GPC
Sbjct  73   ANNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPC  123

>PPTG_03153
Length=314

 Score = 33.5 bits (75),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 32/61 (52%), Gaps = 6/61 (10%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTF---QTSGYTM--DGP  126
            S  Y SL+A++DD+A   +   A   CG+  PK   Q +P    +   ++ G+T   +GP
Sbjct  72   SSKYKSLKAVIDDKAKI-IVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHEGP  130

Query  127  C  127
            C
Sbjct  131  C  131

>PITG_08202
Length=191

 Score = 32.7 bits (73),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (52%), Gaps = 9/58 (16%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  LR ++DD ++Y        DCG T+P    Q IP++  +TF +      GPC
Sbjct  73   ANNFKDLRTLMDDTSVYGA------DCGFTNPNDTPQPIPSDGKATF-SRALVHHGPC  123

>PHYRA_73606
Length=366

 Score = 32.0 bits (71),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 37/69 (54%), Gaps = 11/69 (16%)

Query  62   TSIETQGWMNSHGYDSLRAMLD-DEALYKVTEEALFDCGLTSPKTETQLIPT--NSTFQT  118
            TS+ T G  +S+GY  +R +LD D +LY        DCG T+P    +  PT  ++TF +
Sbjct  66   TSVYT-GLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATF-S  117

Query  119  SGYTMDGPC  127
             G    GPC
Sbjct  118  RGMVHVGPC  126

>PPTG_14221
Length=275

 Score = 31.6 bits (70),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (52%), Gaps = 9/58 (16%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  L+ ++DD ++Y        DCG T+P    Q IPT+  +TF +      GPC
Sbjct  72   ANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATF-SRALVHHGPC  122

>PHYCA_15125
Length=334

 Score = 31.6 bits (70),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 29/57 (51%), Gaps = 3/57 (5%)

Query  72   SHGYDSLRAML-DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            + GYDSL A +  ++ LY    +   DCGLT  K   +     S  + SG+T  GPC
Sbjct  113  TKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASELEYSGFTHTGPC  167

>PITG_11944
Length=302

 Score = 31.6 bits (70),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 41/94 (44%), Gaps = 10/94 (11%)

Query  41   IVDGLDF----QGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTE---E  93
            ++DG D+    +GM+     E             N+  Y SL+ + D   + +      +
Sbjct  45   LIDGQDYLPVPKGMSYGGTPESNTEAYWTA---FNASKYTSLKDLADKTMVLQSLSPFGK  101

Query  94   ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            A  +CG ++PK   + +P    ++  GY+  GPC
Sbjct  102  ATKECGFSTPKGTKRNLPAKVQWKDFGYSHQGPC  135

>PYU1_G000219
Length=415

 Score = 31.6 bits (70),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 26/57 (46%), Gaps = 3/57 (5%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLT---SPKTETQLIPTNSTFQTSGYTMDG  125
            SH   SLRA LDDE   ++T +   +  +    SP+ + Q   TN   +      +G
Sbjct  133  SHELQSLRAKLDDEEQLRITTQKQLEAAIAAAKSPQQQDQETQTNDLKEKDAVKKEG  189

>PPTG_20376
Length=186

 Score = 31.2 bits (69),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (52%), Gaps = 9/58 (16%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF  +   + GPC
Sbjct  72   ANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHV-GPC  122

>PHYCA_112615
Length=196

 Score = 31.2 bits (69),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 9/58 (16%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  L+ ++DD ++Y        DCG T P  + Q IP++  +TF  +   + GPC
Sbjct  72   ANNFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHV-GPC  122

>PHYCA_19612
Length=610

 Score = 31.2 bits (69),  Expect = 1.5, Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 35/73 (48%), Gaps = 8/73 (11%)

Query  61   NTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN----STF  116
            NT+  T  +  S  Y SL+ +++D+A   VT +A   CG   P    Q +P      +  
Sbjct  370  NTAAFTTAF-ESSSYSSLKELINDKATITVT-DATLTCGACDPDETAQALPATYVEWAHS  427

Query  117  QTSGYTM--DGPC  127
             + G+T   +GPC
Sbjct  428  DSEGFTASHEGPC  440

>PHYRA_78161
Length=373

 Score = 31.2 bits (69),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN----STFQTSGYTM--DG  125
            S  Y SL+  ++D+A   VT  A   CG   PK E Q +P +    S   + G+T   +G
Sbjct  73   SSKYSSLKEFINDKATVTVTG-ATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEG  131

Query  126  PC  127
            PC
Sbjct  132  PC  133

>PYIW_19151
Length=248

 Score = 30.8 bits (68),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 39/99 (39%), Gaps = 26/99 (26%)

Query  30   GQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYK  89
            G  V++ PP +  D  D +  A A  ++                G+ +LR+ L+D+    
Sbjct  41   GTFVIEYPPPWTGDWKDPKNFAAAAKEK----------------GFSTLRSYLEDKGAV-  83

Query  90   VTEEALFDCGLTSPKTETQLIPTNSTFQTS-GYTMDGPC  127
                    CG T PK   + IP + T + S      GPC
Sbjct  84   --------CGFTDPKVSPRAIPADRTIRFSRDIPHPGPC  114

>PHYCA_534296
Length=309

 Score = 30.8 bits (68),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 37/68 (54%), Gaps = 10/68 (15%)

Query  63   SIET-QGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTS  119
            S+ET +   +++ +  L+ ++DD ++Y        DCG T+P    Q IPT+  +TF  +
Sbjct  36   SVETFKSLKSANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRA  89

Query  120  GYTMDGPC  127
               + GPC
Sbjct  90   LVHV-GPC  96

>PHYSO_340333
Length=284

 Score = 30.4 bits (67),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (52%), Gaps = 9/58 (16%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF  +   + GPC
Sbjct  72   ANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHV-GPC  122

>PHYSO_533682
Length=278

 Score = 30.4 bits (67),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (51%), Gaps = 9/57 (16%)

Query  73   HGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            + +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF + G    GPC
Sbjct  73   NNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATF-SRGLIHVGPC  122

>PYU1_G013346
Length=85

 Score = 29.3 bits (64),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 0/32 (0%)

Query  96   FDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             +CG T P    Q+IP    ++ S +   GPC
Sbjct  52   LECGFTDPNGPPQMIPDQIAWRGSTFQHSGPC  83

>PHYSO_340332
Length=295

 Score = 30.4 bits (67),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (52%), Gaps = 9/58 (16%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF  +   + GPC
Sbjct  72   ANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHV-GPC  122

>PHYCA_127270
Length=279

 Score = 30.4 bits (67),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 9/58 (16%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF +      GPC
Sbjct  72   ANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATF-SRALVHVGPC  122

>PPTG_06253
Length=303

 Score = 30.0 bits (66),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (51%), Gaps = 3/57 (5%)

Query  72   SHGYDSLRAML-DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            + GYDSL A +  ++ LY    +   DCGLT  K   +     S  + +G+T  GPC
Sbjct  76   TKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASQLEYTGFTHTGPC  130

>PHYRA_80631
Length=320

 Score = 30.0 bits (66),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query  74   GYDSLRAML-DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            GYDSL A +  ++ LY    +   DCGLT  K   +     S    SG+T  GPC
Sbjct  78   GYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASKLTYSGFTHTGPC  130

>PHYSO_521210
Length=168

 Score = 30.0 bits (66),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 3/32 (9%)

Query  34  LQPPPFFIVDGLDFQGMALAYLQEQGVNTSIE  65
           ++PPPFF V+     G+   YL + G+N+SIE
Sbjct  6   VEPPPFFSVNAALAAGL---YLVDVGLNSSIE  34

>PHYRA_78689
Length=296

 Score = 30.0 bits (66),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (52%), Gaps = 9/58 (16%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF  +   + GPC
Sbjct  72   ANNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHV-GPC  122

>PITG_19714
Length=515

 Score = 30.0 bits (66),  Expect = 4.3, Method: Composition-based stats.
 Identities = 19/68 (28%), Positives = 31/68 (46%), Gaps = 4/68 (6%)

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            LA++ +  +  S ++  WM      S +    D  L    EE   D G  S K +  ++P
Sbjct  20   LAFIADFEMEDSHDSDDWMEDDASMSGQGKTQDTQL----EELFVDSGTNSNKPDKVVVP  75

Query  112  TNSTFQTS  119
            +N+T  TS
Sbjct  76   SNATVATS  83

>PHYSO_483955
Length=320

 Score = 30.0 bits (66),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTS-GYTMDGPC  127
            ++ Y  +R+++D   +Y        DCG T PK +    PT+ T   S G    GPC
Sbjct  73   ANNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPC  123

>PPTG_04622
Length=273

 Score = 29.6 bits (65),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (51%), Gaps = 10/59 (17%)

Query  72   SHGYDSLRAMLD-DEALYKVTEEALFDCGLTSPKTETQLIPT--NSTFQTSGYTMDGPC  127
            S+GY  +RA+LD D  LY        +CG T P    +  PT  ++TF + G    GPC
Sbjct  75   SNGYSDIRALLDSDTDLYGA------NCGFTDPDATPKDPPTTGDATF-SRGMVHAGPC  126

>PHYSO_438103
Length=238

 Score = 29.6 bits (65),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 30/59 (51%), Gaps = 9/59 (15%)

Query  71   NSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            +++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF +      GPC
Sbjct  70   SANNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATF-SRALVHVGPC  121

>PYAP_15000
Length=465

 Score = 29.6 bits (65),  Expect = 5.4, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%)

Query  89   KVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPCWKK  130
            +++  + F  G+ SPKT     P N    T+G T  GP + K
Sbjct  114  RISAASGFSVGVGSPKTAATASPINLANTTAGSTARGPSFAK  155

>PITG_05271
Length=278

 Score = 29.3 bits (64),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 9/58 (16%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  L+ ++DD ++Y        DCG T P  + Q IP +  +TF +      GPC
Sbjct  72   ANKFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATF-SRALVHVGPC  122

>PHYSO_524101
Length=308

 Score = 29.3 bits (64),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 31/64 (48%), Gaps = 7/64 (11%)

Query  70   MNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN----STFQTSGYTM--  123
              S  Y SL+ +++D+A   VT +A   CG+  P    Q +P      +   + G+T   
Sbjct  73   FESSSYSSLKELINDKATITVT-DATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTASH  131

Query  124  DGPC  127
            +GPC
Sbjct  132  EGPC  135

>PHYRA_78176
Length=312

 Score = 29.3 bits (64),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 7/64 (11%)

Query  70   MNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN----STFQTSGYTM--  123
              S  Y SL+  +DD+A   VT+  L  CG   P    Q +P      +   + G+T   
Sbjct  74   FESSSYSSLKEFIDDKATITVTDATL-TCGACDPDETAQPLPETYVEWAHSDSEGFTASH  132

Query  124  DGPC  127
            +GPC
Sbjct  133  EGPC  136

>PHYCA_10471
Length=309

 Score = 29.3 bits (64),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 40/94 (43%), Gaps = 9/94 (10%)

Query  41   IVDGLDF----QGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTE---E  93
            ++DG D+     GM+     E   NT      +  S  Y SL+ + D   + +      +
Sbjct  44   LIDGQDYLPVPDGMSYGGTPEG--NTEAYWTAFNASKKYSSLKDLADKTMVLQSLSPFGK  101

Query  94   ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            A  +CG + P    + +P    ++  GY+  GPC
Sbjct  102  ATKECGFSLPNGTARALPAKVQWKDFGYSHQGPC  135

>PYU1_G001527
Length=278

 Score = 28.9 bits (63),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 32/61 (52%), Gaps = 12/61 (20%)

Query  75   YDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP--------TNSTFQTSGYTMDGP  126
            Y S+RA++D + +++       +CG+TSP  E Q +P        +NS   T  +T  GP
Sbjct  83   YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--GP  138

Query  127  C  127
            C
Sbjct  139  C  139

>PYU1_G001523
Length=278

 Score = 28.9 bits (63),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 32/61 (52%), Gaps = 12/61 (20%)

Query  75   YDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP--------TNSTFQTSGYTMDGP  126
            Y S+RA++D + +++       +CG+TSP  E Q +P        +NS   T  +T  GP
Sbjct  83   YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--GP  138

Query  127  C  127
            C
Sbjct  139  C  139

>H310_05643
Length=1316

 Score = 29.3 bits (64),  Expect = 8.1, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query  41   IVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGL  100
            +V G      A+ YL     + S+ +  +++  G DS    +DD A YK T  A+   GL
Sbjct  269  LVRGASATHRAMFYL----TDASVHSFHYLHQSGCDSRTDGVDDAAQYKRTLHAMTTIGL  324

Query  101  TSPKTETQLI  110
            T P+ +T ++
Sbjct  325  T-PQEQTNVL  333

>PHYKE_6001
Length=289

 Score = 28.9 bits (63),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 26/57 (46%), Gaps = 7/57 (12%)

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMD-GPC  127
            ++ Y  L+ ++DD ++Y        DCG T P    Q IP++     S      GPC
Sbjct  72   ANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPC  122

>PYVX_22510
Length=596

 Score = 29.3 bits (64),  Expect = 8.2, Method: Composition-based stats.
 Identities = 22/85 (26%), Positives = 35/85 (41%), Gaps = 7/85 (8%)

Query  49   GMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQ  108
            G +  +  +   NT+  T  + +S  Y SL+ M+        T      CGLT P    Q
Sbjct  299  GFSGTFNSDPATNTASFTTAFASS-SYSSLKEMVTSLGQLISTSGVTITCGLTDPDETAQ  357

Query  109  LIPTN----STFQTSGYTM--DGPC  127
             +P      +   + G+T   +GPC
Sbjct  358  ALPDTYVEWAHSDSEGFTASHEGPC  382

>PHYCA_123316
Length=316

 Score = 28.9 bits (63),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 29/63 (46%), Gaps = 6/63 (10%)

Query  70   MNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN---STFQTSGYTM--D  124
             NS  Y S++  + D+    V   A  +CGLT P    Q +P     +   T G+T   +
Sbjct  73   FNSSKYSSIKDFVTDKGQI-VANGATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHE  131

Query  125  GPC  127
            GPC
Sbjct  132  GPC  134

>PYU1_G001526
Length=334

 Score = 28.9 bits (63),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 32/61 (52%), Gaps = 12/61 (20%)

Query  75   YDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP--------TNSTFQTSGYTMDGP  126
            Y S+RA++D + +++       +CG+TSP  E Q +P        +NS   T  +T  GP
Sbjct  83   YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--GP  138

Query  127  C  127
            C
Sbjct  139  C  139

>PYIW_27477
Length=180

 Score = 28.9 bits (63),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 10/55 (18%)

Query  74   GYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTS-GYTMDGPC  127
            G+++LR+ ++D+            CG T P  + + IP+++  + S      GPC
Sbjct  49   GFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSRAIVHPGPC  94

>PYIR_16443
Length=275

 Score = 28.9 bits (63),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 15/56 (27%), Positives = 27/56 (48%), Gaps = 10/56 (18%)

Query  73   HGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTS-GYTMDGPC  127
             G+++LR+ ++D+            CG T+P    + IP++S  + S      GPC
Sbjct  71   KGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPC  117

>PHYCA_527245
Length=339

 Score = 28.9 bits (63),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 22/41 (54%), Gaps = 1/41 (2%)

Query  81   MLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGY  121
            M   E LY V +   F  G+  P +ET  +P++ST   +GY
Sbjct  1    MFAAEILYGVADSFAFALGVL-PASETNTLPSSSTAAPTGY  40

>PITG_08895
Length=196

 Score = 28.5 bits (62),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query  72   SHGYDSLRAML-DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            + GY SL A +  ++ LY    +   DCGLT  K   +     S  + +G+T  GPC
Sbjct  76   TKGYKSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASQLEHTGFTHTGPC  130

>SPRG_10799
Length=616

 Score = 28.9 bits (63),  Expect = 9.7, Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%)

Query  64   IETQGWMNSHGYDSLRAMLD  83
            I T GW+ S GYD L ++LD
Sbjct  351  INTDGWIKSMGYDLLHSILD  370

>PYIR_16435
Length=304

 Score = 28.9 bits (63),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 27/56 (48%), Gaps = 10/56 (18%)

Query  73   HGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTS-GYTMDGPC  127
             GY +LR+ ++D+            CG T+P    + IP+++T + S      GPC
Sbjct  74   KGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIVHPGPC  120

Lambda      K        H        a         alpha
   0.317    0.134    0.410    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3336362976

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40