Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_8389147522041828911e-122
PHYRA_81106147522021807885e-107
PHYCA_129425147522041827513e-101
PPTG_17122147522041817452e-100
PHYSO_284086147522041827295e-98
PHYCA_511409568762041817052e-94
PPTG_17121568762021816966e-93
PHYRA_81107568762021816949e-93
PHYSO_477820568762021816843e-91
PITG_18450147522031816766e-90
PHYKE_8388568762051806741e-89
PHYCA_14369109792481676591e-86
PHYSO_341599109791851736443e-85
PYVX_18174854042041816393e-84
PPTG_10635528561991726366e-84
PHYCA_102852242061951716358e-84
PHYRA_85631109792281826388e-84
PYVX_18176568762011806351e-83
PHYKE_3446231281991656332e-83
PPTG_10636109792461676363e-83
PPTG_10634720132081636323e-83
PPTG_15264231281941736281e-82
PPTG_17366239131941736281e-82
PHYRA_84190720132061676193e-81
PHYSO_536424606911971706183e-81
PHYSO_507031586531971706183e-81
PHYRA_82864231281931686174e-81
PHYKE_7718109792201666179e-81
PHYCA_102624720131951716123e-80
PHYCA_102550457052681676098e-79
PPTG_10643457052501805955e-77
PHALS_00498109791991655793e-75
PYU1_G001741854041991715621e-72
PPTG_10048213141901655523e-71
PYIR_25089854042621675428e-69
PYU1_G001742932042131835265e-67
PYVX_18173449665001645419e-66
PYU1_G001744568762131835083e-64
PHALS_03284309411881655036e-64
PHYSO_499978231281741425011e-63
PHYSO_501575820771741425011e-63
PYU1_G001740147522061645012e-63
PYIR_26626147522121725005e-63
PHYSO_343376532371721164802e-60
PHYSO_254168462841701474756e-60
PPTG_0882086622501714784e-59
PITG_13520109791711324619e-58
PPTG_14255469372681374639e-57
PITG_1049986623231434671e-56
PYU1_G001739932032661664602e-56
PHYCA_510817445761881374516e-56
PPTG_14254445761881374448e-55
PHYSO_341596528562311264425e-54
PHYSO_417649445761851374385e-54
PYAP_22273932032681654351e-52
PHYKE_9185445762811684343e-52
PYAR_24096932032271654277e-52
PHYCA_53693413059831374572e-51
PYAP_22279854042231494233e-51
PYAP_22278932042891744222e-50
PHYSO_262732469371881674108e-50
PYIW_18791854041941664073e-49
PHYCA_14368528562191674093e-49
PYIR_26546866052391673973e-47
PHYSO_527908600641741543715e-44
PHYSO_353401534611461423642e-43
PHYSO_246676457051871773672e-43
PHYCA_537323449662001423666e-43
PPTG_17123147532011423657e-43
PYU1_G001738534612261383591e-41
PHYRA_81105534612011423553e-41
PITG_18452147538561393725e-40
HYAP_07096534612511603429e-39
PHYSO_340369526762001373335e-38
PYIW_18788932032441403044e-33
PYAP_18131991722261152912e-31
PYU1_G007476539131951392743e-29
PYIR_1643542333041272726e-28
PPTG_04622696962731372681e-27
PYVX_18179534611471792591e-27
PHYRA_74651699693441332712e-27
PHYSO_342364529831941392612e-27
PHYRA_73607194343431362599e-26
PYAP_246891014392521432531e-25
PHYRA_7868968382961372525e-25
PYIW_19151831912481312487e-25
PHYRA_7358442332871362508e-25
PITG_0494842342321362461e-24
PYIW_18792932041251012372e-24
PPTG_0461842353261362492e-24
PYIR_1644442341821242412e-24
PHYCA_531163194343141362483e-24
PHYKE_10578778802391612433e-24
PHYSO_484051571982851332463e-24
PHYCA_12727044782791372444e-24
PHYCA_13036542352661332444e-24
PITG_0494942353371362475e-24
PYAP_18711943562101362396e-24
PHYSO_48395542353201362456e-24
PYU1_G005324845341911372378e-24
PYU1_G005326463491911372378e-24
PYU1_G00532842331911372378e-24
PPTG_04647194343271372458e-24
PYIR_16443823992751252411e-23
PPTG_0461942342761362411e-23
PHYSO_48552442342781462411e-23
PHYRA_7358242353261482431e-23
PHYRA_73606571983661342423e-23
PHALS_0317644782071462343e-23
PHYSO_438103557212381362363e-23
PHYCA_534473423310501362464e-23
PHYRA_7358342346301362446e-23
PHYSO_533903604652081392326e-23
PHYCA_12942213313531382406e-23
PHYKE_2937571983661362407e-23
PHYSO_340333526712841362351e-22
PHYSO_34033244782951362361e-22
PYU1_G01469042342951282351e-22
PYVX_1817514752147622261e-22
PHALS_0539242353671362372e-22
PYVX_14662510865401412402e-22
PPTG_1422144782751372332e-22
PHYKE_600144782891412342e-22
PYAP_18709943552351322302e-22
PYU1_G005325943562071312282e-22
PYU1_G007364851643161382333e-22
PHYSO_533682604462781362313e-22
PHYRA_78626578954731372373e-22
CCI4738117292111312274e-22
PHYRA_78625541464341372364e-22
PYIW_27477823991801172254e-22
PHYKE_771752856568462366e-22
PITG_0527144782781402296e-22
PHYKE_391342343211042301e-21
PHYSO_459106194342231362251e-21
PHYRA_85794726192301312251e-21
PHYRA_77971705552301312251e-21
PYIR_19612831912601382262e-21
PPTG_0462042333421342292e-21
PHYCA_69583463492241212232e-21
PHYCA_534296526713091362272e-21
PYAR_14260845342121372213e-21
H310_0636217301971262203e-21
PHYKE_2809752822911342254e-21
PHYKE_6002526711971262194e-21
PHALS_03177526712591372226e-21
PHYRA_8615172836170742151e-20
PITG_0494742332981332221e-20
PHYRA_8794174106157742131e-20
PHYRA_83494464352241242171e-20
H257_1355017302661302191e-20
PHALS_03179308833721412232e-20
PYIR_23585845342401272172e-20
SDRG_165351259803131422202e-20
PHYRA_86016727462361242153e-20
PYAR_14256943551991362134e-20
PPTG_07509718142991472175e-20
PPTG_0750738072991472176e-20
CCA1717917291851312116e-20
PYU1_G005985820772001462118e-20
PHYRA_86752732363001242168e-20
PYU1_G005323943552511322138e-20
SPRG_19916161733051452169e-20
PYAR_206171040482541312131e-19
PHYRA_7914038074241352172e-19
PHYCA_97965401872881432132e-19
SPRG_2216117303001542132e-19
PHYCA_12943369712871452122e-19
PHYSO_255056463492691002112e-19
PHYRA_83500718143941352127e-19
PHALS_0539442342881452097e-19
PYIR_24743851643571382117e-19
PYU1_G005871944962841352081e-18
PYU1_G005872161732971352081e-18
PHYSO_26284417292761272071e-18
PYIR_2048117292771382061e-18
PYAP_18221944962261452041e-18
PHYSO_533747604512061322021e-18
SPRG_077961259803221422081e-18
SDRG_081291363312181492032e-18
PYU1_G00586817292671272052e-18
SDRG_075651244122781582052e-18
PYVX_16138786195591332093e-18
PYIW_254631650392161442013e-18
PHALS_04411944962621362033e-18
PYU1_G005873510322141422003e-18
SPRG_199171339462411372024e-18
PITG_1193697753331322054e-18
PHYRA_83499204334731242075e-18
PHYRA_7358169693293912035e-18
PYVX_20783375052761342026e-18
PYAP_222571003612471312006e-18
PYAP_1871342341841261951e-17
SDRG_173181339462411371981e-17
PHYRA_8075044782751302001e-17
SDRG_081371363342821491991e-17
PHYRA_86751732351631021931e-17
PHYCA_98479819502761101991e-17
PHYCA_1865738072951141992e-17
SDRG_17317161731221101892e-17
PYIW_1552617302561341972e-17
PHYRA_86241728921951041932e-17
PPTG_04617696934961192022e-17
PPTG_03153597733141331993e-17
PPTG_0752038142941431983e-17
PPTG_07516464352941431983e-17
PPTG_18166242064451472003e-17
PYU1_G001514188574691272003e-17
H257_112641259792821321964e-17
PYIR_24421899032131421934e-17
PYAP_22462820772101401934e-17
PPTG_0114817292951281974e-17
PYAP_18138991732681161964e-17
PYVX_22511188573031291974e-17
PHYKE_1913732362801081964e-17
PYAP_24691101441145821884e-17
H257_112651431862821441956e-17
PPTG_07521450302811101956e-17
SDRG_154261258855231441987e-17
PHYRA_84732161732651361937e-17
PHYKE_391242332521081928e-17
PHYCA_122958161732601481939e-17
PHYSO_324715696932741521931e-16
PITG_0820268381911401891e-16
PHYKE_1029517292921251931e-16
PYVX_24563161732541361911e-16
PYIW_242891643031961251881e-16
SPRG_0782697753711401932e-16
PYAP_18226840622261451882e-16
PITG_0196617293271281922e-16
PYAR_2411397811921271862e-16
PYIW_242881643022011291873e-16
SPRG_078251259983371461923e-16
SDRG_165341259793201341913e-16
PHYRA_7729317293021251903e-16
PPTG_10186161732701291894e-16
SPRG_077991259833451301914e-16
SDRG_0878217304501451916e-16
SDRG_009721259983331461896e-16
PHYKE_574938073001051887e-16
PYIR_14463819503691321898e-16
SPRG_077971259813181341879e-16
PHYRA_84947539132651351851e-15
PHALS_02044930992371301841e-15
PHYKE_2539161732581361841e-15
SPRG_076271258855361391882e-15
PHALS_05110161731951321802e-15
PYU1_G005867944952001431802e-15
PHYSO_476077161732681271832e-15
PHYSO_472009159812681271832e-15
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_8389

Length=204
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_8389                                                            347        1e-122
PHYRA_81106                                                           308        5e-107
PHYCA_129425                                                          293        3e-101
PPTG_17122                                                            291        2e-100
PHYSO_284086                                                          285        5e-98 
PHYCA_511409                                                          276        2e-94 
PPTG_17121                                                            272        6e-93 
PHYRA_81107                                                           271        9e-93 
PHYSO_477820                                                          268        3e-91 
PITG_18450                                                            265        6e-90 
PHYKE_8388                                                            264        1e-89 
PHYCA_14369                                                           258        1e-86 
PHYSO_341599                                                          252        3e-85 
PYVX_18174                                                            250        3e-84 
PPTG_10635                                                            249        6e-84 
PHYCA_102852                                                          249        8e-84 
PHYRA_85631                                                           250        8e-84 
PYVX_18176                                                            249        1e-83 
PHYKE_3446                                                            248        2e-83 
PPTG_10636                                                            249        3e-83 
PPTG_10634                                                            248        3e-83 
PPTG_15264                                                            246        1e-82 
PPTG_17366                                                            246        1e-82 
PHYRA_84190                                                           243        3e-81 
PHYSO_536424                                                          242        3e-81 
PHYSO_507031                                                          242        3e-81 
PHYRA_82864                                                           242        4e-81 
PHYKE_7718                                                            242        9e-81 
PHYCA_102624                                                          240        3e-80 
PHYCA_102550                                                          239        8e-79 
PPTG_10643                                                            233        5e-77 
PHALS_00498                                                           227        3e-75 
PYU1_G001741                                                          221        1e-72 
PPTG_10048                                                            217        3e-71 
PYIR_25089                                                            213        8e-69 
PYU1_G001742                                                          207        5e-67 
PYVX_18173                                                            213        9e-66 
PYU1_G001744                                                          200        3e-64 
PHALS_03284                                                           198        6e-64 
PHYSO_499978                                                          197        1e-63 
PHYSO_501575                                                          197        1e-63 
PYU1_G001740                                                          197        2e-63 
PYIR_26626                                                            197        5e-63 
PHYSO_343376                                                          189        2e-60 
PHYSO_254168                                                          187        6e-60 
PPTG_08820                                                            188        4e-59 
PITG_13520                                                            182        9e-58 
PPTG_14255                                                            182        9e-57 
PITG_10499                                                            184        1e-56 
PYU1_G001739                                                          181        2e-56 
PHYCA_510817                                                          178        6e-56 
PPTG_14254                                                            175        8e-55 
PHYSO_341596                                                          174        5e-54 
PHYSO_417649                                                          173        5e-54 
PYAP_22273                                                            172        1e-52 
PHYKE_9185                                                            171        3e-52 
PYAR_24096                                                            169        7e-52 
PHYCA_536934                                                          180        2e-51 
PYAP_22279                                                            167        3e-51 
PYAP_22278                                                            167        2e-50 
PHYSO_262732                                                          162        8e-50 
PYIW_18791                                                            161        3e-49 
PHYCA_14368                                                           162        3e-49 
PYIR_26546                                                            157        3e-47 
PHYSO_527908                                                          147        5e-44 
PHYSO_353401                                                          144        2e-43 
PHYSO_246676                                                          145        2e-43 
PHYCA_537323                                                          145        6e-43 
PPTG_17123                                                            145        7e-43 
PYU1_G001738                                                          142        1e-41 
PHYRA_81105                                                           141        3e-41 
PITG_18452                                                            147        5e-40 
HYAP_07096                                                            136        9e-39 
PHYSO_340369                                                          132        5e-38 
PYIW_18788                                                            121        4e-33 
PYAP_18131                                                            116        2e-31 
PYU1_G007476                                                          110        3e-29 
PYIR_16435                                                            109        6e-28 
PPTG_04622                                                            107        1e-27 
PYVX_18179                                                            104        1e-27 
PHYRA_74651                                                           108        2e-27 
PHYSO_342364                                                          105        2e-27 
PHYRA_73607                                                           104        9e-26 
PYAP_24689                                                            102        1e-25 
PHYRA_78689                                                           101        5e-25 
PYIW_19151                                                            100        7e-25 
PHYRA_73584                                                           100        8e-25 
PITG_04948                                                            99.4       1e-24 
PYIW_18792                                                            95.9       2e-24 
PPTG_04618                                                            100        2e-24 
PYIR_16444                                                            97.4       2e-24 
PHYCA_531163                                                          100        3e-24 
PHYKE_10578                                                           98.2       3e-24 
PHYSO_484051                                                          99.4       3e-24 
PHYCA_127270                                                          98.6       4e-24 
PHYCA_130365                                                          98.6       4e-24 
PITG_04949                                                            99.8       5e-24 
PYAP_18711                                                            96.7       6e-24 
PHYSO_483955                                                          99.0       6e-24 
PYU1_G005324                                                          95.9       8e-24 
PYU1_G005326                                                          95.9       8e-24 
PYU1_G005328                                                          95.9       8e-24 
PPTG_04647                                                            99.0       8e-24 
PYIR_16443                                                            97.4       1e-23 
PPTG_04619                                                            97.4       1e-23 
PHYSO_485524                                                          97.4       1e-23 
PHYRA_73582                                                           98.2       1e-23 
PHYRA_73606                                                           97.8       3e-23 
PHALS_03176                                                           94.7       3e-23 
PHYSO_438103                                                          95.5       3e-23 
PHYCA_534473                                                          99.4       4e-23 
PHYRA_73583                                                           98.6       6e-23 
PHYSO_533903                                                          94.0       6e-23 
PHYCA_12942                                                           97.1       6e-23 
PHYKE_2937                                                            97.1       7e-23 
PHYSO_340333                                                          95.1       1e-22 
PHYSO_340332                                                          95.5       1e-22 
PYU1_G014690                                                          95.1       1e-22 
PYVX_18175                                                            91.7       1e-22 
PHALS_05392                                                           95.9       2e-22 
PYVX_14662                                                            97.1       2e-22 
PPTG_14221                                                            94.4       2e-22 
PHYKE_6001                                                            94.7       2e-22 
PYAP_18709                                                            93.2       2e-22 
PYU1_G005325                                                          92.4       2e-22 
PYU1_G007364                                                          94.4       3e-22 
PHYSO_533682                                                          93.6       3e-22 
PHYRA_78626                                                           95.9       3e-22 
CCI47381                                                              92.0       4e-22 
PHYRA_78625                                                           95.5       4e-22 
PYIW_27477                                                            91.3       4e-22 
PHYKE_7717                                                            95.5       6e-22 
PITG_05271                                                            92.8       6e-22 
PHYKE_3913                                                            93.2       1e-21 
PHYSO_459106                                                          91.3       1e-21 
PHYRA_85794                                                           91.3       1e-21 
PHYRA_77971                                                           91.3       1e-21 
PYIR_19612                                                            91.7       2e-21 
PPTG_04620                                                            92.8       2e-21 
PHYCA_69583                                                           90.5       2e-21 
PHYCA_534296                                                          92.0       2e-21 
PYAR_14260                                                            89.7       3e-21 
H310_06362                                                            89.4       3e-21 
PHYKE_2809                                                            91.3       4e-21 
PHYKE_6002                                                            89.0       4e-21 
PHALS_03177                                                           90.1       6e-21 
PHYRA_86151                                                           87.4       1e-20 
PITG_04947                                                            90.1       1e-20 
PHYRA_87941                                                           86.7       1e-20 
PHYRA_83494                                                           88.2       1e-20 
H257_13550                                                            89.0       1e-20 
PHALS_03179                                                           90.5       2e-20 
PYIR_23585                                                            88.2       2e-20 
SDRG_16535                                                            89.4       2e-20 
PHYRA_86016                                                           87.4       3e-20 
PYAR_14256                                                            86.7       4e-20 
PPTG_07509                                                            88.2       5e-20 
PPTG_07507                                                            88.2       6e-20 
CCA17179                                                              85.9       6e-20 
PYU1_G005985                                                          85.9       8e-20 
PHYRA_86752                                                           87.8       8e-20 
PYU1_G005323                                                          86.7       8e-20 
SPRG_19916                                                            87.8       9e-20 
PYAR_20617                                                            86.7       1e-19 
PHYRA_79140                                                           88.2       2e-19 
PHYCA_97965                                                           86.7       2e-19 
SPRG_22161                                                            86.7       2e-19 
PHYCA_12943                                                           86.3       2e-19 
PHYSO_255056                                                          85.9       2e-19 
PHYRA_83500                                                           86.3       7e-19 
PHALS_05394                                                           85.1       7e-19 
PYIR_24743                                                            85.9       7e-19 
PYU1_G005871                                                          84.7       1e-18 
PYU1_G005872                                                          84.7       1e-18 
PHYSO_262844                                                          84.3       1e-18 
PYIR_20481                                                            84.0       1e-18 
PYAP_18221                                                            83.2       1e-18 
PHYSO_533747                                                          82.4       1e-18 
SPRG_07796                                                            84.7       1e-18 
SDRG_08129                                                            82.8       2e-18 
PYU1_G005868                                                          83.6       2e-18 
SDRG_07565                                                            83.6       2e-18 
PYVX_16138                                                            85.1       3e-18 
PYIW_25463                                                            82.0       3e-18 
PHALS_04411                                                           82.8       3e-18 
PYU1_G005873                                                          81.6       3e-18 
SPRG_19917                                                            82.4       4e-18 
PITG_11936                                                            83.6       4e-18 
PHYRA_83499                                                           84.3       5e-18 
PHYRA_73581                                                           82.8       5e-18 
PYVX_20783                                                            82.4       6e-18 
PYAP_22257                                                            81.6       6e-18 
PYAP_18713                                                            79.7       1e-17 
SDRG_17318                                                            80.9       1e-17 
PHYRA_80750                                                           81.6       1e-17 
SDRG_08137                                                            81.3       1e-17 
PHYRA_86751                                                           79.0       1e-17 
PHYCA_98479                                                           81.3       1e-17 
PHYCA_18657                                                           81.3       2e-17 
SDRG_17317                                                            77.4       2e-17 
PYIW_15526                                                            80.5       2e-17 
PHYRA_86241                                                           79.0       2e-17 
PPTG_04617                                                            82.4       2e-17 
PPTG_03153                                                            81.3       3e-17 
PPTG_07520                                                            80.9       3e-17 
PPTG_07516                                                            80.9       3e-17 
PPTG_18166                                                            81.6       3e-17 
PYU1_G001514                                                          81.6       3e-17 
H257_11264                                                            80.1       4e-17 
PYIR_24421                                                            79.0       4e-17 
PYAP_22462                                                            79.0       4e-17 
PPTG_01148                                                            80.5       4e-17 
PYAP_18138                                                            80.1       4e-17 
PYVX_22511                                                            80.5       4e-17 
PHYKE_1913                                                            80.1       4e-17 
PYAP_24691                                                            77.0       4e-17 
H257_11265                                                            79.7       6e-17 
PPTG_07521                                                            79.7       6e-17 
SDRG_15426                                                            80.9       7e-17 
PHYRA_84732                                                           79.0       7e-17 
PHYKE_3912                                                            78.6       8e-17 
PHYCA_122958                                                          79.0       9e-17 
PHYSO_324715                                                          79.0       1e-16 
PITG_08202                                                            77.4       1e-16 
PHYKE_10295                                                           79.0       1e-16 
PYVX_24563                                                            78.2       1e-16 
PYIW_24289                                                            77.0       1e-16 
SPRG_07826                                                            79.0       2e-16 
PYAP_18226                                                            77.0       2e-16 
PITG_01966                                                            78.6       2e-16 
PYAR_24113                                                            76.3       2e-16 
PYIW_24288                                                            76.6       3e-16 
SPRG_07825                                                            78.6       3e-16 
SDRG_16534                                                            78.2       3e-16 
PHYRA_77293                                                           77.8       3e-16 
PPTG_10186                                                            77.4       4e-16 
SPRG_07799                                                            78.2       4e-16 
SDRG_08782                                                            78.2       6e-16 
SDRG_00972                                                            77.4       6e-16 
PHYKE_5749                                                            77.0       7e-16 
PYIR_14463                                                            77.4       8e-16 
SPRG_07797                                                            76.6       9e-16 
PHYRA_84947                                                           75.9       1e-15 
PHALS_02044                                                           75.5       1e-15 
PHYKE_2539                                                            75.5       1e-15 
SPRG_07627                                                            77.0       2e-15 
PHALS_05110                                                           73.9       2e-15 
PYU1_G005867                                                          73.9       2e-15 
PHYSO_476077                                                          75.1       2e-15 
PHYSO_472009                                                          75.1       2e-15 
PHYKE_6078                                                            75.5       2e-15 
PPTG_03139                                                            75.5       2e-15 
SDRG_00948                                                            75.9       3e-15 
PYIR_15187                                                            73.9       3e-15 
PYIW_18790                                                            70.9       3e-15 
PYIR_22134                                                            75.1       3e-15 
PYVX_21643                                                            74.7       3e-15 
PHYCA_112615                                                          73.2       4e-15 
PYIW_24287                                                            75.1       4e-15 
HYAP_14170                                                            74.3       4e-15 
PHYSO_255975                                                          72.8       5e-15 
HYAP_01683                                                            74.3       7e-15 
PYAP_18584                                                            72.8       7e-15 
PYIW_16810                                                            72.8       9e-15 
PHYKE_7445                                                            74.3       9e-15 
PHYCA_132255                                                          70.5       1e-14 
PHYCA_19611                                                           74.7       1e-14 
PHYRA_77292                                                           72.0       1e-14 
PPTG_03156                                                            74.3       1e-14 
PHYKE_8104                                                            68.9       1e-14 
PYU1_G005869                                                          72.8       1e-14 
PYAR_16493                                                            72.8       1e-14 
H310_05432                                                            73.6       1e-14 
PHYCA_562062                                                          72.4       1e-14 
PHYRA_93650                                                           72.4       1e-14 
PYAP_16994                                                            72.8       1e-14 
PITG_20631                                                            72.8       2e-14 
SPRG_04679                                                            72.0       2e-14 
PHYCA_103479                                                          73.2       2e-14 
PHYSO_329293                                                          72.8       2e-14 
PITG_20312                                                            72.4       2e-14 
SPRG_07795                                                            73.2       2e-14 
PHYSO_488921                                                          72.8       2e-14 
PYAR_21940                                                            72.0       2e-14 
PPTG_03160                                                            72.8       3e-14 
PYVX_21297                                                            71.6       3e-14 
PHYSO_256017                                                          69.3       4e-14 
PHYKE_2379                                                            71.6       5e-14 
PYU1_G001527                                                          71.6       5e-14 
PYU1_G001523                                                          71.6       5e-14 
PPTG_10073                                                            69.7       7e-14 
PHYRA_78176                                                           71.2       8e-14 
PYIR_20483                                                            71.2       8e-14 
PYU1_G001526                                                          71.6       8e-14 
PYAR_17166                                                            67.8       9e-14 
PYIR_25999                                                            71.6       9e-14 
PYU1_G006405                                                          71.2       1e-13 
PHYCA_120062                                                          69.7       1e-13 
PHALS_10635                                                           70.9       1e-13 
PHYCA_123316                                                          70.9       1e-13 
PYIW_21964                                                            70.5       1e-13 
PPTG_20376                                                            68.9       1e-13 
PHYKE_6077                                                            70.9       1e-13 
PHYSO_318683                                                          70.9       1e-13 
PHYRA_78175                                                           70.5       2e-13 
PHYSO_524101                                                          70.5       2e-13 
PHYCA_14560                                                           70.5       2e-13 
PHYCA_19598                                                           70.9       2e-13 
SDRG_17448                                                            69.7       2e-13 
PYVX_16673                                                            70.9       2e-13 
PYAR_25093                                                            68.6       2e-13 
PYU1_G001525                                                          70.1       2e-13 
PYIW_18065                                                            70.1       2e-13 
PHYRA_78177                                                           69.7       3e-13 
PITG_19818                                                            67.0       3e-13 
PYU1_G001519                                                          68.9       4e-13 
PHYCA_12944                                                           67.4       4e-13 
PHYCA_19612                                                           70.1       4e-13 
PYU1_G005866                                                          67.4       5e-13 
PHYKE_8390                                                            65.9       5e-13 
PHYRA_80632                                                           69.3       5e-13 
PPTG_09880                                                            67.8       5e-13 
PYAR_17163                                                            65.5       6e-13 
PYVX_20789                                                            68.9       6e-13 
PPTG_04803                                                            68.6       6e-13 
PHYCA_15126                                                           68.9       6e-13 
PHYRA_78172                                                           69.3       6e-13 
PHYRA_78169                                                           68.9       7e-13 
PHYRA_77290                                                           68.6       8e-13 
PYAR_18165                                                            67.8       1e-12 
PHYSO_246481                                                          68.2       1e-12 
PYIR_16375                                                            67.4       1e-12 
PYAP_16347                                                            66.2       1e-12 
PYAR_21271                                                            66.6       2e-12 
PYIR_20482                                                            65.1       2e-12 
PHYKE_6079                                                            67.4       2e-12 
PYU1_G007254                                                          65.9       2e-12 
PHYKE_9023                                                            67.0       2e-12 
PHYCA_18729                                                           67.8       2e-12 
PHYKE_10296                                                           67.8       2e-12 
PYAP_19707                                                            66.6       2e-12 
PYAP_23672                                                            66.6       3e-12 
PPTG_01153                                                            67.0       3e-12 
PPTG_03143                                                            67.4       3e-12 
PHYSO_374518                                                          63.5       3e-12 
PHYKE_2454                                                            67.4       3e-12 
PYAP_16338                                                            66.2       3e-12 
PITG_11937                                                            66.6       4e-12 
PYVX_19277                                                            66.6       4e-12 
PYIR_23689                                                            65.5       4e-12 
PYU1_G001528                                                          66.2       5e-12 
PYVX_21174                                                            62.4       5e-12 
PYIW_18794                                                            65.5       6e-12 
PPTG_04801                                                            65.5       6e-12 
PYIW_25573                                                            65.5       8e-12 
PHYSO_257305                                                          64.3       8e-12 
PYAR_15391                                                            63.9       8e-12 
PPTG_03140                                                            65.9       9e-12 
PYVX_22510                                                            66.2       9e-12 
PPTG_07511                                                            63.9       9e-12 
PHYRA_80631                                                           65.5       9e-12 
PHYCA_6388                                                            65.5       9e-12 
PPTG_18176                                                            65.1       1e-11 
PHYCA_19608                                                           65.1       1e-11 
PYU1_G006672                                                          60.1       1e-11 
PHALS_01293                                                           64.7       2e-11 
PYAP_23455                                                            65.1       2e-11 
PYIW_16208                                                            63.9       2e-11 
H310_05433                                                            64.7       2e-11 
PYU1_G001524                                                          64.3       2e-11 
PHYRA_78161                                                           64.7       3e-11 
PHALS_02041                                                           63.9       3e-11 
PHYSO_375794                                                          61.2       3e-11 
PYVX_22508                                                            64.3       3e-11 
PHYRA_78174                                                           63.9       3e-11 
PHYKE_6066                                                            63.9       3e-11 
PHYKE_6076                                                            63.5       3e-11 
PHYSO_454780                                                          62.4       4e-11 
PPTG_03138                                                            63.5       4e-11 
PHYSO_525076                                                          63.9       4e-11 
PITG_08895                                                            62.4       4e-11 
PYU1_G007242                                                          63.2       5e-11 
PYAP_14265                                                            63.2       5e-11 
PHYKE_7443                                                            63.5       5e-11 
PYAP_16351                                                            62.8       6e-11 
PYAP_20077                                                            62.4       6e-11 
PYVX_21438                                                            62.8       7e-11 
PHALS_08575                                                           63.2       7e-11 
PHYRA_78162                                                           63.5       7e-11 
PPTG_06253                                                            63.2       7e-11 
PHYSO_318693                                                          63.5       7e-11 
PYU1_G001520                                                          63.2       7e-11 
PHYCA_558591                                                          59.7       9e-11 
PHYCA_15124                                                           62.8       9e-11 
PYIR_25571                                                            62.4       1e-10 
PHYSO_374025                                                          62.4       1e-10 
PHYSO_426658                                                          61.6       1e-10 
PHYRA_86201                                                           62.4       1e-10 
PYIR_26867                                                            60.5       1e-10 
H257_11271                                                            62.4       1e-10 
PHYSO_488139                                                          62.0       1e-10 
PYIR_25334                                                            62.0       1e-10 
PHYSO_337515                                                          62.0       1e-10 
PITG_08892                                                            62.0       1e-10 
PPTG_06256                                                            62.0       1e-10 
PPTG_06249                                                            62.0       1e-10 
PHYKE_9024                                                            62.0       2e-10 
HYAP_11923                                                            62.4       2e-10 
PYIW_15528                                                            62.0       2e-10 
PYIW_23030                                                            61.2       2e-10 
PYAP_19712                                                            61.2       2e-10 
PHYCA_538650                                                          61.2       3e-10 
PPTG_01147                                                            60.8       3e-10 
PHYCA_15125                                                           61.2       3e-10 
PHYKE_6069                                                            61.2       3e-10 
PPTG_03161                                                            61.6       3e-10 
PYU1_G006404                                                          60.8       3e-10 
PYIR_22634                                                            60.8       4e-10 
PYAR_24818                                                            59.7       4e-10 
PHYRA_78164                                                           60.8       4e-10 
PITG_21641                                                            60.8       5e-10 
PYAR_14261                                                            58.5       5e-10 
PHYCA_10471                                                           60.5       6e-10 
PYIR_22133                                                            60.8       6e-10 
PYIW_19601                                                            59.7       7e-10 
PYIR_22549                                                            59.7       8e-10 
PYIR_24935                                                            59.7       9e-10 
PYU1_G006403                                                          59.3       1e-09 
PPTG_03148                                                            59.3       1e-09 
PYU1_G003057                                                          58.5       1e-09 
PHYRA_95184                                                           59.7       1e-09 
PHYRA_77291                                                           58.9       1e-09 
H257_11258                                                            59.3       2e-09 
PPTG_03145                                                            58.9       2e-09 
PYIR_23622                                                            58.5       2e-09 
PPTG_01152                                                            58.5       2e-09 
PHYKE_7446                                                            59.3       2e-09 
PYU1_G001518                                                          58.9       2e-09 
PPTG_03144                                                            58.9       2e-09 
PHYCA_14559                                                           58.5       2e-09 
PHYCA_552912                                                          58.9       2e-09 
PYIR_24867                                                            58.5       3e-09 
PHYSO_525490                                                          58.5       3e-09 
HYAP_01682                                                            58.2       3e-09 
PYU1_G001516                                                          58.2       3e-09 
H310_05438                                                            58.2       4e-09 
PYAP_23673                                                            58.2       4e-09 
PYIR_20304                                                            57.0       4e-09 
PPTG_00483                                                            57.4       5e-09 
PYAP_24338                                                            57.4       6e-09 
PHYRA_78167                                                           57.4       6e-09 
PITG_11942                                                            57.0       6e-09 
PYAP_25026                                                            56.6       7e-09 
PITG_11944                                                            57.4       7e-09 
PITG_11951                                                            55.5       7e-09 
PHYCA_97699                                                           56.6       8e-09 
PYIW_14247                                                            56.6       8e-09 
PYIW_20715                                                            56.6       9e-09 
PYAR_15390                                                            55.8       9e-09 
PYU1_G005878                                                          53.1       9e-09 
PYVX_23997                                                            55.8       1e-08 
PHALS_02295                                                           56.6       1e-08 
PHYSO_261686                                                          56.2       1e-08 
PHYKE_9025                                                            56.6       1e-08 
PYAR_13902                                                            54.7       1e-08 
H257_11306                                                            56.6       1e-08 
PYIR_17978                                                            55.8       1e-08 
PYAP_16337                                                            55.8       2e-08 
PYVX_24274                                                            55.5       2e-08 
PYIW_26655                                                            55.8       2e-08 
PPTG_22744                                                            54.3       2e-08 
PITG_11957                                                            55.8       2e-08 
PHYCA_19606                                                           55.8       2e-08 
PYU1_G001517                                                          55.8       2e-08 
PHYSO_339832                                                          55.5       3e-08 
PITG_01969                                                            55.1       3e-08 
PHALS_02296                                                           55.1       3e-08 
PYVX_21644                                                            54.7       3e-08 
PHYSO_489485                                                          53.5       3e-08 
PHALS_01460                                                           55.5       3e-08 
PYAR_17307                                                            54.7       3e-08 
PHYSO_324755                                                          55.1       3e-08 
PYIR_22562                                                            53.5       4e-08 
PYU1_G001475                                                          54.7       4e-08 
PYAR_25949                                                            53.5       5e-08 
PPTG_13879                                                            54.7       6e-08 
PYAP_20161                                                            53.9       6e-08 
PYIW_17867                                                            53.9       1e-07 
PYAP_18983                                                            52.8       1e-07 
PYIR_22136                                                            53.5       1e-07 
PYVX_22512                                                            52.8       1e-07 
PYIR_22187                                                            52.8       2e-07 
PYAP_20456                                                            53.1       2e-07 
PHYCA_10470                                                           52.8       2e-07 
PYAR_23090                                                            50.8       3e-07 
PYAR_15784                                                            51.6       3e-07 
PITG_04404                                                            51.6       3e-07 
PHYRA_78165                                                           52.4       4e-07 
PHYRA_79881                                                           52.0       4e-07 
PYIR_25001                                                            51.2       5e-07 

>PHYKE_8389
Length=204

 Score = 347 bits (891),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/182 (100%), Positives = 182/182 (100%), Gaps = 0/182 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA
Sbjct  23   TADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI
Sbjct  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202
            SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI
Sbjct  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202

Query  203  EF  204
            EF
Sbjct  203  EF  204

>PHYRA_81106
Length=202

 Score = 308 bits (788),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 168/180 (93%), Gaps = 3/180 (2%)

Query  25   DAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKY  84
            DAHQVVLLPAPTYTTD KDTKYAPLAFLENQGFETV DFNAWRR+NGYKTLRAFMDGAKY
Sbjct  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKY  85

Query  85   TVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  144
            TV DGADY+CGFTNADA PQAIP GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG
Sbjct  86   TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  145

Query  145  KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIEF  204
            KDYTIDYSSCTGTCTL WYW+GVR+LKN YSWQVYKACVPLSASARRL    NESA I+F
Sbjct  146  KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAVIDF  202

>PHYCA_129425
Length=204

 Score = 293 bits (751),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 166/182 (91%), Gaps = 1/182 (1%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQVVLLPAPTYTTD+KDTKYAPLAFLE+QGF+TV+DFN WRR+NGYKTLRAFMDGA
Sbjct  24   TADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVTDGADY+CGFTNA AAPQ IP G  MRSTGYTHDGPCEVWLD+TRVL  DNCHE  
Sbjct  84   KYTVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETF  142

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202
             GK Y +DYSSC G+C LRWYWLG RFLKNE+SWQVYKAC+PLS+SARRL+GAANESAAI
Sbjct  143  PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAI  202

Query  203  EF  204
            EF
Sbjct  203  EF  204

>PPTG_17122
Length=204

 Score = 291 bits (745),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 1/181 (1%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            T++AHQVVLLPAPTYTTD+KDTKYAPLAFLENQG+ETV+DFN WRRNNGYKTLR FMD A
Sbjct  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVTDGADY+CGFTN +AAPQ IP G  MRSTGYTHDGPCEVWLDT RVL  DNCHE I
Sbjct  84   KYTVTDGADYYCGFTNVNAAPQPIPDGT-MRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202
            SGK Y +DYSSCTGTCTLRWYWLGVR+LKN YSWQ+YKAC+PLSASARRL+ AANES A+
Sbjct  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASARRLESAANESVAL  202

Query  203  E  203
            E
Sbjct  203  E  203

>PHYSO_284086
Length=204

 Score = 285 bits (729),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 160/182 (88%), Gaps = 1/182 (1%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQVVLLPAPTYTTDDK TKYAPLAFLENQG+ETV+DFNAWRR+ GYKTLRAFMDGA
Sbjct  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
             YTV DGADY+CGFT+     Q IP G  MRSTGYTHDGPCEVWLDTTRVL  DNCHE  
Sbjct  84   SYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202
            SGK Y +DYSSC G+CTLRWYWLGVRFLKNEYSWQVYKACVPLS SARRL+ AANESAA+
Sbjct  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSARRLEAAANESAAL  202

Query  203  EF  204
            EF
Sbjct  203  EF  204

>PHYCA_511409
Length=204

 Score = 276 bits (705),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 160/181 (88%), Gaps = 0/181 (0%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            ADAHQVVLLPAPTYTTDDK TKYAPLAFLE+QGF T +DF AWR++NGY +LRAF DGA 
Sbjct  24   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGAS  83

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            YTV+DGAD+ CGFTN +   QAIP  NAMRSTGYTHDGPCEVWLD T V+ +DNCHEAIS
Sbjct  84   YTVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAIS  143

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIE  203
            GKDYTIDYSSCT TCTL W+WLGVR+LKNEYSWQ+YKACVPLSASARRL+GAANESA  +
Sbjct  144  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASARRLEGAANESAIAD  203

Query  204  F  204
            F
Sbjct  204  F  204

>PPTG_17121
Length=202

 Score = 272 bits (696),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 158/181 (87%), Gaps = 0/181 (0%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            A+AHQVVLL APTYTTDDKDTKYAPLAFLE+QGF T +DF AWR++NGY +LRAF DGA 
Sbjct  22   ANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS  81

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            YTV+DGAD  CGFTN +   Q IP GNAMRSTGYTHDGPCEVWLD T V+ +DNCHEAIS
Sbjct  82   YTVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAIS  141

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIE  203
            GK YTIDYSSCT TCTL W+WLGVR+LKNEYSWQ+YKACVPLS SARRL+GAANESA I+
Sbjct  142  GKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGAANESAIID  201

Query  204  F  204
            F
Sbjct  202  F  202

>PHYRA_81107
Length=202

 Score = 271 bits (694),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 157/181 (87%), Gaps = 0/181 (0%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            ADAHQVVLLPAPTYTTDDK TKYAPLAFLE+QGF T +DF AWR  NGY +LRAF DGA 
Sbjct  22   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDDGAS  81

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            YTV+DGAD+ CGFT+ +   QAIP GNAMRSTGYTHDGPCEVWLD T V+ +DNCHE IS
Sbjct  82   YTVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVIS  141

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIE  203
            GKDYTIDYSSCT TCTL W+W+GVR+L N YSWQVYKACVPLSASARRL+GAANESA ++
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASARRLEGAANESAILD  201

Query  204  F  204
            F
Sbjct  202  F  202

>PHYSO_477820
Length=202

 Score = 268 bits (684),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 155/181 (86%), Gaps = 0/181 (0%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            A AHQVVLLPAPTYTTDDK TKYAPLAFLE+QGF T +DF AWR +NGY +LRAF DGA 
Sbjct  22   AGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS  81

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            YTV DGAD+ CGFTN +   Q IP  NAMRSTGYTHDGPCEVWLD T V+ +DNCHE+IS
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIE  203
            GKDYTIDYSSCT TCTL W+WLGVR+LKNEYSWQ+YKACVPLS SARRL+GA NESA ++
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGATNESARLD  201

Query  204  F  204
            F
Sbjct  202  F  202

>PITG_18450
Length=203

 Score = 265 bits (676),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 155/181 (86%), Gaps = 4/181 (2%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TA AHQVVLLP+PTYTTDDKDTKYAPL FLE QG+ETV+DFN WRRNNGYKTLR FM+  
Sbjct  24   TATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME--  81

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
             YTV DGADY+CGFTN +AAPQ  P G AMRSTGYTHDGPCEVWLD+TRVL  DNCHE I
Sbjct  82   -YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202
             GK Y +DYSSC GTCTLRWYWLGVRFLKN YSWQ+YKAC+PLSASARRL+ AAN+S   
Sbjct  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVF  199

Query  203  E  203
            +
Sbjct  200  D  200

>PHYKE_8388
Length=205

 Score = 264 bits (674),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            A+AHQVVLLP+PTYTTDDK TKYAPLAFLE+QGF T +DF AWR +NGY +LRAF D A 
Sbjct  25   ANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS  84

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            YTV+DGAD+ CGFT+ + A Q IP  NAMRSTGYTHDGPCEVWLD T V+ ++NCH++IS
Sbjct  85   YTVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSIS  144

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIE  203
            GKDYTIDYSSCT TCTL W+W+GVR+LKNEYSWQVYKACVPLSASARRL+GA NES   E
Sbjct  145  GKDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASARRLEGAVNESVIFE  204

>PHYCA_14369
Length=248

 Score = 258 bits (659),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 140/167 (84%), Gaps = 0/167 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ+VLLP P +TT+DKDTKY PLAFLENQGF+T  DF AWR  NGYK+LR FMD A
Sbjct  24   TADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDRA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVT+GAD+ CGFT+    PQ IP+GNAMRSTGYTHDGPCEVWLD T VL  DNCHE  
Sbjct  84   KYTVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  143

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
             GKDYT+DYSSC GTCTLRWYWLGVRFLKN YSWQVYKAC+PL+ S 
Sbjct  144  PGKDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSG  190

>PHYSO_341599
Length=185

 Score = 252 bits (644),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 142/173 (82%), Gaps = 0/173 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ+VLLP P +TT+DK+TKY PLAFLENQGF+T +DF AWR+ NGYK+LR FMD A
Sbjct  7    TADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDRA  66

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KY VT GAD+ CGFT+    PQ IP GN MRSTGYTHDGPCEVWLD T VL  DNCHE  
Sbjct  67   KYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  126

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGA  195
             GKDYT+DYSSC GTCTLRWYWLGVRFLKN+YSWQVYKAC+PL++ +    G+
Sbjct  127  PGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  179

>PYVX_18174
Length=204

 Score = 250 bits (639),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 147/181 (81%), Gaps = 3/181 (2%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            ADAHQ V+LP PT+TT D+D  YAPLAFLE+QGFETV+DFNAWRR+NGYKTLRAFMD A 
Sbjct  25   ADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS  84

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            YTVTDGAD  CGFT  D  PQ IP+    RSTGYTHDGPCE+WLD+TRV  +DNCHEAIS
Sbjct  85   YTVTDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAIS  142

Query  144  GKDYTIDYS-SCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202
            GKD  IDYS    GTCTL WYW+GVR+L N YSWQVYK CVPLS SAR L+GAAN SA I
Sbjct  143  GKDTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSARMLEGAANASAII  202

Query  203  E  203
            E
Sbjct  203  E  203

>PPTG_10635
Length=199

 Score = 249 bits (636),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 140/172 (81%), Gaps = 0/172 (0%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            ADAHQ+VLLP P +TT+DKDTKY PLAFLENQGF+T +DF +WR  NGYK+LR FMD AK
Sbjct  8    ADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDRAK  67

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            Y VT GAD+ CGFT+    PQ IP+GNAMRSTGYTHDGPCEVWLD T VL  DNCHE   
Sbjct  68   YEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFP  127

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGA  195
            GKDYT+DYSSC G+CTLRWYWLGVRFLKN YSWQVYKAC+PL+  A    G+
Sbjct  128  GKDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGAGAPAGS  179

>PHYCA_102852
Length=195

 Score = 249 bits (635),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 142/171 (83%), Gaps = 0/171 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ+VLLP P +TT+DKDTKY PLAFLEN+GF T +DF AWR  NGYK+LR FMD A
Sbjct  24   TADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDRA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KY VT+GAD+ CGFT+ +  PQ IP+GNAMRSTGYTHDGPCEVWLD T VL  +NCHE  
Sbjct  84   KYPVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKF  143

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLK  193
             GK YTIDYSSC GTCTL W+WLGVRFLKN+YSWQVYKAC+PL+A  R L+
Sbjct  144  PGKGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLTAGQRNLR  194

>PHYRA_85631
Length=228

 Score = 250 bits (638),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 143/182 (79%), Gaps = 1/182 (1%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQVVLLP P +TTDDKDTKY PLAFLEN+GF T +DF +WR  NGYK+LR FMD A
Sbjct  24   TADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDNA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KY V DGAD+ CGFT+    PQ IP+GNAMRSTGYTHDGPCEVWLD T VL  DNCHE  
Sbjct  84   KYNVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  143

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLS-ASARRLKGAANESAA  201
             GKDYT+DYSSC GTCTLRWYWLG+RFLKN+YSWQVYK C+PL+  S       A E+ +
Sbjct  144  PGKDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGSGTSESAPATEAPS  203

Query  202  IE  203
             E
Sbjct  204  TE  205

>PYVX_18176
Length=201

 Score = 249 bits (635),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 149/180 (83%), Gaps = 1/180 (1%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            ADAHQ V+LPAPT+ TDDKD  YAPLAFLE+QGF T +DF AWR +NGY +LRAFMDGA 
Sbjct  22   ADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS  81

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            YTVTDGAD  CG+TN D   QA+P G  MRSTGYTH GPCEVWLD T VL +DNCH++IS
Sbjct  82   YTVTDGADQTCGWTNKDGTAQALPDG-VMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSIS  140

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIE  203
            GK Y +DYSSCT TCTL W+W+GVR+L NEYSWQVYK CVPLSASARRL+GAAN SA ++
Sbjct  141  GKTYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASARRLEGAANASAVVD  200

>PHYKE_3446
Length=199

 Score = 248 bits (633),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 137/165 (83%), Gaps = 0/165 (0%)

Query  25   DAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKY  84
            DAHQ+VLLP P + TD K+ KY PLAFLENQGF T +D NAWRR+NGYKTLRAFMD AKY
Sbjct  26   DAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDMAKY  85

Query  85   TVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  144
             VT+GADY CG+T+ +   Q IP G AMRSTGYTHDGPCEVW+D TRVL   NCHE I+G
Sbjct  86   QVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITG  145

Query  145  KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
            KDYTIDYS+C GTC LRWYWLGVRFLKN YSWQVYKAC+PL++ +
Sbjct  146  KDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLTSGS  190

>PPTG_10636
Length=246

 Score = 249 bits (636),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 138/167 (83%), Gaps = 0/167 (0%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            ADAHQ+VLLP P +TT+DKDTKY PLAFLENQGF+T +DF +WR  N YK+LR FMD AK
Sbjct  25   ADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDNAK  84

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            Y VT GAD+ CGFT+    PQ IP+GNAMRSTGYTHDGPCEVWLD T VL  +NCHE   
Sbjct  85   YEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFP  144

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASAR  190
            GKDYT+DYSSC GTCTLRWYWLG+RFLKN+YSWQVYKAC+PLS S  
Sbjct  145  GKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGE  191

>PPTG_10634
Length=208

 Score = 248 bits (632),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 137/163 (84%), Gaps = 0/163 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            T DAHQ+VLLP P +TT+DK+TKY PLAFLEN+GF T +DF AWR+ NGYK+LR F+D A
Sbjct  24   TVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KY VTDGAD+ CGFT+    PQ IP+GNAMRSTGYTHDGPCEVWLD T VL  DNCHE  
Sbjct  84   KYPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  143

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             GKDYT+DYSSC GTCTL WYWLGVRFLKN+YSWQVYKAC+PL
Sbjct  144  PGKDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PPTG_15264
Length=194

 Score = 246 bits (628),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 141/173 (82%), Gaps = 2/173 (1%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            + DAHQ+VL P P +TTD+KD KY PLAFLE QGF+T +DFNAWRR+NGYKTLR FMD A
Sbjct  21   STDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRA  80

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVT+GADY CG+T+    PQ IP+G AMRSTGYTHDGPCEVWLD  RVL   NCHE+I
Sbjct  81   KYTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESI  140

Query  143  SGKDYTIDYSSC--TGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLK  193
             GKDYTIDYSSC   G C LRWYWLGVRFLKN YSWQVYK C+PL+ + +RL+
Sbjct  141  PGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRLR  193

>PPTG_17366
Length=194

 Score = 246 bits (628),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 141/173 (82%), Gaps = 2/173 (1%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            + DAHQ+VL P P +TTD+KD KY PLAFLE QGF+T +DFNAWRR+NGYKTLR FMD A
Sbjct  21   STDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRA  80

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVT+GADY CG+T+    PQ IP+G AMRSTGYTHDGPCEVWLD  RVL   NCHE+I
Sbjct  81   KYTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESI  140

Query  143  SGKDYTIDYSSC--TGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLK  193
             GKDYTIDYSSC   G C LRWYWLGVRFLKN YSWQVYK C+PL+ + +RL+
Sbjct  141  PGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRLR  193

>PHYRA_84190
Length=206

 Score = 243 bits (619),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 0/167 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ+VLLP P +TTDDKDTKY PLAFLEN+GF T +DF AWR  NGYK+LR FMD A
Sbjct  7    TADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNA  66

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KY+VT+GAD+ CGFT+    PQ IP+ NAMRSTGYTHDGPCEVWLD T VL  +NCHE  
Sbjct  67   KYSVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKF  126

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
             GKDYT+DYSSC GTCTLRWYW+GVRFLK  YSWQVYK C+PL+  +
Sbjct  127  PGKDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGS  173

>PHYSO_536424
Length=197

 Score = 242 bits (618),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 137/170 (81%), Gaps = 0/170 (0%)

Query  26   AHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYT  85
             HQ+VLLP P +TT+DK+TKY PLAFLEN+GF T +DF AWR+ NGYK+LR FMD AKY 
Sbjct  22   THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYD  81

Query  86   VTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  145
            VT GAD+ CGFT+    PQ IP GN MRSTGYTHDGPCEVWLD T VL  DNCHE   GK
Sbjct  82   VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  141

Query  146  DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGA  195
            DYT+DYSSC GTCTLRWYWLGVRFLKN+YSWQVYKAC+PL++ +    G+
Sbjct  142  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  191

>PHYSO_507031
Length=197

 Score = 242 bits (618),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 137/170 (81%), Gaps = 0/170 (0%)

Query  26   AHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYT  85
             HQ+VLLP P +TT+DK+TKY PLAFLEN+GF T +DF AWR+ NGYK+LR FMD AKY 
Sbjct  22   THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYD  81

Query  86   VTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  145
            VT GAD+ CGFT+    PQ IP GN MRSTGYTHDGPCEVWLD T VL  DNCHE   GK
Sbjct  82   VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  141

Query  146  DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGA  195
            DYT+DYSSC GTCTLRWYWLGVRFLKN+YSWQVYKAC+PL++ +    G+
Sbjct  142  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  191

>PHYRA_82864
Length=193

 Score = 242 bits (617),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 138/168 (82%), Gaps = 1/168 (1%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQVVLLP P +TTD+KDTKY PLAFLE QGF T  DFNAWRR+NGYKTLR FMD A
Sbjct  24   TADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDRA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVT+GADY CG+T+ +  PQ IP+GN MRSTGYTHDGPCEVWLD TRVL  DNCHE  
Sbjct  84   KYTVTEGADYFCGWTDPNGTPQPIPAGN-MRSTGYTHDGPCEVWLDNTRVLQGDNCHEQF  142

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASAR  190
              KDY IDYSSC GTCTL WYW+GVRFLKN YSWQVYK C+ L++  R
Sbjct  143  PDKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQR  190

>PHYKE_7718
Length=220

 Score = 242 bits (617),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 137/166 (83%), Gaps = 0/166 (0%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            ADAHQ+VLLP PT+TTDDKDTKY PLAFLE +GF   +DF AWR  NGYK+LR FMD AK
Sbjct  29   ADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAK  88

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            Y+VT GAD  CGFT+ +  PQ IP GNAMRSTGYTHDGPCEVW+D T  + +DNCHEA  
Sbjct  89   YSVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFP  148

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
            GKDYTIDYS+C GTCTLRWYWLGVRFLKN YSWQVYKAC+PL+ S 
Sbjct  149  GKDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGSG  194

>PHYCA_102624
Length=195

 Score = 240 bits (612),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 135/171 (79%), Gaps = 0/171 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TA AHQVVLLP P + TD++DT++ PL FLE  GF+T  DF AWR+ NGYK+LR FMD A
Sbjct  24   TATAHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KY V++GAD+ CGFT+ +  PQ IP+GNAMRSTGYTHDGPCEVW+D T V+  DNCHE  
Sbjct  84   KYPVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKF  143

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLK  193
             GKDYTIDYS C G CTL WYWLGVRFLKN YSWQVYK C+PL++  R L+
Sbjct  144  PGKDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTSEQRSLR  194

>PHYCA_102550
Length=268

 Score = 239 bits (609),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 134/167 (80%), Gaps = 0/167 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TA AHQVVLLPAP + TD++DT++ PLAFLE+QGF+T  DF AWR  NGYK+LR FMD A
Sbjct  24   TATAHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDRA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTV +GAD+ CG+T+ +  PQ IP+GNAMRSTGYTHDGPCEVW+D T V+  DNCHE  
Sbjct  84   KYTVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKF  143

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
             GK YTIDYS C G CTL WYWLGVRFLKN YSWQVYK C+PL+ S 
Sbjct  144  PGKGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSG  190

>PPTG_10643
Length=250

 Score = 233 bits (595),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 136/180 (76%), Gaps = 5/180 (3%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            T DAHQ+VLLP P +TT+DKDTKY PLAFLENQGF+  +DF AW + NGYK+LR FMD A
Sbjct  24   TTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDRA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KY VT GAD+ CGFTN    PQ IP+   MRSTGYTHDGPCEV+LD T VL  DNCHE  
Sbjct  84   KYEVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKF  143

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202
             GKD  IDYSSC GTCTLRWYWLG+RFLKN YSWQVYK C+PL  S     G  +++A +
Sbjct  144  PGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGS-----GGVSQTAPV  198

>PHALS_00498
Length=199

 Score = 227 bits (579),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 130/165 (79%), Gaps = 0/165 (0%)

Query  26   AHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYT  85
            AHQ+VLLP P + T+DKDT+Y PLAFLENQ F+T  D  A+ + N +KTLR FMD AKYT
Sbjct  27   AHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAKYT  86

Query  86   VTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  145
            V  GAD  CGFT+ +  PQ IP+ NAMRSTGYTHDGPCEVWL+ TRVL+  NCHE   GK
Sbjct  87   VVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGK  146

Query  146  DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASAR  190
            DYTIDYSSC   C LRWYWLGVRFLK +YSWQVYKAC+PLS SA+
Sbjct  147  DYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSAK  191

>PYU1_G001741
Length=199

 Score = 221 bits (562),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 134/171 (78%), Gaps = 3/171 (2%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ V+LPAPT+T   +  ++ PLAFLENQGFET  DFNA+ +  GYKTLRAFMD  
Sbjct  23   TADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDK  82

Query  83   K-YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141
            K YTV  GAD+ CG+T  D   Q+IP+G  +RSTGYTHDGPCEVWLD+TRV+  +NCH  
Sbjct  83   KAYTVASGADFECGWTKLDGTRQSIPAGT-IRSTGYTHDGPCEVWLDSTRVMKGNNCHTE  141

Query  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRL  192
             +G  +TIDYSSC G+CTLRWYW+G+RFLK EYSWQVYK CVP+  S+RRL
Sbjct  142  FTGTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPI-GSSRRL  191

>PPTG_10048
Length=190

 Score = 217 bits (552),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 131/165 (79%), Gaps = 0/165 (0%)

Query  25   DAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKY  84
            +AHQVVL PAP + TD++DT++ PLAFLE+QGF+T +DF +WR  NGYKTLR FM+ AKY
Sbjct  23   EAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEHAKY  82

Query  85   TVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  144
            TVT+GAD+ CG+TN    PQ IP+G  MRSTGYTH+GPCE+W+  T+V   DNCH ++ G
Sbjct  83   TVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPG  142

Query  145  KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
            K+Y IDYS C G C L WYWLGVRFLKN YSWQVYK C+PL+ ++
Sbjct  143  KEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNS  187

>PYIR_25089
Length=262

 Score = 213 bits (542),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 124/167 (74%), Gaps = 1/167 (1%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMD-G  81
            + DAHQ V+LPAPT+T   +  ++ PLAFLENQGF+T  DF+A+ +  GYKTLRAFMD  
Sbjct  24   SVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDK  83

Query  82   AKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141
            + Y V DGAD+ CG+T     PQ IPS + +RSTGYTHDGPCEVWLD TRVL   NCH  
Sbjct  84   SAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSE  143

Query  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSAS  188
              G  + IDYSSC G+C LRWYW+G+RFLK +YSWQVYK CVP++ S
Sbjct  144  FPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVTGS  190

>PYU1_G001742
Length=213

 Score = 207 bits (526),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 131/183 (72%), Gaps = 3/183 (2%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            +ADAHQ V+LPAPT+T   +  ++ PLAFLENQG++T  DFNA+ +  GYKTLRAFMD  
Sbjct  24   SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDP  83

Query  83   K-YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141
            K Y V  GAD+ CG+T  D   Q IP+G  +RSTGYTHDGPCEVWLD+TRV+  +NCH  
Sbjct  84   KAYKVAAGADFQCGWTKLDGKRQPIPAGT-IRSTGYTHDGPCEVWLDSTRVMKGNNCHSE  142

Query  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAA  201
              G  + IDYSSC G+CTLRWYW+G+RFLK +YSWQVYK CVP+    R L+    E  +
Sbjct  143  FPGTTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK-RLLEEQFAEGNS  201

Query  202  IEF  204
             E 
Sbjct  202  TEL  204

>PYVX_18173
Length=500

 Score = 213 bits (541),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 128/164 (78%), Gaps = 2/164 (1%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-A  82
            A AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T DDF  +   NG+ +LRAFMD  +
Sbjct  232  AMAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDS  291

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
             Y+V   AD+ CGFT+ DAAPQ IP G  MRSTGYTHDGPCEVWLD TRVL HDNCHE I
Sbjct  292  LYSVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVI  350

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            SGK Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKACVP+S
Sbjct  351  SGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

 Score = 135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 96/163 (59%), Gaps = 1/163 (1%)

Query  28   QVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AKYTV  86
            QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  87   TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  146
            T+   + CG T  +   Q IP+  +  ++GYT DGPCE+W+D T  L   NCH       
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  147  YTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
            +TIDYS C  +C + W+WLG+++    YSWQV+K C+ LSASA
Sbjct  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200

>PYU1_G001744
Length=213

 Score = 200 bits (508),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 128/183 (70%), Gaps = 3/183 (2%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            +ADAHQ V+LPAPT+T   +  ++ PLAFLENQGF+T  DFNA+ +  GYK+LRAFMD  
Sbjct  24   SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDK  83

Query  83   K-YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141
            K Y V  GAD+ CG+T  D   Q IP+G  +RSTGYTHDGPCEVWLD T V+  +NCH  
Sbjct  84   KAYKVAAGADFQCGWTKLDGKRQPIPAGT-IRSTGYTHDGPCEVWLDNTLVMKGNNCHSE  142

Query  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAA  201
              G  + I Y+SC G+CTLRWYW+G+RFLK +YSWQVYK CVP+    R L+    E  +
Sbjct  143  FPGTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK-RLLEEQFAEGNS  201

Query  202  IEF  204
             E 
Sbjct  202  TEL  204

>PHALS_03284
Length=188

 Score = 198 bits (503),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 120/165 (73%), Gaps = 0/165 (0%)

Query  26   AHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYT  85
            AHQ++LLP P + T+DKDTKY PLAFLENQ F T  DF  + + N Y +LR F+  A YT
Sbjct  13   AHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRANYT  72

Query  86   VTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  145
            VT+GAD  CGFT+ +  PQ IP+GN MR TGYTHDG CE+WLD T+VL+  NCH    GK
Sbjct  73   VTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGK  132

Query  146  DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASAR  190
            D  +DYSSC   C + WYWL VR LKNEYSWQVYKAC+PL+ S +
Sbjct  133  DCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRSGK  177

>PHYSO_499978
Length=174

 Score = 197 bits (501),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 113/142 (80%), Gaps = 0/142 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ+VL P P +TT+DK+TKY PLAFLENQGF T  DF  WR  NGYKTLR FMD  
Sbjct  24   TADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHG  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVT GAD+ CG+T+    PQ IP G+AMRSTGYTHDGPCEVW+D TRVL  DNCHE I
Sbjct  84   KYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKI  143

Query  143  SGKDYTIDYSSCTGTCTLRWYW  164
            + K YTIDYS+C GTCTLRWYW
Sbjct  144  ADKGYTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 197 bits (501),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 113/142 (80%), Gaps = 0/142 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ+VL P P +TT+DK+TKY PLAFLENQGF T  DF  WR  NGYKTLR FMD  
Sbjct  24   TADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHG  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVT GAD+ CG+T+    PQ IP G+AMRSTGYTHDGPCEVW+D TRVL  DNCHE I
Sbjct  84   KYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKI  143

Query  143  SGKDYTIDYSSCTGTCTLRWYW  164
            + K YTIDYS+C GTCTLRWYW
Sbjct  144  ADKGYTIDYSACKGTCTLRWYW  165

>PYU1_G001740
Length=206

 Score = 197 bits (501),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 126/164 (77%), Gaps = 3/164 (2%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
             ADAHQ+V+LP PT+T   KD +++PLAFLENQG++T  DFNA+ ++ GYK+LRAFMD  
Sbjct  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83

Query  83   K-YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141
            K Y V   AD+ CG+TN + A Q IP+    R+TGYTHDGPCEVWLD T+VL+  NCH+ 
Sbjct  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141

Query  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
              GK + + Y++C G+CTLRWYW+G+RFLK ++SWQVYK CVPL
Sbjct  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PYIR_26626
Length=212

 Score = 197 bits (500),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 131/172 (76%), Gaps = 4/172 (2%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            + DAHQ V+LPAPT+T  DK+  + PLAFLENQG++T  DFN + ++ GYKTLRAFMD  
Sbjct  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83

Query  83   KYTVTD--GADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHE  140
            K    D  GA++ CG+TN +   Q IP+G  +RSTGYTHDGPCEVWLD T+V++  NC++
Sbjct  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142

Query  141  AISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRL  192
               GK ++I Y+SC G+CTLRWYW+G+RFLKN++SWQVYK CVP+  S RRL
Sbjct  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI-GSGRRL  193

>PHYSO_343376
Length=172

 Score = 189 bits (480),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 92/116 (79%), Gaps = 0/116 (0%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            LAFLENQGF T  DF AWR  NGYKTLR FMD  KYTVT GAD+ CG+T+    PQ IP 
Sbjct  48   LAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGKYTVTKGADFSCGWTDPKGTPQPIPD  107

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYW  164
            G+AMRSTGYTHDGPCEVW+D TRVL  DNCHE I+ K YTIDYS+C GTCTLRWYW
Sbjct  108  GDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  163

>PHYSO_254168
Length=170

 Score = 187 bits (475),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 104/147 (71%), Gaps = 17/147 (12%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            LAFLE QGF T + F+A RR+NGYKTLR FMD  KYTVT GADY CG+TN    PQ IP 
Sbjct  38   LAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGKYTVTQGADYFCGWTNPKGTPQPIP-  96

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSC--TGTCTLRWYWLG  166
                RSTGYTHDGPCE+WLD  RVL           +  TIDYSSC   G CT+ WYWLG
Sbjct  97   ----RSTGYTHDGPCEIWLDDVRVLE----------RSPTIDYSSCEKKGGCTMHWYWLG  142

Query  167  VRFLKNEYSWQVYKACVPLSASARRLK  193
            VRFLKN YSWQVYK C+PL+A+ +RL+
Sbjct  143  VRFLKNSYSWQVYKECIPLTAAPKRLR  169

>PPTG_08820
Length=250

 Score = 188 bits (478),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 114/171 (67%), Gaps = 6/171 (4%)

Query  23   TADAHQVVLLpaptyttddkdtkya--pLAFLENQGFETVDDFNAWRRNNGYKTLRAFMD  80
            T DAHQ++L P P +     D      PLAFLE+QGF    DFN WR  +GYK LR FMD
Sbjct  24   TVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMD  83

Query  81   GAKYT--VTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  138
             AKYT  VT GAD  CG T     P+ IP    M+STGYTHDGPC V+LD   VL +DNC
Sbjct  84   RAKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNC  143

Query  139  HEAISGKDYTIDYSSC--TGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSA  187
            HE + GK Y IDYSSC   G CTL W+WLG+RF+K+ +SWQVYK CVPL+A
Sbjct  144  HEKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLTA  194

>PITG_13520
Length=171

 Score = 182 bits (461),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 104/132 (79%), Gaps = 0/132 (0%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ+VLLP P +TT DKDTKY PLAFLENQGF+T  DF AWR  NGYK+LR FMD A
Sbjct  24   TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDRA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KY VT GAD+ CGFT+    PQ IP+G AMRSTGYTHDGPCEVWLD   VL  DNCHE  
Sbjct  84   KYDVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKF  143

Query  143  SGKDYTIDYSSC  154
             GKDYT+DYSSC
Sbjct  144  PGKDYTVDYSSC  155

>PPTG_14255
Length=268

 Score = 182 bits (463),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 104/137 (76%), Gaps = 0/137 (0%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            L+FLE +G+ T ++F  ++ +NGYK+LR FMD AKY+VTDGAD  CG+T+    PQ IP 
Sbjct  49   LSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDNAKYSVTDGADQACGWTDPKGVPQQIPE  108

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVR  168
               MR++GYTHDGPCE+++  T  L++ NCHE+I+ + + +DYS+C  +C L WYWLGVR
Sbjct  109  DGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGVR  168

Query  169  FLKNEYSWQVYKACVPL  185
            +LK +YSWQVYK C+PL
Sbjct  169  YLKKKYSWQVYKECIPL  185

>PITG_10499
Length=323

 Score = 184 bits (467),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 103/143 (72%), Gaps = 4/143 (3%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKY--TVTDGADYHCGFTNADAAPQAI  106
            LAFLE+QGF   +DFN WR  NGYK LR FMD AKY  +VT GAD  CG T     P+ I
Sbjct  22   LAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTPGADQTCGLTELKGPPRPI  81

Query  107  PSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSC--TGTCTLRWYW  164
            P   AMRSTGYTHDGPC ++LD   V+ +DNCHE+I G+ Y ID+SSC   G CTL W+W
Sbjct  82   PKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYKIDFSSCQKKGGCTLYWFW  141

Query  165  LGVRFLKNEYSWQVYKACVPLSA  187
            LG+RF+K+ +SWQVYK C+ L+A
Sbjct  142  LGIRFVKSRWSWQVYKECISLTA  164

>PYU1_G001739
Length=266

 Score = 181 bits (460),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 113/166 (68%), Gaps = 1/166 (1%)

Query  25   DAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-  83
            DAHQ+++ P P +  D KD ++ PLAFLENQG  T  D   + +  GY  LRA MD  K 
Sbjct  22   DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKL  81

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            Y V   A + CG+T+     Q IP+   +RSTGYTHDGPCEVWLD  +V++ DNCH+   
Sbjct  82   YEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFP  141

Query  144  GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
            GK + +DYSSC G+CTLRWYWLGVR+LK  YSWQ+YK CV LS +A
Sbjct  142  GKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNA  187

>PHYCA_510817
Length=188

 Score = 178 bits (451),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 101/137 (74%), Gaps = 0/137 (0%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            L+FLE +GF+T ++F  ++ +NGYK+LR FM+ AKY V+DGAD  CG+++    PQ IPS
Sbjct  50   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFMEKAKYKVSDGADQACGWSDPKGIPQQIPS  109

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVR  168
               MR++GYTHDGPCE+W+     L++ NCHE+I  + + +DYS C  +C L WYWLGVR
Sbjct  110  DGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGVR  169

Query  169  FLKNEYSWQVYKACVPL  185
             LK +YSWQVYK C+PL
Sbjct  170  KLKGKYSWQVYKECIPL  186

>PPTG_14254
Length=188

 Score = 175 bits (444),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 0/137 (0%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            L+FLE +GF+T ++F  ++ +NGYK+LR FMD AKY VT+GAD  CG+T+    PQ IP 
Sbjct  50   LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMDRAKYKVTEGADQACGWTDPKGIPQKIPE  109

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVR  168
               MR+TGYTHDGPCE+++     L++ NCHE+I  + + +DYS C  +C L WYWLGVR
Sbjct  110  DGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGVR  169

Query  169  FLKNEYSWQVYKACVPL  185
             LK +YSWQVYK C+P+
Sbjct  170  KLKGKYSWQVYKECIPI  186

>PHYSO_341596
Length=231

 Score = 174 bits (442),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 92/126 (73%), Gaps = 8/126 (6%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ+VLL   T            LAFLENQGFET +DF +WR  NGYK+LR FMD A
Sbjct  24   TADAHQIVLLDKDTKYNP--------LAFLENQGFETQEDFASWRDKNGYKSLRDFMDKA  75

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVT GAD+ CGFT+    PQ IP+G+AMRSTGYTHDGPCEVWLD T+VL  DNCHE  
Sbjct  76   KYTVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKF  135

Query  143  SGKDYT  148
             GKDYT
Sbjct  136  PGKDYT  141

>PHYSO_417649
Length=185

 Score = 173 bits (438),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 101/137 (74%), Gaps = 0/137 (0%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            L+FLE +GF+T ++F  ++ +NGYK+LR FM+ AKY +TDGAD  CG+T+    PQ IP 
Sbjct  48   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFMERAKYKLTDGADQACGWTDPKGIPQQIPE  107

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVR  168
               MR++GYTHDGPCE+++     L++ NCHE+I+ + + +DYS C  +C L WYWLGVR
Sbjct  108  DGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGVR  167

Query  169  FLKNEYSWQVYKACVPL  185
             LK ++SWQVYK C+PL
Sbjct  168  KLKGKFSWQVYKECIPL  184

>PYAP_22273
Length=268

 Score = 172 bits (435),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 110/165 (67%), Gaps = 3/165 (2%)

Query  25   DAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA-K  83
            +AHQ V  P   YT  D+ T + P A LENQG++T  DFNA+   NGYKTLR FMD    
Sbjct  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  83

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            Y    GA   CG+T+ +A PQ IP+    R++GYTH+GPCE+W+D   V +  NCH  IS
Sbjct  84   YKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDIS  143

Query  144  GKDYT--IDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
             K +T  IDYS+C G C L+WYWLG+R +  +YSWQ+YKAC+PL+
Sbjct  144  EKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188

>PHYKE_9185
Length=281

 Score = 171 bits (434),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 116/168 (69%), Gaps = 5/168 (3%)

Query  23   TADAHQVVLLpaptyttddkdtky-----apLAFLENQGFETVDDFNAWRRNNGYKTLRA  77
            T +AHQVV +P+PT+T  +  +K       PL+FLE +G +T ++F  ++ +N Y +LR 
Sbjct  21   TTEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRD  80

Query  78   FMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  137
            FMD AKY V+DGAD  CG+T+    PQ IP    MR++GYTHDGPCE+++     L++ N
Sbjct  81   FMDKAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLN  140

Query  138  CHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            CHE+I+ + + +DYS+C  +C L WYWLGVR LK  YSWQ+YK C+PL
Sbjct  141  CHESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PYAR_24096
Length=227

 Score = 169 bits (427),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 109/165 (66%), Gaps = 3/165 (2%)

Query  25   DAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AK  83
            +AHQ V LP   YT  +++T + P A LE QG++T  DFNA+ + N YKTLR FMD    
Sbjct  25   EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  84

Query  84   YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            Y    GA + CGFT+  A  Q IP   A R++GYTH+GPCE+W+D  RV   DNCH  IS
Sbjct  85   YKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS  144

Query  144  GKDYT--IDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
               +T  IDYS+C GTC L+WYWLG+R     YSWQ+YKAC+PLS
Sbjct  145  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PHYCA_536934
Length=983

 Score = 180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 101/137 (74%), Gaps = 0/137 (0%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            L+FLE +G+ T ++F  ++ +NGYK LR FMD AKY VTDGAD  CG+++ +  PQ IP 
Sbjct  66   LSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDNAKYAVTDGADQACGWSDPNGIPQQIPE  125

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVR  168
               MR++GYTHDGPCE+W+     L++ NCHE+I+ + + +DYS C  +C L WYWLGVR
Sbjct  126  DGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGVR  185

Query  169  FLKNEYSWQVYKACVPL  185
            +LK +YSWQVYK C+PL
Sbjct  186  YLKKKYSWQVYKECIPL  202

>PYAP_22279
Length=223

 Score = 167 bits (423),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 97/149 (65%), Gaps = 6/149 (4%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AKYTV-TDGADYHCGFTNADAAPQAI  106
            LAFLENQG +  DD   + R  G KTLR FMD  A Y V   GA + CG+T+ + A Q I
Sbjct  43   LAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKVEAAGATFECGYTDPNGARQPI  102

Query  107  PSGNAMRSTGYTHDGPCEVWLDTTRVL--THDNCHEAISGK--DYTIDYSSCTGTCTLRW  162
            PS   MRSTGYTHDGPCEVWLD TRVL  T  +CH+ I      Y ID+S C G C LRW
Sbjct  103  PSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDIGQGMISYKIDFSKCKGNCMLRW  162

Query  163  YWLGVRFLKNEYSWQVYKACVPLSASARR  191
            YWL  R + +++SWQVYK CVPL  SA R
Sbjct  163  YWLAKRKIGSKWSWQVYKQCVPLKGSAAR  191

>PYAP_22278
Length=289

 Score = 167 bits (422),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 114/174 (66%), Gaps = 7/174 (4%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-  81
            + DAHQ V +PAPT+T +D++  + PLAFLENQG +  DD   + R+ G KTLR +MD  
Sbjct  21   SVDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNK  80

Query  82   AKYTV-TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTH--DNC  138
            A Y +   GA + CG+TN + A Q IP    MRSTGYTHDGPCEVWLD TRVL     NC
Sbjct  81   ANYKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNC  140

Query  139  HEAISGK--DYTIDYSSCTGTCTLRWYWLGVRFL-KNEYSWQVYKACVPLSASA  189
            H  +  K   Y ID+S C G C LRWYWLG R +   ++SWQ+YKACVPL  S 
Sbjct  141  HRDVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSG  194

>PHYSO_262732
Length=188

 Score = 162 bits (410),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 110/167 (66%), Gaps = 19/167 (11%)

Query  24   ADAHQVVLLpaptyttddkdtky-----apLAFLENQGFETVDDFNAWRRNNGYKTLRAF  78
            A+AHQVV +P+PT+T  +           PLAFLENQGF+T               LR F
Sbjct  19   AEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT--------------HLRDF  64

Query  79   MDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  138
            MD AKYTVT+GAD  CG+T+     Q IPS   MR++GYTHDGPCE+++     L++ NC
Sbjct  65   MDNAKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNC  124

Query  139  HEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            HE+I+ + + +DYS C  +CTL WYWLGVRFL N+YSWQVYK C+P+
Sbjct  125  HESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  171

>PYIW_18791
Length=194

 Score = 161 bits (407),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 111/166 (67%), Gaps = 3/166 (2%)

Query  24   ADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK  83
            ADAHQ V +P P +T   K T +APL+FLE  G +T +  + + ++ GY TLRA MD +K
Sbjct  19   ADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSK  78

Query  84   -YTVTDGAD-YHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141
             Y     AD + CG+T+     Q IP  + MR+TGYTH GPCEVW+D  RV+  DNCHE 
Sbjct  79   LYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQ  138

Query  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSA  187
            +S     +DYS+C G CT+RWYWLG+R+LK ++SWQVYK C+ L+ 
Sbjct  139  VSNTT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALTG  183

>PHYCA_14368
Length=219

 Score = 162 bits (409),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 106/167 (63%), Gaps = 45/167 (27%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TA+AHQ+VLLP P +TT+DKDTKY PLAFLENQGF+T  DF +WR  N YK+LR FMD A
Sbjct  24   TAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNA  83

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KYTVTDGAD+ CGFT+                                            
Sbjct  84   KYTVTDGADFSCGFTDP-------------------------------------------  100

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
              KDYT+DYSSC GTCTLRWYWLG+RFLKN+YSWQVYKAC+PLS S 
Sbjct  101  --KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSG  145

>PYIR_26546
Length=239

 Score = 157 bits (397),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 110/167 (66%), Gaps = 4/167 (2%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQ-GFETVDDFNAWRRNNGYKTLRAFMDG  81
            TA AHQ+V+LP PT+T + K  ++ P+A+LE Q GF    DFN +  + G+KT+R FMD 
Sbjct  24   TARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDN  83

Query  82   AK-YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCH-  139
             K Y     AD+ CG+T  D  PQ IP  + +R+TGYTH+GPCE+WLD  +V    NCH 
Sbjct  84   DKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHY  143

Query  140  EAISGKDY-TIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            +  SG ++  +D+SSC G CT+ WYW+G+R      SWQ+YK C+PL
Sbjct  144  DVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHYSO_527908
Length=174

 Score = 147 bits (371),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 102/154 (66%), Gaps = 5/154 (3%)

Query  23   TADAHQVVLLpaptyttddkdtky-----apLAFLENQGFETVDDFNAWRRNNGYKTLRA  77
            + DAHQVV +P PT+T  +  +        PLAFLE QGF T  +F  +  +NGYK+LR 
Sbjct  18   SVDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRD  77

Query  78   FMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  137
            FMD   Y+VT GAD  CG+T+ +  PQ IP    MR++G+THD PCE+++     L++ N
Sbjct  78   FMDNGNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPN  137

Query  138  CHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLK  171
            CHE+I+ + + +DYS+C  +C L WYWLGVRF+K
Sbjct  138  CHESITSQPFKLDYSACGDSCVLYWYWLGVRFIK  171

>PHYSO_353401
Length=146

 Score = 144 bits (364),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 92/142 (65%), Gaps = 1/142 (1%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIP  107
            LA+L+ QG  T  +  +W + +GY +LRA +D    Y VT+ A + CG T+     Q IP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  108  SGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGV  167
            S ++ +++GYT DGPCEVWLD T+V    NCH       + IDYS+C  +CTL WYWLG+
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  168  RFLKNEYSWQVYKACVPLSASA  189
            ++++  YSWQVYK CV LS +A
Sbjct  123  KYVEGAYSWQVYKNCVALSKTA  144

>PHYSO_246676
Length=187

 Score = 145 bits (367),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 106/177 (60%), Gaps = 42/177 (24%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            TADAHQ+VLLP P +TT+DK TKY PLAFLENQGF+T +DF AWR+ NGY+TLR FMD A
Sbjct  7    TADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDKA  66

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142
            KY VT GAD+ CGFT+    PQ IP GN MRSTGYTHDG           L H +     
Sbjct  67   KYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG-----------LVHAS-----  110

Query  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANES  199
                                  L +  +KN YSW+VYKAC+PLS S     G + ES
Sbjct  111  ----------------------LVLDGMKNSYSWKVYKACIPLSGSG----GTSQES  141

>PHYCA_537323
Length=200

 Score = 145 bits (366),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 90/142 (63%), Gaps = 1/142 (1%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIP  107
            LA+L+ QG  T  +  +W   +GY +LRA +D    Y VT+ A + CG T+     Q IP
Sbjct  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116

Query  108  SGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGV  167
            + N+ +++GYT DGPCEVWLD T+V    NCH       + +DYSSC  +CTL WYWLG+
Sbjct  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGI  176

Query  168  RFLKNEYSWQVYKACVPLSASA  189
            ++++  YSWQVYK CV L  +A
Sbjct  177  KYVEGIYSWQVYKNCVGLGTAA  198

>PPTG_17123
Length=201

 Score = 145 bits (365),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 1/142 (1%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIP  107
            LA+L+ QG  T  +  +W + +GY +LRA +D    Y VT+ A + CG T+     Q IP
Sbjct  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117

Query  108  SGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGV  167
            + N+ +++GYT DGPCEVWLD T+V +  NCH       + +DYSSC   CTL WYWLG+
Sbjct  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGI  177

Query  168  RFLKNEYSWQVYKACVPLSASA  189
            ++++  YSWQVYK CV LS + 
Sbjct  178  KYIEGIYSWQVYKNCVGLSTAP  199

>PYU1_G001738
Length=226

 Score = 142 bits (359),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 85/138 (62%), Gaps = 1/138 (1%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIP  107
            +A LE QG +T  D + + +  GY  LRA +D  K Y V   A   CG+T+     Q IP
Sbjct  44   VAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIP  103

Query  108  SGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGV  167
              NA  STGY  +GPCEVWLD  +V++  NCH    G ++ +DYSSC G+C LRWYWLG+
Sbjct  104  VTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGI  163

Query  168  RFLKNEYSWQVYKACVPL  185
            + +   YSWQVYK CV L
Sbjct  164  QPVNETYSWQVYKVCVSL  181

>PHYRA_81105
Length=201

 Score = 141 bits (355),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 87/142 (61%), Gaps = 1/142 (1%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIP  107
            LA+L+ QG  T  +   W + +GY +LR+ +D    Y VT+ A + CG T+     Q IP
Sbjct  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117

Query  108  SGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGV  167
            + ++ +S+GYT DGPCEVWLD T+     NCH       + IDYS+C   C LRWYWLG+
Sbjct  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGI  177

Query  168  RFLKNEYSWQVYKACVPLSASA  189
            ++++  YSWQVYK C+ L   A
Sbjct  178  KYVEGAYSWQVYKNCIALGKEA  199

>PITG_18452
Length=856

 Score = 147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 90/139 (65%), Gaps = 1/139 (1%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIP  107
            LA+L+ QG  T  +  +W +  GY +LRA +D    Y VT+ A + CG T+     Q IP
Sbjct  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772

Query  108  SGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGV  167
            + N+ +++GYT DGPCE+WLD T+V +  NCH       + +DYSSC G+C L WYWLG+
Sbjct  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGI  832

Query  168  RFLKNEYSWQVYKACVPLS  186
            ++++  YSWQVYK CV LS
Sbjct  833  KYVEGIYSWQVYKNCVGLS  851

>HYAP_07096
Length=251

 Score = 136 bits (342),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 100/160 (63%), Gaps = 2/160 (1%)

Query  28   QVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTV  86
            QVVL P+P +  DD   +   LA+L+ QG +T  +  +W++ +GY +LRA +D    Y V
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  87   TDGADYHCGFTNADAAP-QAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  145
            +  A + CGFT+  +   Q IP+   + S+GYT DGPCEVW D T+V +  NC       
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  146  DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             + +DYSSC  +CTLRWYWLG++++   YSWQVYK C+ L
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245

>PHYSO_340369
Length=200

 Score = 132 bits (333),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 80/137 (58%), Gaps = 14/137 (10%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            LA+ E+QGF T  +F  W+  NG+KTLR FMD   Y+VT              +PQ IP 
Sbjct  52   LAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNGNYSVT--------------SPQQIPD  97

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVR  168
             N MR+ GYT DGPCE+WLD T   +  +C  ++    YT+DYS C  +C + WY LGV 
Sbjct  98   DNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTLGVA  157

Query  169  FLKNEYSWQVYKACVPL  185
                 YSW+VYK C+PL
Sbjct  158  KPDRVYSWEVYKECIPL  174

>PYIW_18788
Length=244

 Score = 121 bits (304),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 80/140 (57%), Gaps = 2/140 (1%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIP  107
            +A LE+Q   T  D   + +  GY +LRA +D    Y V   + + CG+T+     Q IP
Sbjct  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108

Query  108  SGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGV  167
            +   +R TGY  DGPCE+W+D  ++L+  NC +   G    +DYSSC G CTLRWY L V
Sbjct  109  TNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSV  168

Query  168  -RFLKNEYSWQVYKACVPLS  186
             +     YSW+VYK CV LS
Sbjct  169  SKTTGGSYSWEVYKNCVALS  188

>PYAP_18131
Length=226

 Score = 116 bits (291),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 7/115 (6%)

Query  80   DGAKYTV-TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHD--  136
            D A Y V   GA + CG T+ +   Q IP    MRSTG+THDG   VW+D TRVL     
Sbjct  3    DKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSKLG  60

Query  137  NCHEAISGK--DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
            NCH++I      Y ID+S C G C +RWYWLG+R L  ++SWQVYKAC+P+ AS 
Sbjct  61   NCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASG  115

>PYU1_G007476
Length=195

 Score = 110 bits (274),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 75/139 (54%), Gaps = 16/139 (12%)

Query  60   VDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGN----AMRST  115
            ++DF    +  GYKTLR+F++        GA   CG+T  +  P+AIP       A  + 
Sbjct  63   MNDFARISKQKGYKTLRSFLE------NKGAS--CGYTEPNTTPRAIPRDGKVIFAHSNV  114

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAISGKD--YTIDYSSCTGTCTLRWYWLGVRFLKNE  173
            G+ H GPCE+WLD   +L  DNC +A  G      +D+SSC GTC LR YWLG  F    
Sbjct  115  GFVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLG--FQDQG  172

Query  174  YSWQVYKACVPLSASARRL  192
              WQ YK CVP+    +RL
Sbjct  173  QRWQTYKYCVPVKKGGKRL  191

>PYIR_16435
Length=304

 Score = 109 bits (272),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 76/127 (60%), Gaps = 13/127 (10%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-STGYTHD  120
            +F    +  GY TLR++++  K T+       CG TN DA P+AIPS N ++ S    H 
Sbjct  66   NFATVSKEKGYSTLRSYIED-KGTL-------CGRTNPDATPKAIPSDNTVKFSRAIVHP  117

Query  121  GPCEVWLDTTRVLTHDNCHEAISGK--DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            GPCE+WLD  RV+  DNC      K   + ID+SSC G+C LRW+WLG++   +   WQV
Sbjct  118  GPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQV  175

Query  179  YKACVPL  185
            YK CVPL
Sbjct  176  YKNCVPL  182

>PPTG_04622
Length=273

 Score = 107 bits (268),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 79/137 (58%), Gaps = 13/137 (9%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            + + + +NGY  +RA +D      TD    +CGFT+ DA P+  P+ G+A  S G  H G
Sbjct  69   YTSLKESNGYSDIRALLDSD----TDLYGANCGFTDPDATPKDPPTTGDATFSRGMVHAG  124

Query  122  PCEVWLDTTRVLTHDNCHEAISGKDY-------TIDYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD T VL++D+C  A              +DYSSC TG C LR+YWL  + + ++
Sbjct  125  PCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSK  184

Query  174  YSWQVYKACVPLSASAR  190
              WQVYK CVPL+  A 
Sbjct  185  MVWQVYKDCVPLTGPAE  201

>PYVX_18179
Length=147

 Score = 104 bits (259),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 94/179 (53%), Gaps = 61/179 (34%)

Query  23   TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
             ADAHQ V+LP PT+T++D D  Y+PLAFLE+QGF T +DF                   
Sbjct  24   VADAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDF-------------------  64

Query  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRST-GYTHDGPCEVWLDTTRVLTHDNCHEA  141
                                       N+ RS  GY          DT R        +A
Sbjct  65   ---------------------------NSWRSANGY----------DTLRAFMD----QA  83

Query  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESA  200
            +SGKD  +DYSSC+G+CTL W+W+GVR+LK  YSWQVYK CVPLS SAR L+GAAN SA
Sbjct  84   VSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASA  142

>PHYRA_74651
Length=344

 Score = 108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 79/133 (59%), Gaps = 13/133 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            + + + +NGY  +R  +D    T   GAD  CGFT+ +A P+  PS G+A  S G  H G
Sbjct  69   YTSLKESNGYSDIRTLLDSD--TSLYGAD--CGFTDPNATPKDPPSTGDATFSRGMVHAG  124

Query  122  PCEVWLDTTRVLTHDNCHEAISGKDY-------TIDYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD T+VL++DNC  A              +DYSSC +G CTLR+YWL  + L + 
Sbjct  125  PCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSS  184

Query  174  YSWQVYKACVPLS  186
              WQVYK CVPL+
Sbjct  185  TVWQVYKNCVPLT  197

>PHYSO_342364
Length=194

 Score = 105 bits (261),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 81/139 (58%), Gaps = 14/139 (10%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++V  FN+ + ++ YK LR  +D    T   G +  CG+TN +  PQ IP+ G A+ S G
Sbjct  61   KSVQVFNSLKTSHNYKDLRTLLDN---TAVYGPN--CGYTNPNGTPQPIPTNGKAIFSRG  115

Query  117  YTHDGPCEVWLDTTRVLTHDNC-----HEAISGK-DYTIDYSSCT--GTCTLRWYWLGVR  168
              H GPCE+WLD  +V+  D+C     H  ++ K ++ +DYS C   G C +R+YWLG +
Sbjct  116  LIHTGPCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQ  175

Query  169  FLKNEYSWQVYKACVPLSA  187
             L  +  WQ YK C+PL A
Sbjct  176  ALGKKTVWQTYKNCIPLKA  194

>PHYRA_73607
Length=343

 Score = 104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 80/136 (59%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +++ + +NGY  +R  +D    T   GAD  CGFTN DA  +  P+ G+A  S G  H G
Sbjct  69   YSSLKSSNGYSDIRTLLDSD--TSLYGAD--CGFTNPDATAKDPPTTGDATFSRGMVHVG  124

Query  122  PCEVWLDTTRVLTHDNCHEAI-SGKDYT------IDYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD T+VL++DNC  A   G   T      +DYSSC T  C LR+YWL  + + + 
Sbjct  125  PCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSS  184

Query  174  YSWQVYKACVPLSASA  189
              WQVYK CVPL+  A
Sbjct  185  MVWQVYKNCVPLTGPA  200

>PYAP_24689
Length=252

 Score = 102 bits (253),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 78/143 (55%), Gaps = 12/143 (8%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-STGYTHDG  121
            ++A R+ +G KTLRAF++ +K  V       CG TN +A  + IP    ++  +   H G
Sbjct  64   YDAVRKKHGVKTLRAFLE-SKGPV-------CGSTNPNAKRKPIPRDGLIKFGSSMEHPG  115

Query  122  PCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYK  180
            PCE+W D TRV    +C++   S   + IDYS C G C LR+YWLG++       WQ YK
Sbjct  116  PCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGGKRWQSYK  173

Query  181  ACVPLSASARRLKGAANESAAIE  203
             CVPL    R L+   +E A  E
Sbjct  174  NCVPLGNDKRMLEEGGDEVAETE  196

>PHYRA_78689
Length=296

 Score = 101 bits (252),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 78/137 (57%), Gaps = 14/137 (10%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++VD F + +  N +K L+  MD    T   GAD  CGFT+ D  PQ IP+ G A  S  
Sbjct  61   QSVDTFKSLKTANNFKDLKTLMDD---TSVYGAD--CGFTDPDGTPQPIPTDGKATFSRA  115

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYWLGVR  168
              H GPCE+WLD T+VL  D+C      ++      + +DYSSC +G C  +R+YWL  +
Sbjct  116  LVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQ  175

Query  169  FLKNEYSWQVYKACVPL  185
             L ++  WQ YK C+PL
Sbjct  176  GLDSKTVWQSYKDCIPL  192

>PYIW_19151
Length=248

 Score = 100 bits (248),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 81/131 (62%), Gaps = 13/131 (10%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-STGYTHD  120
            +F A  +  G+ TLR++++        GA   CGFT+   +P+AIP+   +R S    H 
Sbjct  60   NFAAAAKEKGFSTLRSYLE------DKGA--VCGFTDPKVSPRAIPADRTIRFSRDIPHP  111

Query  121  GPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            GPCE+++D TRV  +D+C  A +G    + +D+S C G C +R+YWLG++   +   WQV
Sbjct  112  GPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQV  169

Query  179  YKACVPLSASA  189
            YK+CVP+S+SA
Sbjct  170  YKSCVPVSSSA  180

>PHYRA_73584
Length=287

 Score = 100 bits (250),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 80/136 (59%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +++ +++NGY  +R  +D    T   GA  +CGFTN DA  +  P+ G+A  S G  H G
Sbjct  66   YSSLKKSNGYSDIRTLLDSD--TTLYGA--NCGFTNPDATAKDPPTTGDATFSRGMVHAG  121

Query  122  PCEVWLDTTRVLTHDNCHEAISGKDY-------TIDYSSCTGT-CTLRWYWLGVRFLKNE  173
            PCE+WLD T VL++D+C  A              +DYSSC+ + C LR+YWL  + + ++
Sbjct  122  PCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSK  181

Query  174  YSWQVYKACVPLSASA  189
              WQVYK CVPL+  A
Sbjct  182  TVWQVYKDCVPLTGPA  197

>PITG_04948
Length=232

 Score = 99.4 bits (246),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 76/136 (56%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   + +N  K +R  +D    T   GAD  CG+TN D +P+  P+ G A  S G  H G
Sbjct  67   YKELKASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVSPKDPPTDGTATFSRGIVHAG  122

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC +G C LR+YWL ++ L  +
Sbjct  123  PCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGK  182

Query  174  YSWQVYKACVPLSASA  189
              WQVYK C+PLS  A
Sbjct  183  TYWQVYKNCIPLSGPA  198

>PYIW_18792
Length=125

 Score = 95.9 bits (237),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 68/101 (67%), Gaps = 0/101 (0%)

Query  25   DAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKY  84
            DAHQ V LPAPT+T   +  ++ PLAFLE QG++   DF A+ ++ GYK LR FMD  K 
Sbjct  22   DAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKA  81

Query  85   TVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEV  125
               DG ++ CG+++    PQ IP+G A+RSTGYTHDGP  +
Sbjct  82   YKVDGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PPTG_04618
Length=326

 Score = 100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 70/136 (51%), Gaps = 14/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            F      N YK +R+ MDG      D     CGFT+    P   PS G A  S G  H G
Sbjct  67   FKELAPKNNYKDVRSLMDGNPVYGED-----CGFTDPKGTPSEPPSDGTATFSRGIVHAG  121

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC +G C LR+YWL ++ L  +
Sbjct  122  PCEIWLDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGK  181

Query  174  YSWQVYKACVPLSASA  189
              WQ YK C+PL+  A
Sbjct  182  TVWQAYKNCIPLTGPA  197

>PYIR_16444
Length=182

 Score = 97.4 bits (241),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 68/124 (55%), Gaps = 13/124 (10%)

Query  68   RNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDGPCEVW  126
            +  G+ TLR++++        GA   CG TNA A P+ IPS G    S    H GPCE+W
Sbjct  69   KQKGFPTLRSYIE------NKGAI--CGKTNAKATPKPIPSDGKVHFSRAIVHPGPCELW  120

Query  127  LDTTRVLTHDNCHEAISGKD--YTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVP  184
            LD  RV  +DNC      K   + ID+SSC G C LR++WLG++       WQVYK CVP
Sbjct  121  LDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCVP  178

Query  185  LSAS  188
            +   
Sbjct  179  VKGK  182

>PHYCA_531163
Length=314

 Score = 100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            + + + +NGY  +R  +D    T   GAD  CG+TNADA  +  PS G+A  S G  H G
Sbjct  69   YTSLKSSNGYSDIRTLLDSD--TSLYGAD--CGYTNADATAKDPPSTGDATFSRGMVHVG  124

Query  122  PCEVWLDTTRVLTHDNCHEA-----ISGKDY--TIDYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD T VL++D+C  A     +  K     +DYSSC T  C LR+YWL  + + + 
Sbjct  125  PCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSA  184

Query  174  YSWQVYKACVPLSASA  189
              WQVYK CVPL+  A
Sbjct  185  IVWQVYKDCVPLTGPA  200

>PHYKE_10578
Length=239

 Score = 98.2 bits (243),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 75/161 (47%), Gaps = 24/161 (15%)

Query  56   GFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM---  112
            G + V  F       G       +D  K       D  CGFT ADA PQ +PS   +   
Sbjct  55   GGDQVGKFKTMATEKGMSVKDVILDMVK-------DKKCGFTRADADPQPVPSDGKLVWR  107

Query  113  --RSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRW  162
               + G+TH GPCEV++D   VL  DNC +   G         + TIDYSSC G C L +
Sbjct  108  GSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSF  167

Query  163  YWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIE  203
            YWLG    +NE  WQ Y  CVPL+ S +      + + A E
Sbjct  168  YWLG---FQNE-QWQSYVNCVPLTGSGKSTGAQPSGNQATE  204

>PHYSO_484051
Length=285

 Score = 99.4 bits (246),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 76/133 (57%), Gaps = 13/133 (10%)

Query  67   RRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDGPCEV  125
            + +NGY  +R  +D    T   GAD  CGFTN DA+P+  P+ G+   S    H  PCE+
Sbjct  73   KESNGYSDIRTLLDSD--TSLYGAD--CGFTNPDASPKDPPTTGDPTFSRCMVHASPCEI  128

Query  126  WLDTTRVLTHDNCHEAIS-GKDYT------IDYSSC-TGTCTLRWYWLGVRFLKNEYSWQ  177
            WLD T VL++D+C  A   G   T      +DYSSC T  C LR+YWL  + + ++  WQ
Sbjct  129  WLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  188

Query  178  VYKACVPLSASAR  190
            VYK CVPL+  A 
Sbjct  189  VYKDCVPLTGPAE  201

>PHYCA_127270
Length=279

 Score = 98.6 bits (244),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 75/137 (55%), Gaps = 14/137 (10%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++VD F + +  N +K L+  MD    T   GAD  CGFT+ +  PQ IP+ G A  S  
Sbjct  61   QSVDTFKSLKAANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRA  115

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYWLGVR  168
              H GPCE+WLD  +VL  D+C      K+      + +DYSSC  G C  +R+YWL  +
Sbjct  116  LVHVGPCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQ  175

Query  169  FLKNEYSWQVYKACVPL  185
             L  +  WQ YK C+PL
Sbjct  176  GLSKKTVWQSYKDCIPL  192

>PHYCA_130365
Length=266

 Score = 98.6 bits (244),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 72/133 (54%), Gaps = 14/133 (11%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            F     +N YK +R+ MDG      D     CGFT+ +  P   P+ G A  S G  H G
Sbjct  66   FKELAASNNYKDVRSMMDGNSVYGED-----CGFTDPNGTPVDPPTDGTATFSRGIVHAG  120

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC +G C LR+YWLG++ L  +
Sbjct  121  PCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGK  180

Query  174  YSWQVYKACVPLS  186
              WQ YK C+PL+
Sbjct  181  TVWQAYKNCIPLT  193

>PITG_04949
Length=337

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 69/136 (51%), Gaps = 14/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            F      N +K +R+ MDG            CGFT+    P   PS G A  S G  H G
Sbjct  67   FKELAPKNNFKDVRSLMDGNPVFG-----EECGFTDPKGKPSEPPSDGTATFSRGIVHAG  121

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSCT-GTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC  G C LR+YWL ++ LK +
Sbjct  122  PCEIWLDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGK  181

Query  174  YSWQVYKACVPLSASA  189
              WQ YK C+PL+  A
Sbjct  182  TVWQAYKNCIPLTGPA  197

>PYAP_18711
Length=210

 Score = 96.7 bits (239),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 74/136 (54%), Gaps = 12/136 (9%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-ST  115
            F T   ++A R+  G K LRAF++      + G +  CG TN +A  + IPS   ++  +
Sbjct  55   FRTGAQYDAERKKRGIKNLRAFLE------SKGPE--CGRTNPNAKRKPIPSDGLIKFGS  106

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
               H GPCEVW D T V +  +C +   S   + IDYS C G C LR+YWLG++      
Sbjct  107  SMEHPGPCEVWFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPLSASAR  190
             WQ YK CVP+ ++ +
Sbjct  165  RWQSYKNCVPIGSATK  180

>PHYSO_483955
Length=320

 Score = 99.0 bits (245),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 71/136 (52%), Gaps = 14/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            F      N YK +R+ MDG      D     CGFT+    P A P+ G A  S G  H G
Sbjct  67   FKELSAANNYKDVRSLMDGNPVYGED-----CGFTDPKGKPVAPPTDGTATFSRGIVHAG  121

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC +G C LR+YWL ++ L  +
Sbjct  122  PCEIWLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGK  181

Query  174  YSWQVYKACVPLSASA  189
              WQ YK C+PL+  A
Sbjct  182  TVWQAYKNCIPLTGPA  197

>PYU1_G005324
Length=191

 Score = 95.9 bits (237),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 73/137 (53%), Gaps = 12/137 (9%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-ST  115
            F T   + A     GYK L++F+D    T        CG T ++A  +AIP    ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
               H GPCE+WL  TR   +D+C +   S   + ID+S+C G C LR+YWLG++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPLSASARR  191
             WQ YK CVPL +S  R
Sbjct  165  RWQSYKNCVPLKSSKLR  181

>PYU1_G005326
Length=191

 Score = 95.9 bits (237),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 73/137 (53%), Gaps = 12/137 (9%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-ST  115
            F T   + A     GYK L++F+D    T        CG T ++A  +AIP    ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
               H GPCE+WL  TR   +D+C +   S   + ID+S+C G C LR+YWLG++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPLSASARR  191
             WQ YK CVPL +S  R
Sbjct  165  RWQSYKNCVPLKSSKLR  181

>PYU1_G005328
Length=191

 Score = 95.9 bits (237),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 73/137 (53%), Gaps = 12/137 (9%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-ST  115
            F T   + A     GYK L++F+D    T        CG T ++A  +AIP    ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
               H GPCE+WL  TR   +D+C +   S   + ID+S+C G C LR+YWLG++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPLSASARR  191
             WQ YK CVPL +S  R
Sbjct  165  RWQSYKNCVPLKSSKLR  181

>PPTG_04647
Length=327

 Score = 99.0 bits (245),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 77/137 (56%), Gaps = 13/137 (9%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   + +NGY  +R  +D    + TD     CG+TN DA  +  P+ G+A  S G  H G
Sbjct  68   YTTLKSSNGYSDIRTLLD----SDTDLYGADCGYTNPDATAKDPPTTGDATFSRGMVHVG  123

Query  122  PCEVWLDTTRVLTHDNCHEA-----ISGKDY--TIDYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD T VL++DNC  A     +  K     +DYSSC T  C LR+YWL  + + ++
Sbjct  124  PCEIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSK  183

Query  174  YSWQVYKACVPLSASAR  190
              WQVYK CVPL+  A 
Sbjct  184  MVWQVYKDCVPLTGPAS  200

>PYIR_16443
Length=275

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 75/125 (60%), Gaps = 14/125 (11%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-STGYTHD  120
            +F    +  G++TLR++++        GA   CG TN +A+P+AIPS + ++ S    H 
Sbjct  63   NFATVSKQKGFETLRSYIEDK------GA--LCGRTNPNASPKAIPSDSVVKFSRAIVHP  114

Query  121  GPCEVWLDTTRVLTHDNCHEAISGKDYT--IDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            GPCE+WLD  RV+  DNC      K  T  ID+SSC G+C LRW+WLG++   +   WQV
Sbjct  115  GPCEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQV  172

Query  179  Y-KAC  182
            Y K+C
Sbjct  173  YSKSC  177

>PPTG_04619
Length=276

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   + +N  K +R  +D    T   GAD  CG+TN D  P+  P+ G A  S G  H G
Sbjct  67   YKELKASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAG  122

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC +G C  R+YWL ++ L  +
Sbjct  123  PCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGK  182

Query  174  YSWQVYKACVPLSASA  189
              WQVYK C+PLS  A
Sbjct  183  TYWQVYKNCIPLSGPA  198

>PHYSO_485524
Length=278

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 80/146 (55%), Gaps = 16/146 (11%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   + +N  K +R  +D    T   GA  +CG+TN DA P+  P+ G A  S G  H G
Sbjct  67   YKELKDSNNAKDIRTLLDSD--TKLYGA--NCGYTNPDATPEDPPTDGTATFSRGIVHAG  122

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC +G C  R+YWL ++ L  +
Sbjct  123  PCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGK  182

Query  174  YSWQVYKACVPLSASARRLKGAANES  199
              WQVYK C+PLS  A    G A++S
Sbjct  183  TYWQVYKNCIPLSGPA---GGGASQS  205

>PHYRA_73582
Length=326

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 77/148 (52%), Gaps = 18/148 (12%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            F      N YK L+  MDG ++    G D  CGFT+ +  P   P+ G A  S G  H G
Sbjct  67   FKELSATNNYKDLKTLMDGPEF----GED--CGFTDPNGTPSDPPTDGTATFSRGIVHAG  120

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYS C  G C LR+YWL ++ L  +
Sbjct  121  PCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGK  180

Query  174  YSWQVYKACVPLSASARRLKGAANESAA  201
              WQ YK C+PL+  A    G A+++A 
Sbjct  181  AVWQSYKNCIPLTGPA---GGGASQTAP  205

>PHYRA_73606
Length=366

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 77/134 (57%), Gaps = 13/134 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   + +NGY  +R  +D    T   GAD  CG+TN DA  +  P+ G+A  S G  H G
Sbjct  69   YTGLKSSNGYSDIRTLLDSD--TSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVG  124

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYT------IDYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD T VL++D+C  A   G   T      +DYSSC T  C LR+YWL  + + +E
Sbjct  125  PCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSE  184

Query  174  YSWQVYKACVPLSA  187
              WQVYK CVPL+ 
Sbjct  185  IVWQVYKDCVPLTG  198

>PHALS_03176
Length=207

 Score = 94.7 bits (234),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 75/146 (51%), Gaps = 15/146 (10%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++V  F   +  N +K L+  MD + +    GA   CGF++    PQ IP  G A  S  
Sbjct  61   KSVKTFQKLKAANKFKDLKTLMDTSAF----GA--KCGFSDPKGKPQPIPKDGKATFSRA  114

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYWLGVR  168
              H GPCE+WLD  +VL  D+C+      D      + +DYSSC  G C  +R+YWL  +
Sbjct  115  IVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQ  174

Query  169  FLKNEYSWQVYKACVPLSASARRLKG  194
             +  +  WQ YK C+PL  S+ +  G
Sbjct  175  GVNGKTVWQSYKNCIPLQGSSGKNGG  200

>PHYSO_438103
Length=238

 Score = 95.5 bits (236),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 73/136 (54%), Gaps = 14/136 (10%)

Query  59   TVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGY  117
            +V+ F + +  N +K L+  MD       D     CGFT+ +  PQ IP+ G A  S   
Sbjct  61   SVEVFKSLKSANNFKDLKTLMDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRAL  115

Query  118  THDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSCT-GTCT-LRWYWLGVRF  169
             H GPCE+WLD T+VL  D+C      ++      + +DYSSC  G C  +R+YWL  + 
Sbjct  116  VHVGPCEIWLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQG  175

Query  170  LKNEYSWQVYKACVPL  185
            L ++  WQ YK C+PL
Sbjct  176  LDSKTVWQSYKDCIPL  191

>PHYCA_534473
Length=1050

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 77/136 (57%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            + + + +NGY  +R  +D    + TD    +CGFT+ D   +  P+ G+A  S G  H G
Sbjct  841  YASLKESNGYSDIRTLLD----SDTDLYGANCGFTDPDVTAKDPPTTGDATFSRGMVHAG  896

Query  122  PCEVWLDTTRVLTHDNCHEAISGKDY-------TIDYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD T+VL++D+C  A              +DYSSC T  C LR+YWL  + + ++
Sbjct  897  PCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSK  956

Query  174  YSWQVYKACVPLSASA  189
              WQVYK CVPL+  A
Sbjct  957  IVWQVYKDCVPLTGPA  972

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 71/133 (53%), Gaps = 13/133 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   +++N  K +R  +D        G D  CG T+  A P+  PS G+A  S G  H G
Sbjct  536  YKQLKKSNNVKDIRTMIDADPKLY--GED--CGNTDPKAKPKDPPSTGDATFSRGIVHAG  591

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSCT-GTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC  G C  R+YWL ++   ++
Sbjct  592  PCEIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSK  651

Query  174  YSWQVYKACVPLS  186
              WQVYK C+PL+
Sbjct  652  TLWQVYKNCIPLT  664

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 59/118 (50%), Gaps = 14/118 (12%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            F      N YK +R  MDG      D     CGFT+    P   P+ G A  S G  H G
Sbjct  67   FKELAAKNNYKDVRTLMDGNPVYGED-----CGFTDPKGTPVDPPTDGTATFSRGIVHAG  121

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLK  171
            PCE+WLD   VL +D+C  A   G   TI      DYSSC +G C LR+YWL ++ LK
Sbjct  122  PCEIWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLK  179

 Score = 75.9 bits (185),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 63/117 (54%), Gaps = 13/117 (11%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   + +N  K +R  +D    T   GAD  CG+TN D  P+  P+ G A  S G  H G
Sbjct  273  YKELKASNNAKDIRTLLDSD--TKLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAG  328

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFL  170
            PCE+WLD   VL++D+C  A   G   TI      DYSSC +G C  R+YWL ++ L
Sbjct  329  PCEIWLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  385

>PHYRA_73583
Length=630

 Score = 98.6 bits (244),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 77/136 (57%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   + +N  K +R  +D    T   GA  +CG+TN DA+P+  PS G+A  S G  H G
Sbjct  67   YKELKASNNAKDIRTLLDSD--TTLYGA--NCGYTNPDASPKDPPSTGDATFSRGIVHAG  122

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC +G C  R+YWL ++ L  +
Sbjct  123  PCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGK  182

Query  174  YSWQVYKACVPLSASA  189
              WQVYK C+PLS  A
Sbjct  183  TWWQVYKNCIPLSGPA  198

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 74/136 (54%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   + +N  K +R  +D    T   GAD  CGFT+  A P+  PS G+A  S G  H G
Sbjct  368  YKELKASNNIKDIRTMIDSD--TKLYGAD--CGFTDPKATPKDPPSTGDATFSRGMVHAG  423

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYT------IDYSSCT-GTCTLRWYWLGVRFLKNE  173
            PCEVWLD   VL +D+C  A   G   T      IDYSSC  G C  R++WL ++   ++
Sbjct  424  PCEVWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSK  483

Query  174  YSWQVYKACVPLSASA  189
              WQVYK CVPLS  A
Sbjct  484  TWWQVYKNCVPLSGPA  499

>PHYSO_533903
Length=208

 Score = 94.0 bits (232),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 79/139 (57%), Gaps = 15/139 (11%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++V+ F + +  N +K L+  +D       D     CGFT+ +  PQ IP+ G A+ S G
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  116

Query  117  YTHDGPCEVWLDTTRVLTHDNC-----HEAISGK-DYTIDYSSC-TGTC-TLRWYWLGVR  168
              H GPCE WLD  +VL  D+C     H  ++ K ++ IDYSSC  G C  +R+YWLG +
Sbjct  117  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  176

Query  169  FLKNEYS-WQVYKACVPLS  186
             L ++ + WQ YK C+PL 
Sbjct  177  ALDDKKTVWQTYKDCIPLQ  195

>PHYCA_12942
Length=353

 Score = 97.1 bits (240),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 65/138 (47%), Gaps = 19/138 (14%)

Query  56   GFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR--  113
            G + V  F       G       +D  K       D  CG+T ADA PQ IPS   ++  
Sbjct  53   GGDQVGKFKTMAAERGMSVKDVILDMVK-------DKKCGYTVADAPPQPIPSDGMVKWA  105

Query  114  ---STGYTHDGPCEVWLDTTRVLTHDNCHEAISG---KDYTIDYSSCTGTCTLRWYWLGV  167
                 G+TH GPCE+++D   VL  DNC E   G    D  IDYSSC G C L  YWLG 
Sbjct  106  GNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGF  165

Query  168  RFLKNEYSWQVYKACVPL  185
            +  +    WQ Y  CVPL
Sbjct  166  QNAQ----WQAYVNCVPL  179

>PHYKE_2937
Length=366

 Score = 97.1 bits (240),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 79/136 (58%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            + + + +NGY  +R  +D    T   GAD  CG+TN DA  +  P+ G+A  S G  H G
Sbjct  73   YTSLKSSNGYSDIRTLLD--SDTSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVG  128

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYT------IDYSSCTGT-CTLRWYWLGVRFLKNE  173
            PCE+WLD T VL++D+C  A   G   T      +DYSSC+ + C LR+YWL  + + + 
Sbjct  129  PCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSS  188

Query  174  YSWQVYKACVPLSASA  189
              WQVYK CVPL+  A
Sbjct  189  MVWQVYKDCVPLTGPA  204

>PHYSO_340333
Length=284

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 74/136 (54%), Gaps = 14/136 (10%)

Query  59   TVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGY  117
            +VD F A +  N +K L+  MD    T   GAD  CGFT+ +  PQ IP+ G A  S   
Sbjct  62   SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAI  116

Query  118  THDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYWLGVRF  169
             H GPCE+WLD  +VL  D+C      ++      + +DYSSC  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  176

Query  170  LKNEYSWQVYKACVPL  185
            +  +  WQ YK C+PL
Sbjct  177  VDGKTVWQSYKDCIPL  192

>PHYSO_340332
Length=295

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 74/136 (54%), Gaps = 14/136 (10%)

Query  59   TVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGY  117
            +VD F A +  N +K L+  MD    T   GAD  CGFT+ +  PQ IP+ G A  S   
Sbjct  62   SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAI  116

Query  118  THDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYWLGVRF  169
             H GPCE+WLD  +VL  D+C      ++      + +DYSSC  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  176

Query  170  LKNEYSWQVYKACVPL  185
            +  +  WQ YK C+PL
Sbjct  177  VDGKTVWQSYKDCIPL  192

>PYU1_G014690
Length=295

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 75/128 (59%), Gaps = 15/128 (12%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-STGYTHD  120
            +F    +  G+ TLR++++        GA   CG T+ +A P+AIPS N +  S    H 
Sbjct  62   NFAKVSKEKGFDTLRSYIEDK------GA--LCGKTDPNATPKAIPSDNKVHFSRPIVHP  113

Query  121  GPCEVWLDTTRVLTHDNCHEAISGKD---YTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQ  177
            GPCE+WLD  RV+  D+C EA  G +   + ID+SSC   C LR++WLG++   +   WQ
Sbjct  114  GPCEIWLDDKRVMQDDDC-EATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQ  170

Query  178  VYKACVPL  185
            VYK CVPL
Sbjct  171  VYKNCVPL  178

>PYVX_18175
Length=147

 Score = 91.7 bits (226),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 2/62 (3%)

Query  143  SGK--DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESA  200
            SGK  D  IDYSSC G+CTL WYW+GVR+LK  YSWQVYK CVPLS SAR L+ A+NESA
Sbjct  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESA  141

Query  201  AI  202
             I
Sbjct  142  LI  143

 Score = 75.5 bits (184),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)

Query  23  TADAHQVVLLpaptyttddkdtkyapLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82
            ADAHQ V+LP P++TT D+D  Y+PLAFLENQGF+T +DF+AWRR NGYKTLR+FMD  
Sbjct  24  VADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG  83

Query  83  KYTVT  87
           KYT T
Sbjct  84  KYTDT  88

>PHALS_05392
Length=367

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 70/136 (51%), Gaps = 14/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            F      N +K +R+ MDG      D     CG+T+ +  P A PS G A  S G  H G
Sbjct  150  FKELATANNFKDVRSLMDGNPVYGED-----CGYTDPNGTPVAPPSNGEATFSRGIVHAG  204

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSCTGT-CTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC    C LR+YWL ++ L  +
Sbjct  205  PCEIWLDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGK  264

Query  174  YSWQVYKACVPLSASA  189
              WQ YK C+PL+  A
Sbjct  265  TVWQAYKNCIPLNGPA  280

>PYVX_14662
Length=540

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 75/141 (53%), Gaps = 16/141 (11%)

Query  54   NQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAM  112
            NQG  +VD + +     G   +R+ +D       D     CGFT+ D   Q IP+ G A 
Sbjct  60   NQG--SVDTYKSLAAEKGVTEIRSLLDDTSIYGQD-----CGFTDPDGTAQDIPTDGKAT  112

Query  113  RSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYW  164
             S G  H GPCE+WLD T VL  D+C+    G D      + +DYSSC +G C  +R+YW
Sbjct  113  FSRGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYW  172

Query  165  LGVRFLKNEYSWQVYKACVPL  185
            L  + +  +  WQVYK C+PL
Sbjct  173  LAFQGVDGDTVWQVYKNCIPL  193

>PPTG_14221
Length=275

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 73/137 (53%), Gaps = 14/137 (10%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++VD F + +  N +K L+  MD    T   GAD  CGFTN +  PQ IP+ G A  S  
Sbjct  61   KSVDTFKSLKAANNFKDLKTLMDD---TSVYGAD--CGFTNPNGTPQPIPTDGKATFSRA  115

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSCT-GTCT-LRWYWLGVR  168
              H GPC +WLD   VL  D+C      ++      + +DYSSC  G C  +R+YWL  +
Sbjct  116  LVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQ  175

Query  169  FLKNEYSWQVYKACVPL  185
             L  +  WQ YK C+PL
Sbjct  176  GLNKKTVWQSYKDCIPL  192

>PHYKE_6001
Length=289

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 76/141 (54%), Gaps = 14/141 (10%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++V  FNA ++ N Y  L+  MD    T   GAD  CGFT+ +  PQ IPS G A  S  
Sbjct  61   QSVTAFNALKKANNYVDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPSDGKATYSRA  115

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSCT-GTCT-LRWYWLGVR  168
              H GPCE+WLD   V + ++C+     ++      + +DYSSC  G C  +R+YWL  +
Sbjct  116  IQHVGPCEIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQ  175

Query  169  FLKNEYSWQVYKACVPLSASA  189
             +  +  WQ YK C+PL  S 
Sbjct  176  GVDGKTVWQSYKNCIPLEGSG  196

>PYAP_18709
Length=235

 Score = 93.2 bits (230),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (57%), Gaps = 12/132 (9%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-ST  115
            F+T   + A     G+K LR+F++    T        CG +  +A+P+ IPS   ++ ++
Sbjct  54   FKTGAQYAAVAPGKGFKDLRSFLEDKGPT--------CGNSLPNASPKPIPSDGTIKLAS  105

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
               H GPCEVWLD TR   +D+C +A  S   + +D+ +C G+C LR+YWLG++      
Sbjct  106  TIEHAGPCEVWLDNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGK  163

Query  175  SWQVYKACVPLS  186
             WQ YK C+PL+
Sbjct  164  RWQSYKNCIPLN  175

>PYU1_G005325
Length=207

 Score = 92.4 bits (228),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 70/131 (53%), Gaps = 12/131 (9%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-ST  115
            F T   + A     GYK L++F+D    T        CG T ++A  +AIP    ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
               H GPCE+WL  TR   +D+C +   S   + ID+S+C G C LR+YWLG++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPL  185
             WQ YK C+PL
Sbjct  165  RWQSYKNCIPL  175

>PYU1_G007364
Length=316

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 75/138 (54%), Gaps = 23/138 (17%)

Query  60   VDDF-NAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSG------NAM  112
            VD F  A++ +  Y +LR  + G       G D  CG T  DA P+ IPS       N  
Sbjct  76   VDTFTKAFQASGKYASLRDLLQG------HGED--CGNTKLDATPKPIPSDGMVSWQNPD  127

Query  113  RSTGY--THDGPCEVWLDTTRVLTHDNCHEAISGK--DYTIDYSSCTGTCTLRWYWLGVR  168
             + G+  +H GPCE+WLD T VL  +NC     G      +D+SSCTG C +R+YWL ++
Sbjct  128  TNEGFVPSHTGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ  187

Query  169  FLKNEYSWQVYKACVPLS  186
                E +WQ+YK C+PL+
Sbjct  188  ----EPAWQIYKNCIPLA  201

>PHYSO_533682
Length=278

 Score = 93.6 bits (231),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 74/136 (54%), Gaps = 14/136 (10%)

Query  59   TVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGY  117
            +V+ F +++  N +K L+  MD       D     CGFT+ +  PQ IP+ G A  S G 
Sbjct  62   SVEVFTSFKSVNNFKDLKTLMDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRGL  116

Query  118  THDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYWLGVRF  169
             H GPCE+WLD  +VL+ D+C+      +      + +DYSSC  G C  +R Y LG + 
Sbjct  117  IHVGPCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQG  176

Query  170  LKNEYSWQVYKACVPL  185
            L ++  WQ YK C+PL
Sbjct  177  LVDKTVWQSYKNCIPL  192

>PHYRA_78626
Length=473

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 68/137 (50%), Gaps = 45/137 (33%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            L+FLE +GFET ++F  ++ +NGY +LR F+D AKY +                      
Sbjct  307  LSFLEKEGFETQENFTQFQVDNGYTSLRDFLDKAKYKLA---------------------  345

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVR  168
                                    L++ NCHE+I+ + + +DYS C  +C L WYWLG R
Sbjct  346  ------------------------LSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGAR  381

Query  169  FLKNEYSWQVYKACVPL  185
            +LK  YSWQVYK C+ L
Sbjct  382  YLKGSYSWQVYKECILL  398

>CCI47381
Length=211

 Score = 92.0 bits (227),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 74/131 (56%), Gaps = 22/131 (17%)

Query  72   YKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM------RSTGY--THDGPC  123
            ++TLR F+        D   Y CG TN +A+P+ IP+ NA+         G+  +H GPC
Sbjct  72   FRTLRDFLK-------DKGPY-CGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGPC  123

Query  124  EVWLDTTRVLTHDNC--HEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKA  181
            EVWL  TRV   DNC  H   S     I++SSC+G C L+++WL +    +E  WQVYK 
Sbjct  124  EVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLAL----HEPQWQVYKN  179

Query  182  CVPLSASARRL  192
            C+P++ +  RL
Sbjct  180  CIPIAPNGIRL  190

>PHYRA_78625
Length=434

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 68/137 (50%), Gaps = 45/137 (33%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            L+FLE +GFET ++F  ++ +NGY +LR F+D AKY +                      
Sbjct  268  LSFLEKEGFETQENFTQFQVDNGYTSLRDFLDKAKYKL----------------------  305

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVR  168
                                    L++ NCHE+I+ + + +DYS C  +C L WYWLG R
Sbjct  306  -----------------------ALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGAR  342

Query  169  FLKNEYSWQVYKACVPL  185
            +LK  YSWQVYK C+ L
Sbjct  343  YLKGSYSWQVYKECILL  359

>PYIW_27477
Length=180

 Score = 91.3 bits (225),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 70/117 (60%), Gaps = 17/117 (15%)

Query  68   RNNGYKTLRAFMD--GAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-STGYTHDGPCE  124
            +  G++TLR++++  GAK          CG T+ +A  +AIPS N ++ S    H GPCE
Sbjct  46   KEKGFETLRSYIEDKGAK----------CGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCE  95

Query  125  VWLDTTRVLTHDNCHEAISGK--DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVY  179
            +W+D TRV+  DNC +    K   + ID+S+C G C LRW+WLG++   +   WQVY
Sbjct  96   LWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

>PHYKE_7717
Length=568

 Score = 95.5 bits (236),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)

Query  141  AISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            A  GKDYTIDYS+C GTCTLRWYWLGVRFLKN YSWQVYKAC+PL+
Sbjct  1    AFPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  46

>PITG_05271
Length=278

 Score = 92.8 bits (229),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 74/140 (53%), Gaps = 14/140 (10%)

Query  59   TVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGY  117
            +V+ F A +  N +K L+  MD    T   GAD  CGFT+ +   Q IP  G A  S   
Sbjct  62   SVNAFKALKTANKFKDLKTLMDD---TSVYGAD--CGFTDPNGKAQPIPKDGKATFSRAL  116

Query  118  THDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYWLGVRF  169
             H GPCE+WLD T+VL  D+C      ++      + +DYSSC  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  176

Query  170  LKNEYSWQVYKACVPLSASA  189
            +  +  WQ YK C+PL  S 
Sbjct  177  VDGKTVWQSYKDCIPLEGSG  196

>PHYKE_3913
Length=321

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 61/104 (59%), Gaps = 9/104 (9%)

Query  93   HCGFTNADAAPQAIPS-GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI-  149
            +CGFTN DA P+  P+ G A  S G  H GPCE+WLD   VL +D+C  A   G   TI 
Sbjct  120  NCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETIS  179

Query  150  -----DYSSC-TGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSA  187
                 DYSSC  G C  R+YW+ ++ L  +  WQVYK CVPL+ 
Sbjct  180  IFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCVPLTG  223

>PHYSO_459106
Length=223

 Score = 91.3 bits (225),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 73/136 (54%), Gaps = 13/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   ++ N  K +R  +D    T   G D  CGFT+    PQ  P+ G+A  S G  H G
Sbjct  67   YKQLKKANNVKDIRTMIDSD--TKLYGED--CGFTDPKGKPQDPPTTGDATFSRGIVHAG  122

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYT------IDYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   T      +DYSSC +G C  R+YWL ++   ++
Sbjct  123  PCEIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSK  182

Query  174  YSWQVYKACVPLSASA  189
              WQVYK C+PL+  A
Sbjct  183  TYWQVYKNCIPLTGPA  198

>PHYRA_85794
Length=230

 Score = 91.3 bits (225),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 68/131 (52%), Gaps = 19/131 (15%)

Query  89   GADYHCGFTNADAAPQAIPS-GNAM----RSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            GAD  CGFT  D  PQ +P+ G A+       GYTH GPCE+++D   VL  DNC     
Sbjct  82   GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYP  141

Query  144  G--------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASAR--RLK  193
            G         +  +DYSSC G CT   YWLG +  +    WQ Y  CVPLS +    + +
Sbjct  142  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGETTQTQ  197

Query  194  GAANESAAIEF  204
             + + SA++E 
Sbjct  198  ASGSRSASVEV  208

>PHYRA_77971
Length=230

 Score = 91.3 bits (225),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 68/131 (52%), Gaps = 19/131 (15%)

Query  89   GADYHCGFTNADAAPQAIPS-GNAM----RSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            GAD  CGFT  D  PQ +P+ G A+       GYTH GPCE+++D   VL  DNC     
Sbjct  82   GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYP  141

Query  144  G--------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASAR--RLK  193
            G         +  +DYSSC G CT   YWLG +  +    WQ Y  CVPLS +    + +
Sbjct  142  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGETTQTQ  197

Query  194  GAANESAAIEF  204
             + + SA++E 
Sbjct  198  ASGSRSASVEV  208

>PYIR_19612
Length=260

 Score = 91.7 bits (226),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 79/138 (57%), Gaps = 19/138 (14%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-STGYTHD  120
            +F    +  G+ TLR++++    T        CGFT+ + AP+AIP+   +R S   +H 
Sbjct  62   NFATAAKEKGFATLRSYLEDKGAT--------CGFTDPNVAPRAIPADRKVRFSRDISHP  113

Query  121  GPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            GPCE+W+D  RV  +D+C  A +G    + +D++ C+G C +R+YWL ++   +   WQV
Sbjct  114  GPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQ--ASGTRWQV  171

Query  179  YKA------CVPLSASAR  190
            Y++      CVP+S S +
Sbjct  172  YRSELTRDLCVPVSGSGK  189

>PPTG_04620
Length=342

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 15/134 (11%)

Query  63   FNAWRRNNGYKTLRAFMDG-AKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHD  120
            +   +++N  K +R  +DG AK    D     CG T+  A P+  PS G+A  S G  H 
Sbjct  69   YKELKKSNNVKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPSTGDATFSRGIVHA  123

Query  121  GPCEVWLDTTRVLTHDNCHEAI-SGKDYTI------DYSSC-TGTCTLRWYWLGVRFLKN  172
            GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C  R+YWL ++   +
Sbjct  124  GPCEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDS  183

Query  173  EYSWQVYKACVPLS  186
            +  WQVYK C+PLS
Sbjct  184  KTLWQVYKNCIPLS  197

>PHYCA_69583
Length=224

 Score = 90.5 bits (223),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 67/121 (55%), Gaps = 14/121 (12%)

Query  93   HCGFTNADAAPQAIPS-GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDY----  147
            +CGF+N DA  +  PS G A    G  H GPCE+WLD   VL +D+C +A S  DY    
Sbjct  95   NCGFSNPDAKAKDPPSDGTATFERGLAHHGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIK  154

Query  148  ----TIDYSSCTGT-CTLRWYWLGVR-FLKNEYSWQVYKACVPLS---ASARRLKGAANE  198
                 IDYSSC+ + C  R+YWL  +     +Y WQ+YK C+PL+   A      GA+N 
Sbjct  155  SVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYKDCIPLTGPGAGKSSTVGASNS  214

Query  199  S  199
            S
Sbjct  215  S  215

>PHYCA_534296
Length=309

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 74/136 (54%), Gaps = 14/136 (10%)

Query  59   TVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGY  117
            +V+ F + +  N +K L+  MD    T   GAD  CGFTN     Q IP+ G A  S   
Sbjct  36   SVETFKSLKSANNFKDLKTLMDD---TSVYGAD--CGFTNPSGTAQPIPTDGKATFSRAL  90

Query  118  THDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYWLGVRF  169
             H GPCE+WLD T+VL  D+C+     ++      + +DYSSC  G C  +R+YWL  + 
Sbjct  91   VHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQG  150

Query  170  LKNEYSWQVYKACVPL  185
            +  +  WQ YK C+PL
Sbjct  151  VDGKTVWQSYKDCIPL  166

>PYAR_14260
Length=212

 Score = 89.7 bits (221),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 72/137 (53%), Gaps = 12/137 (9%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-ST  115
            F+T   + A     G+K LR+F++    T        CG + + A P+ IPS   ++ ++
Sbjct  31   FKTGAQYAAVAPGKGFKNLRSFLESKGPT--------CGNSLSSAKPKPIPSDGMVKFAS  82

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
               H GPCE+WLD T     D+C +   S     +++S+C G+C LR+YWLG++   +  
Sbjct  83   TLEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGT  140

Query  175  SWQVYKACVPLSASARR  191
             WQ YK CVPL     R
Sbjct  141  RWQSYKNCVPLGGGKSR  157

>H310_06362
Length=197

 Score = 89.4 bits (220),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 68/126 (54%), Gaps = 23/126 (18%)

Query  71   GYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSG------NAMRSTGY--THDGP  122
            G+KTLRA +D        G D  CG+T  +   + IP+       N     G+  +H GP
Sbjct  51   GFKTLRAMLD------PHGPD--CGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTGP  102

Query  123  CEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVY  179
            CE+WLD TRV  ++NC      K      +D+SSC G+CT+R+YWL +    +E  WQVY
Sbjct  103  CEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDLWQVY  158

Query  180  KACVPL  185
            K C PL
Sbjct  159  KNCAPL  164

>PHYKE_2809
Length=291

 Score = 91.3 bits (225),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 70/134 (52%), Gaps = 13/134 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            +   +  N  K +R  +D    T   G D  CGFT+  A P+  P+ G A  S G  H G
Sbjct  54   YKELKAANNVKDIRTMLDSD--TKLYGQD--CGFTDPKATPKDPPTDGAATFSRGIVHAG  109

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSCT-GTCTLRWYWLGVRFLKNE  173
            PCE+WLD   VL +D+C  A   G   TI      DYSSC  G C  R+YWL ++ L  +
Sbjct  110  PCEIWLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGK  169

Query  174  YSWQVYKACVPLSA  187
              WQVYK CVPLS 
Sbjct  170  KFWQVYKNCVPLSG  183

>PHYKE_6002
Length=197

 Score = 89.0 bits (219),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 73/126 (58%), Gaps = 11/126 (9%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++V  F++ ++ N +  L+  MD    T   GAD  CGFT+    PQ IPS G A  S  
Sbjct  61   QSVTTFDSLKKANNFVDLKTLMDD---TSVYGAD--CGFTDPSGTPQPIPSDGKATFSRA  115

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSC-TGTCT-LRWYWLGVRFLKNEY  174
              H GPCE+WLD+T+  + DNC +    + + +DYSSC +G C  +R+YWL  + L ++ 
Sbjct  116  MQHVGPCEIWLDSTKAFSKDNCADM---ETFPVDYSSCNSGGCKEMRYYWLAFQGLDSKT  172

Query  175  SWQVYK  180
             WQ Y+
Sbjct  173  VWQSYR  178

>PHALS_03177
Length=259

 Score = 90.1 bits (222),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 71/137 (52%), Gaps = 15/137 (11%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++V  F + +  N +K L+  MD        G D  CG+++ +  PQ IP  G A  S  
Sbjct  61   KSVKAFQSLKAANNFKDLKTLMDNPVL----GRD--CGYSDPNGKPQPIPKDGKATFSRA  114

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LRWYWLGVR  168
              H GPCE+WLD  +VL  D+C+      D      + +DYSSC  G C  +R+YWL  +
Sbjct  115  MVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQ  174

Query  169  FLKNEYSWQVYKACVPL  185
             +  +  WQ YK C+PL
Sbjct  175  GINGKTFWQSYKMCIPL  191

>PHYRA_86151
Length=170

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            L+FLE +GFET ++F  ++ +NGY +LR F+D AKY V+DGAD  CG+++    PQ IP 
Sbjct  29   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  88

Query  109  GNAMRSTGYTHDGP  122
               M  +GYTHD P
Sbjct  89   DGTMSPSGYTHDAP  102

>PITG_04947
Length=298

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 72/133 (54%), Gaps = 15/133 (11%)

Query  63   FNAWRRNNGYKTLRAFMDG-AKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHD  120
            +   +++N  K +R  +DG AK    D     CG T+  A P+  P+ G+A  S G  H 
Sbjct  42   YKQLKKSNNIKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPTTGDATFSRGIVHA  96

Query  121  GPCEVWLDTTRVLTHDNCHEAI-SGKDYTI------DYSSC-TGTCTLRWYWLGVRFLKN  172
            GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C  R+YWL ++    
Sbjct  97   GPCEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQ  156

Query  173  EYSWQVYKACVPL  185
            +  WQVYK C+PL
Sbjct  157  KTLWQVYKNCIPL  169

>PHYRA_87941
Length=157

 Score = 86.7 bits (213),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)

Query  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS  108
            L+FLE +GFET ++F  ++ +NGY +LR F+D AKY V+DGAD  CG+++    PQ IP 
Sbjct  16   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  75

Query  109  GNAMRSTGYTHDGP  122
               M  +GYTHD P
Sbjct  76   DGTMSPSGYTHDAP  89

>PHYRA_83494
Length=224

 Score = 88.2 bits (217),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 63/124 (51%), Gaps = 17/124 (14%)

Query  89   GADYHCGFTNADAAPQAIPSGNAMR-----STGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            G D  CG T+  AAPQA+P+    +       G+TH GPCE+++D   VL  DNC +   
Sbjct  18   GEDKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYP  77

Query  144  G--------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGA  195
            G         D  +DYSSC G CT   YWL  +  +    WQ Y  CVPL+ S    + A
Sbjct  78   GGDVGSTVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPLTGSGSTTQTA  133

Query  196  ANES  199
            A+ +
Sbjct  134  ASST  137

>H257_13550
Length=266

 Score = 89.0 bits (219),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 72/130 (55%), Gaps = 23/130 (18%)

Query  67   RRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAM-----RSTGY--T  118
            ++  G+KTLRA +D        G D  CG++  D   + IPS GN +        G+  +
Sbjct  102  QQATGFKTLRAMLD------PQGPD--CGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPS  153

Query  119  HDGPCEVWLDTTRVLTHDNCHEAISGKD---YTIDYSSCTGTCTLRWYWLGVRFLKNEYS  175
            H GPCE+WLD TRV  +D+C      K      +D++SC G+CT+R+YW+ +    ++  
Sbjct  154  HTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIAL----HQDL  209

Query  176  WQVYKACVPL  185
            WQVYK C PL
Sbjct  210  WQVYKNCAPL  219

>PHALS_03179
Length=372

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 70/141 (50%), Gaps = 15/141 (11%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++V  + + +  N +K L+  M+      T      CGF++    PQ IP  G A  S  
Sbjct  102  QSVKAYQSLKAANNFKDLKTLME------THALGPECGFSDPKGKPQPIPKDGKATLSRA  155

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTI------DYSSC-TGTCT-LRWYWLGVR  168
              H GPCE+WLD  +VL  D+C+     +D  I      DYSSC  G C  +R+YWL  +
Sbjct  156  IVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQ  215

Query  169  FLKNEYSWQVYKACVPLSASA  189
             +K    WQ YK C+PL  S 
Sbjct  216  GIKGITFWQSYKNCIPLQGSG  236

>PYIR_23585
Length=240

 Score = 88.2 bits (217),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 70/127 (55%), Gaps = 13/127 (10%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-STGYTHD  120
            DF       G+ T RAF++    T        CG T A+A+P+ IPS N ++ S    H 
Sbjct  61   DFAKTAPGKGFATTRAFLESRGPT--------CGNTLANASPKPIPSDNTVKFSRAIVHP  112

Query  121  GPCEVWLDTTRVLTHDNCHEAI--SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            GPCE+W+D TRV  +D+C  A   S   + ID+S+C G+C LR+YWLG++       +Q 
Sbjct  113  GPCELWIDNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGARFQS  170

Query  179  YKACVPL  185
            Y  C+ L
Sbjct  171  YSKCLAL  177

>SDRG_16535
Length=313

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 71/142 (50%), Gaps = 12/142 (8%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS----GNAMRSTGY  117
             F    R + ++TL +F+D   +         CG TNA+ APQ +PS     N       
Sbjct  63   QFTMQFRASKFQTLASFVDDPSFAPCG----TCGITNANGAPQPLPSVLKWANGQEGFVA  118

Query  118  THDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQ  177
            +H+GPCEVW D+TRV  +DNC         +ID + C G   LR  WL +    +  SWQ
Sbjct  119  SHEGPCEVWCDSTRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQ  174

Query  178  VYKACVPLSASARRLKGAANES  199
            VY  CVPLS S   +  A++ S
Sbjct  175  VYINCVPLSGSTIEIPPASSPS  196

>PHYRA_86016
Length=236

 Score = 87.4 bits (215),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 61/124 (49%), Gaps = 17/124 (14%)

Query  91   DYHCGFTNADAAPQAIPSGNAMR-----STGYTHDGPCEVWLDTTRVLTHDNCHEAISG-  144
            D  CG+T  D  PQ IP+   ++       G+TH GPCE+++D T VL  D+C E   G 
Sbjct  19   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  78

Query  145  -------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAAN  197
                    +  +DYSSC G CTL  YWL  +  +    WQ Y  CVPL  S    +    
Sbjct  79   PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSATQTQTQ  134

Query  198  ESAA  201
             S+A
Sbjct  135  TSSA  138

>PYAR_14256
Length=199

 Score = 86.7 bits (213),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 69/136 (51%), Gaps = 11/136 (8%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTG  116
            F T   + A   + G+K LRAF++    T        CG T  +A P+         ++ 
Sbjct  51   FRTGAQYAAVAPDKGFKNLRAFLEDKGPT--------CGNTLPNAKPKPXXXXLIKLAST  102

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYS  175
              H GPCE+WLD +     D+C +   S   + +D+S+C G+C LR+YWLG++   +   
Sbjct  103  IEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKR  160

Query  176  WQVYKACVPLSASARR  191
            WQ YK C+PL  +  R
Sbjct  161  WQSYKNCIPLGGAQSR  176

>PPTG_07509
Length=299

 Score = 88.2 bits (217),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 66/147 (45%), Gaps = 24/147 (16%)

Query  56   GFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR--  113
            G + V  F    +  G       +D  K       D  CG+T  D  P+ IP+   ++  
Sbjct  54   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWW  106

Query  114  ---STGYTHDGPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRW  162
                 G+TH GPCE+++D   VL  DNC E   G         +  +D+SSC G CTL  
Sbjct  107  GNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTI  166

Query  163  YWLGVRFLKNEYSWQVYKACVPLSASA  189
            YWLG +  +    WQ Y  CVPL  S 
Sbjct  167  YWLGFQNAQ----WQAYVNCVPLQGSG  189

>PPTG_07507
Length=299

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 66/147 (45%), Gaps = 24/147 (16%)

Query  56   GFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR--  113
            G + V  F    +  G       +D  K       D  CG+T  D  P+ IP+   ++  
Sbjct  54   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWW  106

Query  114  ---STGYTHDGPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRW  162
                 G+TH GPCE+++D   VL  DNC E   G         +  +D+SSC G CTL  
Sbjct  107  GNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTI  166

Query  163  YWLGVRFLKNEYSWQVYKACVPLSASA  189
            YWLG +  +    WQ Y  CVPL  S 
Sbjct  167  YWLGFQNAQ----WQAYVNCVPLQGSG  189

>CCA17179
Length=185

 Score = 85.9 bits (211),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 70/131 (53%), Gaps = 22/131 (17%)

Query  72   YKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM------RSTGY--THDGPC  123
            ++ LR F+        D   Y CG TN +A P+ IP+ +A+         G+  +H GPC
Sbjct  46   FQNLRDFL-------KDKGPY-CGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHMGPC  97

Query  124  EVWLDTTRVLTHDNCHEAI--SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKA  181
            EVWL+  RV   DNC E    S     ID+S+CT  C L+++WL +     E  WQVYK 
Sbjct  98   EVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLALH----EPQWQVYKN  153

Query  182  CVPLSASARRL  192
            C+P++ +  +L
Sbjct  154  CIPIAPNGIKL  164

>PYU1_G005985
Length=200

 Score = 85.9 bits (211),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 71/146 (49%), Gaps = 22/146 (15%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR----  113
            E    F +     GY +L+A +D     V  G    CG +  D  P  +    AM     
Sbjct  66   ENTQQFTSGFHAAGYSSLKALLD----PVAPG----CGNSRVDVPPVGVSRLAAMEFRND  117

Query  114  --STGY--THDGPCEVWLDTTRVLTHDNCHEAISGKDYTI--DYSSCTGTCTLRWYWLGV  167
                G+  +H GPCEVW+D  R+   D+C    +G   TI  ++S C G CTL +YWL +
Sbjct  118  EFHEGFVNSHHGPCEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLAL  177

Query  168  RFLKNEYSWQVYKACVPLSASARRLK  193
                +E +WQVYK CVP+    +RL+
Sbjct  178  ----HEPTWQVYKQCVPIENQGKRLR  199

>PHYRA_86752
Length=300

 Score = 87.8 bits (216),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 61/124 (49%), Gaps = 17/124 (14%)

Query  91   DYHCGFTNADAAPQAIPSGNAMR-----STGYTHDGPCEVWLDTTRVLTHDNCHEAISG-  144
            D  CG+T  D  PQ IP+   ++       G+TH GPCE+++D T VL  D+C E   G 
Sbjct  83   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  142

Query  145  -------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAAN  197
                    +  +DYSSC G CTL  YWL  +  +    WQ Y  CVPL  S    +    
Sbjct  143  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSATQTQTQ  198

Query  198  ESAA  201
             S+A
Sbjct  199  TSSA  202

>PYU1_G005323
Length=251

 Score = 86.7 bits (213),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 68/132 (52%), Gaps = 12/132 (9%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-ST  115
            F T   + A     GYK L++F++             CG +  DA  + IPS   ++ ++
Sbjct  54   FRTGAQYAAVAPGKGYKDLKSFLEDKGPV--------CGNSLPDAKAKPIPSDGVIKLAS  105

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
               H GPCEVW D  R    D+C +   S   + +D+S+C G+C LR+YWLG++      
Sbjct  106  TIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGK  163

Query  175  SWQVYKACVPLS  186
             WQ YK C+PL+
Sbjct  164  RWQSYKNCIPLT  175

>SPRG_19916
Length=305

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 77/145 (53%), Gaps = 25/145 (17%)

Query  60   VDDFN-AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM----RS  114
            V +FN A++    +KTLR  +D        G D  CG T  + A +AIP+   M      
Sbjct  60   VANFNKAFKAQTQFKTLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPD  111

Query  115  TGY----THDGPCEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGT-CTLRWYWLG  166
            TG     +H GPCEVW+D  RV  +D+C      K   +  IDYSSC+G  C LR+YWL 
Sbjct  112  TGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLA  171

Query  167  VRFLKNEYSWQVYKACVPLSASARR  191
            +    +E  WQVYK CVPL  + ++
Sbjct  172  L----HEPMWQVYKNCVPLEGNGQK  192

>PYAR_20617
Length=254

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 66/131 (50%), Gaps = 12/131 (9%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIP-SGNAMRST  115
            F+T   + A  +  G   LR F++             CG +  DA P+AIP SG    ++
Sbjct  55   FKTGAQYAAKAKAEGIPDLRTFLEDKGPV--------CGNSLKDATPKAIPASGKISLAS  106

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
               H GPCEVW D       D+C +   S   + +D+S C+G+C LR+YWLG++      
Sbjct  107  TIEHAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPL  185
             WQ YK CVPL
Sbjct  165  RWQSYKNCVPL  175

>PHYRA_79140
Length=424

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 66/135 (49%), Gaps = 25/135 (19%)

Query  72   YKTLRAFMDGAKYTVTDGA-----DYHCGFTNADAAPQAIPSGNAMR-----STGYTHDG  121
            YKT+ A     K TV D          CG T+  A+PQ IPS    +       G+TH G
Sbjct  62   YKTMAAEK---KMTVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVG  118

Query  122  PCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRWYWLGVRFLKNE  173
            PCE++LD T VL  DNC +   G         D  +DYSSC G CTL  YWL  +  +  
Sbjct  119  PCEIYLDDTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ--  176

Query  174  YSWQVYKACVPLSAS  188
              WQ Y  CVPLS S
Sbjct  177  --WQAYVNCVPLSGS  189

>PHYCA_97965
Length=288

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 66/143 (46%), Gaps = 24/143 (17%)

Query  56   GFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR--  113
            G + V  F    +  G       +D  K       D  CG+T  D  PQ IPS   ++  
Sbjct  57   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWW  109

Query  114  ---STGYTHDGPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRW  162
                 G+TH GPCE+++D   VL  D+C +   G         + ++D+SSC G CTL  
Sbjct  110  GNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTI  169

Query  163  YWLGVRFLKNEYSWQVYKACVPL  185
            YWL     +NE  WQ Y  CVPL
Sbjct  170  YWLA---FQNEQ-WQSYVNCVPL  188

>SPRG_22161
Length=300

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 78/154 (51%), Gaps = 25/154 (16%)

Query  60   VDDFN-AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM----RS  114
            V +FN A++    +KTLR  +D        G D  CG T  + A +AIP+   M      
Sbjct  60   VANFNKAFKAQTQFKTLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPD  111

Query  115  TG----YTHDGPCEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGT-CTLRWYWLG  166
            TG     +H GPCEVW+D  RV  +D+C      K   +  +DYSSC    C LR+YWL 
Sbjct  112  TGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLA  171

Query  167  VRFLKNEYSWQVYKACVPLSASARRLKGAANESA  200
            +    +E  WQVYK CVPL  + ++   A   +A
Sbjct  172  L----HEPMWQVYKNCVPLKGNGQQPTSAPKPTA  201

>PHYCA_12943
Length=287

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 66/145 (46%), Gaps = 24/145 (17%)

Query  56   GFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR--  113
            G + V  F    +  G       +D  K       D  CG+T  D  PQ IPS   ++  
Sbjct  57   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWW  109

Query  114  ---STGYTHDGPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRW  162
                 G+TH GPCE+++D   VL  D+C +   G         + ++D+SSC G CTL  
Sbjct  110  GNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTI  169

Query  163  YWLGVRFLKNEYSWQVYKACVPLSA  187
            YWL     +NE  WQ Y  CVPL  
Sbjct  170  YWLA---FQNE-QWQSYVNCVPLQG  190

>PHYSO_255056
Length=269

 Score = 85.9 bits (211),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 60/100 (60%), Gaps = 9/100 (9%)

Query  89   GADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDY  147
            GAD  CGF+N DA P+  P+ G A    G  H GPCE+WLD T VL +D+C +A S +DY
Sbjct  94   GAD--CGFSNPDAKPKDPPTDGTATFERGLAHHGPCEIWLDDTMVLHNDDCAKAFSVEDY  151

Query  148  TIDYSSCTGTCTLRWYWLGVR-FLKNEYSWQVYKACVPLS  186
                 S  G C  R+YWL  +     +Y WQ+YK C+PL+
Sbjct  152  M----SING-CMFRFYWLAFQGSTSGKYVWQIYKNCIPLT  186

>PHYRA_83500
Length=394

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 65/135 (48%), Gaps = 25/135 (19%)

Query  72   YKTLRAFMDGAKYTVTDGA-----DYHCGFTNADAAPQAIPSGNAMR-----STGYTHDG  121
            YKT+ A     K TV D          CG T+  A+PQ IPS    +       G+TH G
Sbjct  62   YKTMAAEK---KMTVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVG  118

Query  122  PCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRWYWLGVRFLKNE  173
            PCE++LD T VL  DNC +   G         D  +DYSSC G CTL  YWL  +  +  
Sbjct  119  PCEIYLDDTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ--  176

Query  174  YSWQVYKACVPLSAS  188
              WQ Y  C PLS S
Sbjct  177  --WQAYVNCAPLSGS  189

>PHALS_05394
Length=288

 Score = 85.1 bits (209),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 74/145 (51%), Gaps = 16/145 (11%)

Query  54   NQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAM  112
            +QG   +D F      N +K+ R+ MDG       GAD  CG+T+ +  P   PS G A 
Sbjct  62   DQGL--LDTFKELGAANNFKSARSLMDGNPVY---GAD--CGYTDPNGTPVDPPSDGTAT  114

Query  113  RSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDY-------TIDYSSCTG-TCTLRWYW  164
             S    H G CE+W++   VL +D+C  A   K          IDYSSC G  C LR+YW
Sbjct  115  FSRPMKHAGLCEIWINKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYW  174

Query  165  LGVRFLKNEYSWQVYKACVPLSASA  189
            L ++ + ++  WQ YK C+ +  S+
Sbjct  175  LALQRIGDKTVWQAYKNCISIKGSS  199

>PYIR_24743
Length=357

 Score = 85.9 bits (211),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 74/138 (54%), Gaps = 24/138 (17%)

Query  60   VDDF-NAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSG------NAM  112
            VD F  A++  + +KTLR  +         GAD  CG +  DA+ +AIP        N  
Sbjct  74   VDTFTKAFQGQSEFKTLRDLLKD------HGAD--CGDSKPDASRKAIPGDGKVVWQNPD  125

Query  113  RSTGY--THDGPCEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGTCTLRWYWLGV  167
               G+  +H GPCE+WLD  RV + +NC    + K   +  +D+SSC   C LR+YWL +
Sbjct  126  TGEGFVPSHTGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLAL  185

Query  168  RFLKNEYSWQVYKACVPL  185
                +E +WQVYK CVPL
Sbjct  186  ----HEPTWQVYKNCVPL  199

>PYU1_G005871
Length=284

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 70/135 (52%), Gaps = 23/135 (17%)

Query  65   AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STGY-  117
            AW +  GYK+L+  MD A           CG++N +AAP  +   +AM+        G+ 
Sbjct  74   AWPKT-GYKSLKQMMDKAVPG--------CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFL  124

Query  118  -THDGPCEVWLDTTRVLTHDNCHEAISGKDYTI--DYSSCTGTCTLRWYWLGVRFLKNEY  174
             +H GPCE W+D TRV  +D+C     G   TI   Y SC GTC L +YWL +   K   
Sbjct  125  GSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK---  181

Query  175  SWQVYKACVPLSASA  189
             WQ YK+CV +  +A
Sbjct  182  -WQAYKSCVAIKNNA  195

>PYU1_G005872
Length=297

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 70/135 (52%), Gaps = 23/135 (17%)

Query  65   AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STGY-  117
            AW +  GYK+L+  MD A           CG++N +AAP  +   +AM+        G+ 
Sbjct  74   AWPKT-GYKSLKQMMDKAVP--------GCGYSNPNAAPVDVSKMSAMKFQNNEYKEGFL  124

Query  118  -THDGPCEVWLDTTRVLTHDNCHEAISGKDYTI--DYSSCTGTCTLRWYWLGVRFLKNEY  174
             +H GPCE W+D TRV  +D+C     G   TI   Y SC GTC L +YWL +   K   
Sbjct  125  GSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK---  181

Query  175  SWQVYKACVPLSASA  189
             WQ YK+CV +  +A
Sbjct  182  -WQAYKSCVAIKNNA  195

>PHYSO_262844
Length=276

 Score = 84.3 bits (207),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 68/127 (54%), Gaps = 22/127 (17%)

Query  69   NNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STGY--THD  120
            N+ +KTLRA MD A           CG T    +P  + S ++M+        G+  +H 
Sbjct  72   NSQFKTLRAMMDTAAS--------DCGNTALTGSPVDVSSLSSMKWQNDQEQMGFIDSHH  123

Query  121  GPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            GPCE W+D TRV   D+C  A +    +  IDYS+C+G CT  +YWL +    +E +WQV
Sbjct  124  GPCEAWIDDTRVFHSDDCRAAYTSYPAEIPIDYSACSGDCTFTFYWLAL----HEPNWQV  179

Query  179  YKACVPL  185
            YK C P+
Sbjct  180  YKQCAPI  186

>PYIR_20481
Length=277

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 71/138 (51%), Gaps = 32/138 (23%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STG  116
            F +   N GYK+L+  +D    +V       CGFT  D AP  +    +M+        G
Sbjct  66   FTSAFANTGYKSLKEMLD---LSVPG-----CGFTLTDGAPVDVSGLKSMKWQNDQEQKG  117

Query  117  Y--THDGPCEVWLDTTRVLTHDNCHEAISGKDYT-------IDYSSCTGTCTLRWYWLGV  167
            +  +H GPCEVW+D T+++  D+C       DYT       +DYS C G C L +YWL +
Sbjct  118  FIDSHHGPCEVWIDNTKIMHSDDCRA-----DYTAYPAEIPVDYSKCKGKCQLTFYWLAL  172

Query  168  RFLKNEYSWQVYKACVPL  185
                +E +WQ+YK CVP+
Sbjct  173  ----HEPNWQIYKQCVPI  186

>PYAP_18221
Length=226

 Score = 83.2 bits (204),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 71/145 (49%), Gaps = 26/145 (18%)

Query  68   RNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STGY--TH  119
            + +G K+LR  MD  KY         CG TN +  P+ +     M         G+  +H
Sbjct  77   KQSGLKSLRELMD--KYVPG------CGNTNPNTTPRDVTKLKTMTYQNNEYKEGFLNSH  128

Query  120  DGPCEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSCTGTCTLRWYWLGVRFLKNEYS  175
             GPCEVW+D TRV  +++C  A + K Y     +DYS C GTC L +YWL +   K    
Sbjct  129  HGPCEVWIDNTRVFQNNDC--AANYKSYPAALPVDYSKCKGTCRLTFYWLALHSQK----  182

Query  176  WQVYKACVPLSASARRLKGAANESA  200
            WQ YK CVP+   A R     +E +
Sbjct  183  WQAYKQCVPIKYGASRSMDEEDEES  207

>PHYSO_533747
Length=206

 Score = 82.4 bits (202),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 15/132 (11%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++V+ F + +  N +K L+  +D       D     CGFT+ +  PQ IP+ G A+ S G
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  116

Query  117  YTHDGPCEVWLDTTRVLTHDNC-----HEAISGK-DYTIDYSSC-TGTC-TLRWYWLGVR  168
              H GPCE WLD  +VL  D+C     H  ++ K ++ IDYSSC  G C  +R+YWLG +
Sbjct  117  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  176

Query  169  FLKNEYS-WQVY  179
             L ++ + WQ Y
Sbjct  177  ALDDKKTVWQTY  188

>SPRG_07796
Length=322

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 68/142 (48%), Gaps = 12/142 (8%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS----GNAMRSTGY  117
             F    + + ++TL AF+D             CG TNA  A Q +PS     N       
Sbjct  64   QFTTQFKASPFRTLAAFVDSQNVASCG----RCGITNAIGAAQPLPSVLKWANGQEGFVA  119

Query  118  THDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQ  177
            +H+GPCEVW D+TRV  +DNC         +ID + C G   LR  WL +    +  SWQ
Sbjct  120  SHEGPCEVWCDSTRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQ  175

Query  178  VYKACVPLSASARRLKGAANES  199
            VY  CVPLS S   +  AA+ S
Sbjct  176  VYINCVPLSGSTVVIPPAASPS  197

>SDRG_08129
Length=218

 Score = 82.8 bits (203),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 76/149 (51%), Gaps = 25/149 (17%)

Query  58   ETVDDF-NAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM----  112
            E V  F +A++  + +KTLR  ++             CG +  +A+ + IPS  AM    
Sbjct  56   ENVAAFTSAFKVQSQFKTLRDMLEPQGPA--------CGNSLPNASKKTIPSDGAMTWRN  107

Query  113  RSTG----YTHDGPCEVWLDTTRVLTHDNCHEAISGKD---YTIDYSSCTGT-CTLRWYW  164
              TG     +H GPCEVWLD  RV  +D+C      K      +DYSSC G  C LR+YW
Sbjct  108  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYW  167

Query  165  LGVRFLKNEYSWQVYKACVPLSASARRLK  193
            L +    ++  WQVYK CVPL  + + +K
Sbjct  168  LAL----HQPQWQVYKNCVPLQGNGQAVK  192

>PYU1_G005868
Length=267

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 22/127 (17%)

Query  69   NNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STGY--THD  120
            ++ YK+LR  +D A   V D     CGFT  D  P  + S  +M+        G+  +H 
Sbjct  72   SSSYKSLREMLDSA---VPD-----CGFTLTDGTPVDVSSLKSMKWQNDQEQKGFIDSHH  123

Query  121  GPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            GPCE+W+D T+++  D+C    +    +  +DYS C G C L +YWL +    +E +WQ+
Sbjct  124  GPCELWIDDTKIMHSDDCRADYTAYPAEIPVDYSVCKGKCQLTFYWLAL----HEPNWQI  179

Query  179  YKACVPL  185
            YK CVP+
Sbjct  180  YKQCVPI  186

>SDRG_07565
Length=278

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 77/158 (49%), Gaps = 25/158 (16%)

Query  58   ETVDDFN-AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM----  112
            E V  F  A++  + +KTLR  ++             CG +  +A+ + IPS   M    
Sbjct  118  ENVAAFTTAFKAQSQFKTLRDMLEPQGPA--------CGNSLPNASKKTIPSDGTMTWLN  169

Query  113  RSTG----YTHDGPCEVWLDTTRVLTHDNCHEAISGKD---YTIDYSSCTGT-CTLRWYW  164
              TG     +H GPCEVWLD  RV   D+C      K      +DYSSC G+ C LR+YW
Sbjct  170  PDTGEGFISSHTGPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYW  229

Query  165  LGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202
            L +    ++  WQVYK CVPL  + + +K     S ++
Sbjct  230  LAL----HQPQWQVYKNCVPLQGNGQAVKAVGPSSPSM  263

>PYVX_16138
Length=559

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 14/133 (11%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGN-AMRSTG  116
            ++VD + +     G   +R+ +D    T   GAD  CG+T+ D   Q IP+ + A  S G
Sbjct  62   DSVDTYVSLAEEKGVTQIRSLLDD---TSIYGAD--CGYTDPDGTAQDIPTDSTATFSRG  116

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC--TGTCTLRWYWLGVR  168
              H GPCE+WLD T VL  D+C+    G D      + +DYSSC  +G   +R+YWL  +
Sbjct  117  MVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQ  176

Query  169  FLKNEYSWQVYKA  181
             + +E  WQVY  
Sbjct  177  GVDDETVWQVYSV  189

>PYIW_25463
Length=216

 Score = 82.0 bits (201),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 71/144 (49%), Gaps = 22/144 (15%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR----  113
            + V  F A     GYK+L+  MD        G    CGF+  D A   +   ++M+    
Sbjct  65   QNVQQFTAAWSKTGYKSLKELMD----KQVPG----CGFSRTDIAAVDVSGMSSMKFQNN  116

Query  114  --STGY--THDGPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLRWYWLGV  167
                G+  +H GPCE W+D T+V   D+C ++  G   +  + Y++C GTC L +YWL +
Sbjct  117  EYKEGFLGSHHGPCEGWIDNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLAL  176

Query  168  RFLKNEYSWQVYKACVPLSASARR  191
               K    WQ YK CVP+ A A R
Sbjct  177  HSQK----WQAYKHCVPIKAGAAR  196

>PHALS_04411
Length=262

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 65/136 (48%), Gaps = 14/136 (10%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDG  121
            F      N YK +R  MDG      D     CGFT+    P   PS G A  S G  H G
Sbjct  67   FKELAAKNNYKNVRTLMDGNPAFGED-----CGFTDPKGKPVDPPSDGTATFSRGIVHAG  121

Query  122  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLRWYWLGVRFLKNE  173
            PCE+W +   +L +D+C  A   G   TI       YS C +G   LR+YWL ++ L+ +
Sbjct  122  PCELWCNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGK  181

Query  174  YSWQVYKACVPLSASA  189
              WQ YK C+PL+   
Sbjct  182  VVWQAYKNCIPLTGPG  197

>PYU1_G005873
Length=214

 Score = 81.6 bits (200),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 22/142 (15%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR----  113
            +    F A     GYK+L+  MD A      G    CG++  D AP  +   ++M+    
Sbjct  66   QNTQQFTAAWPKTGYKSLKQMMDKA----VPG----CGYSRTDIAPVDVSRMSSMKFQNN  117

Query  114  --STGY--THDGPCEVWLDTTRVLTHDNCHEAISGKDYTI--DYSSCTGTCTLRWYWLGV  167
                G+  +H GPCE W+D TRV  +D+C     G   TI   + +C GTC L +YWL +
Sbjct  118  EYKEGFLASHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLAL  177

Query  168  RFLKNEYSWQVYKACVPLSASA  189
               K    WQ YK+CVP+  +A
Sbjct  178  HSPK----WQAYKSCVPIKYNA  195

>SPRG_19917
Length=241

 Score = 82.4 bits (202),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 71/137 (52%), Gaps = 25/137 (18%)

Query  62   DFN-AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM----RSTG  116
            +FN A++  + YKTLRA +D        G D  CG T  + A + IPS   M      TG
Sbjct  62   NFNKAFKAQSKYKTLRALLD------QHGPD--CGNTLTNVARKEIPSNGKMTFQNPDTG  113

Query  117  ----YTHDGPCEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGT-CTLRWYWLGVR  168
                 +H GPCEVWLD  RV  +D+C      K   +  +DYSSC    C LR+YW+ + 
Sbjct  114  EGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIALH  173

Query  169  FLKNEYSWQVYKACVPL  185
              +    WQVYK CVPL
Sbjct  174  SPR----WQVYKNCVPL  186

>PITG_11936
Length=333

 Score = 83.6 bits (205),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 12/132 (9%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIP------SGNAMRST  115
            +FN     + YK+L+ FM+     V +     CG+TN DA PQ +P      S  A    
Sbjct  68   NFNKGFAASKYKSLKEFMNDNMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGF  127

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTI--DYSSCTGTCTLRWYWLGVRFLKNE  173
              +H+GPCEV+ D TRV   DNC +        +  D+ +C G+  L  YW+ +    + 
Sbjct  128  TLSHEGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIAL----HS  183

Query  174  YSWQVYKACVPL  185
             SWQVY  C PL
Sbjct  184  PSWQVYINCAPL  195

>PHYRA_83499
Length=473

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 60/124 (48%), Gaps = 17/124 (14%)

Query  91   DYHCGFTNADAAPQAIPSGNAMR-----STGYTHDGPCEVWLDTTRVLTHDNCHEAISG-  144
            D  CG+T  D  PQ IP+   ++       G+TH GPCE+++D T VL  D+C E   G 
Sbjct  83   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  142

Query  145  -------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAAN  197
                    +  +DYSSC G CTL  YWL  +  +    WQ Y  CV L  S    +    
Sbjct  143  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSATQTQTQ  198

Query  198  ESAA  201
             S+A
Sbjct  199  TSSA  202

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 38/67 (57%), Gaps = 12/67 (18%)

Query  121  GPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRWYWLGVRFLKN  172
            GPCE++LD T +L  DNC +  SG         D  IDYSSC G CTL  YWLG    +N
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLG---FQN  407

Query  173  EYSWQVY  179
            E  WQ Y
Sbjct  408  E-QWQAY  413

>PHYRA_73581
Length=293

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 51/91 (56%), Gaps = 9/91 (10%)

Query  109  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDY--------TIDYSSCTGT-CT  159
            G A  S G  H GPCE+WLD T VL  D+C +     DY         IDYSSC+ + C 
Sbjct  118  GTATFSRGIAHHGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCM  177

Query  160  LRWYWLGVRFLKNEYSWQVYKACVPLSASAR  190
            LR+YWL  +   + Y WQ+YK CVPL+  A 
Sbjct  178  LRFYWLAFQGSNDGYVWQIYKHCVPLTGPAE  208

>PYVX_20783
Length=276

 Score = 82.4 bits (202),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 68/134 (51%), Gaps = 18/134 (13%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRST  115
            ++ VDD   W   NG  +L+      +Y  T G+   CG T  D  PQ +PS G A   T
Sbjct  63   YQAVDD---WFTANGISSLK------EYITTYGSFDECGNTEKDGTPQPVPSDGYAQHDT  113

Query  116  -GYTHDGPCEVWLDTTRVLTHDNCHEAISGKD---YTIDYSSCTGTCTLRWYWLGVRFLK  171
             G +H GPCE+W D TRV T  NC    SG+      ID ++CTG+    +YWL +    
Sbjct  114  LGNSHPGPCEIWCDDTRVFTSTNCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLAL----  169

Query  172  NEYSWQVYKACVPL  185
            +   WQVY  CV L
Sbjct  170  HAQPWQVYINCVAL  183

>PYAP_22257
Length=247

 Score = 81.6 bits (200),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 64/131 (49%), Gaps = 21/131 (16%)

Query  65   AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS------GNAMRSTGY-  117
            A++    +KTL+         V       CG ++    PQ++         N    TG+ 
Sbjct  64   AFKSQKTFKTLKDM-------VEKQLKGSCGKSSGKGKPQSVEGLSDVHWENTEEKTGFV  116

Query  118  -THDGPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLRWYWLGVRFLKNEY  174
             +H GPCE+W+D TRV+  DNC     G      ++YS C G C LR+YWL +    +E 
Sbjct  117  SSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLAL----HEP  172

Query  175  SWQVYKACVPL  185
             WQVYK CVP+
Sbjct  173  EWQVYKNCVPI  183

>PYAP_18713
Length=184

 Score = 79.7 bits (195),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 13/126 (10%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRST  115
            F+T   +    ++ G+K LR+F++             CG TN +A P+ +PS    + S 
Sbjct  57   FKTGAQYAVVAKDKGFKDLRSFLEDKGPA--------CGKTNPNAKPRNVPSDSKVVFSR  108

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAISGKD--YTIDYSSCTGTCTLRWYWLGVRFLKNE  173
               H GPCE+W+D T V  +D+C      K   + +D+SSC G C LR+YWLG++   + 
Sbjct  109  PMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSG  166

Query  174  YSWQVY  179
              WQ Y
Sbjct  167  KRWQSY  172

>SDRG_17318
Length=241

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 71/137 (52%), Gaps = 25/137 (18%)

Query  62   DFN-AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------S  114
            +FN A++  + YKTLRA +D        G D  CG T  + A + IPS   M        
Sbjct  62   NFNKAFKAQSKYKTLRAMLD------PHGPD--CGNTLTNVARKEIPSNGKMTFQNPDTG  113

Query  115  TGY--THDGPCEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGT-CTLRWYWLGVR  168
             G+  +H GPCEVWLD  RV  +D+C      K   +  +DYSSC    C LR+YW+ + 
Sbjct  114  EGFIPSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALH  173

Query  169  FLKNEYSWQVYKACVPL  185
              +    WQVYK CVPL
Sbjct  174  SPR----WQVYKNCVPL  186

>PHYRA_80750
Length=275

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 66/130 (51%), Gaps = 14/130 (11%)

Query  59   TVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGY  117
            +VD F A +  N +  L+  MD    T T GAD  CGFT+    PQ IPS G A  S   
Sbjct  62   SVDAFKALKTANNFVDLKTLMDD---TATFGAD--CGFTDPSGTPQPIPSDGKATFSRAI  116

Query  118  THDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSCT-GTCT-LRWYWLGVRF  169
             H GPCE+WLD  +V   D+C      ++      + +DYS C  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQG  176

Query  170  LKNEYSWQVY  179
            +  +  WQ Y
Sbjct  177  VDGKTVWQSY  186

>SDRG_08137
Length=282

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 75/149 (50%), Gaps = 25/149 (17%)

Query  58   ETVDDF-NAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM----  112
            E V  F +A++  + +KTLR  ++             CG +  +A+ + IPS   M    
Sbjct  120  ENVAAFTSAFKAQSQFKTLRDMLEPQGPA--------CGNSLPNASKKTIPSDGTMTWRN  171

Query  113  RSTG----YTHDGPCEVWLDTTRVLTHDNCHEAISGKD---YTIDYSSCTGT-CTLRWYW  164
              TG     +H GPCEVWLD  RV  +D+C      K      +DYSSC G  C LR+YW
Sbjct  172  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYW  231

Query  165  LGVRFLKNEYSWQVYKACVPLSASARRLK  193
            L +    ++  WQVYK CVPL  + + +K
Sbjct  232  LAL----HQPQWQVYKNCVPLQGNGQAVK  256

>PHYRA_86751
Length=163

 Score = 79.0 bits (193),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 57/102 (56%), Gaps = 17/102 (17%)

Query  91   DYHCGFTNADAAPQAIPS-GNAM----RSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG-  144
            +Y CG+T  D  P+AI + G A+       G+TH GPCE++LD T +L  DNC +  SG 
Sbjct  6    EYPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGG  65

Query  145  -------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVY  179
                    D  IDYSSC G CTL  YWLG    +NE  WQ Y
Sbjct  66   ADDSGIMSDMPIDYSSCNGACTLAIYWLG---FQNE-QWQAY  103

>PHYCA_98479
Length=276

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 56/110 (51%), Gaps = 17/110 (15%)

Query  89   GADYHCGFTNADAAPQAIPSGNAMR-----STGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            G+   CG T AD + Q +P+    +       G+TH GPCE+++D T VL  DNC +   
Sbjct  81   GSGKECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYP  140

Query  144  G--------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            G         D  +DYSSC G CTL  YWLG +       WQ Y  CVPL
Sbjct  141  GGDVGSTVTSDMPVDYSSCKGDCTLTIYWLGFQ----NAQWQAYINCVPL  186

>PHYCA_18657
Length=295

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 57/114 (50%), Gaps = 17/114 (15%)

Query  89   GADYHCGFTNADAAPQAIPS-GNAM----RSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            G D  CGFT  D  P+ +P+ G A+       G+TH GPCE+++D   VL  D+C     
Sbjct  167  GNDKKCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYP  226

Query  144  G--------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
            G         +  +DYSSC G CT   YWLG +       WQ Y  CVPLS + 
Sbjct  227  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAYINCVPLSGTG  276

>SDRG_17317
Length=122

 Score = 77.4 bits (189),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 58/110 (53%), Gaps = 16/110 (15%)

Query  94   CGFTNADAAPQAIPSGNAM----RSTG----YTHDGPCEVWLDTTRVLTHDNCHEAISGK  145
            CG T    A ++IPS   M      TG     +H GPCEVWLD  RV  +D+C      K
Sbjct  9    CGNTLTTGAKKSIPSDGTMTWQNPDTGEGFVPSHTGPCEVWLDDKRVFQNDDCATNFPAK  68

Query  146  D---YTIDYSSCTGT-CTLRWYWLGVRFLKNEYSWQVYKACVPLSASARR  191
                  IDYSSC+G  C LR+YWL +    +E  WQVYK CVPL  +  +
Sbjct  69   PAAHLPIDYSSCSGDGCMLRFYWLAL----HEPMWQVYKNCVPLEGNGEK  114

>PYIW_15526
Length=256

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 68/134 (51%), Gaps = 22/134 (16%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------ST  115
            +F A     GY +L+  +D +      G    CG+TN +AAP  +    +M+        
Sbjct  67   EFTAAWPKTGYTSLKEMLDKS----VSG----CGYTNPNAAPVDVSGLKSMKYQNNEYKE  118

Query  116  GY--THDGPCEVWLDTTRVLTHDNCHEAISGKDYT--IDYSSCTGTCTLRWYWLGVRFLK  171
            G+  +H GPCE W+D T++   D+C +   G   T  +DYS C GTC L +YWL V   K
Sbjct  119  GFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVHSPK  178

Query  172  NEYSWQVYKACVPL  185
                WQVYK CV +
Sbjct  179  ----WQVYKGCVAI  188

>PHYRA_86241
Length=195

 Score = 79.0 bits (193),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 60/104 (58%), Gaps = 13/104 (13%)

Query  89   GADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDY  147
            GAD  CGF++ +A  +  PS G A    G  H GPCE+WLD T VL +D+C +A S +DY
Sbjct  93   GAD--CGFSDPNAKAKDPPSDGTATFERGLAHHGPCEIWLDDTMVLHNDDCAKAFSVEDY  150

Query  148  T--------IDYSSCTGT-CTLRWYWLGVR-FLKNEYSWQVYKA  181
                     IDYSSC+ + C  R+YWL  +     +Y WQ+Y A
Sbjct  151  MSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYSA  194

>PPTG_04617
Length=496

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 62/119 (52%), Gaps = 16/119 (13%)

Query  78   FMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTGYTHDGPCEVWLDTTRVLTHD  136
            F+D   Y    GAD  C +++  A P+  PS G A  S G  H GPCE+WLD   VL  D
Sbjct  57   FIDSKLY----GAD--CEYSDPKADPKTSPSDGTATFSRGIAHHGPCEIWLDDKMVLHDD  110

Query  137  NCHEAISGKDY--------TIDYSSC-TGTCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            +C +     DY         IDYSSC T  C  R+YW+  +   N Y  Q+Y+ CVPL+
Sbjct  111  DCEKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIAFQGSDNGYVRQIYRHCVPLT  169

>PPTG_03153
Length=314

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 64/133 (48%), Gaps = 11/133 (8%)

Query  60   VDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNA---MRSTG  116
            V  F     ++ YK+L+A +D     +  GA   CG  +  A PQ +P+        S G
Sbjct  63   VAAFTKAFESSKYKSLKAVIDDKAKIIVPGATLTCGIADPKATPQPLPAKVEWYHSESEG  122

Query  117  YT--HDGPCEVWLDTTRVLTHDNC--HEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKN  172
            +T  H+GPCEVW D  RV   DNC  H   +  +   + S CTG   L  YW+ +    +
Sbjct  123  FTATHEGPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAM----H  178

Query  173  EYSWQVYKACVPL  185
              SWQVY  C PL
Sbjct  179  GPSWQVYVNCAPL  191

>PPTG_07520
Length=294

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 63/143 (44%), Gaps = 24/143 (17%)

Query  56   GFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR--  113
            G + +  F A  +  G       +D  K       D  CG T  +  PQ IP+   ++  
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  ---STGYTHDGPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRW  162
                 G+TH GPCE++LD   VL  D+C +   G         D  +D+SSC G C L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  163  YWLGVRFLKNEYSWQVYKACVPL  185
            YWL  +  +    WQ Y  CVPL
Sbjct  166  YWLAFQNAQ----WQTYVNCVPL  184

>PPTG_07516
Length=294

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 63/143 (44%), Gaps = 24/143 (17%)

Query  56   GFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR--  113
            G + +  F A  +  G       +D  K       D  CG T  +  PQ IP+   ++  
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  ---STGYTHDGPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLRW  162
                 G+TH GPCE++LD   VL  D+C +   G         D  +D+SSC G C L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  163  YWLGVRFLKNEYSWQVYKACVPL  185
            YWL  +  +    WQ Y  CVPL
Sbjct  166  YWLAFQNAQ----WQTYVNCVPL  184

>PPTG_18166
Length=445

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 69/147 (47%), Gaps = 24/147 (16%)

Query  56   GFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM---  112
            G + V  F    +  G       +D  K       D  CG T  + +P+ IPS   +   
Sbjct  53   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DQKCGNTVENGSPKPIPSDGKVKWF  105

Query  113  --RSTGYTHDGPCEVWLDTTRVLTHDNCHE--------AISGKDYTIDYSSCTGTCTLRW  162
              R  G+TH GPCE++LD   VL  D+C E        + SG +  +D+SSC G CTL  
Sbjct  106  GHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGGSDGSSSGSEMPVDFSSCNGKCTLTI  165

Query  163  YWLGVRFLKNEYSWQVYKACVPLSASA  189
            YWL  +  +    WQ Y  CVPLS S+
Sbjct  166  YWLAFQNAQ----WQTYVNCVPLSGSS  188

>PYU1_G001514
Length=469

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 61/127 (48%), Gaps = 23/127 (18%)

Query  72   YKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNA----MRSTGYT--HDGPCEV  125
            YK++RA +D AK     G D  CG T+A  A Q +P+         S G+T  H GPCEV
Sbjct  83   YKSMRALVD-AKGVFQPGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPCEV  141

Query  126  WLDTTRVLTHDNCHEAISGKDYTI-------DYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            W D TRV   DNC      KDYT        D S C G   L+ YWL +       +WQ 
Sbjct  142  WCDNTRVFQDDNC-----AKDYTTAPALLPYDRSKCVGASMLKIYWLALH----SSTWQA  192

Query  179  YKACVPL  185
            Y  C PL
Sbjct  193  YINCAPL  199

>H257_11264
Length=282

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 70/132 (53%), Gaps = 15/132 (11%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR----STGY  117
            +F    + + + +LRAF+D    T  +     CG T AD  P+++PS + ++    S G+
Sbjct  69   EFTRQLKKSSFASLRAFIDAQGNTGGE-----CGLTRADGTPRSLPSDSKVKWAHGSEGF  123

Query  118  --THDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYS  175
              +H+GPCE+W D TRV  +DNC   I      I+ S C G+  L   WL +   +    
Sbjct  124  VLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ----  179

Query  176  WQVYKACVPLSA  187
            WQVYK CV L++
Sbjct  180  WQVYKNCVRLTS  191

>PYIR_24421
Length=213

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 72/142 (51%), Gaps = 13/142 (9%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNA----MRSTGYT  118
            F A  +++ YK++R  ++ AK +   GA   CG +++  A Q +P+         S G+T
Sbjct  42   FTAALKSSSYKSVRDLVN-AKASFISGASKECGISSSSGAKQPLPAQYVEWAHSSSEGFT  100

Query  119  --HDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDY--SSCTGTCTLRWYWLGVRFLKNEY  174
              H+GPCEVW D     ++DNC +        + Y  S C+G   LR+YW+ +    +  
Sbjct  101  PSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVAL----HSS  156

Query  175  SWQVYKACVPLSASARRLKGAA  196
            +WQVY  C PLS +    K  A
Sbjct  157  TWQVYINCAPLSGAKGNNKAPA  178

>PYAP_22462
Length=210

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 72/140 (51%), Gaps = 26/140 (19%)

Query  68   RNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STGY--TH  119
            R  G+ +LRA +D A           CG +  D AP  +   + M+        G+  +H
Sbjct  82   RAGGFSSLRALLDPAAPG--------CGNSRTDVAPVDVSGLSVMQFQNDEEGKGFITSH  133

Query  120  DGPCEVWLDTTRVLTHDNCHEAISGKDYT--IDYSSCTG--TCTLRWYWLGVRFLKNEYS  175
             GPCE W+D TRV   D+C    +G   T  I+Y++C    TC L +YWL +    +E +
Sbjct  134  HGPCEAWIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLAL----HEAN  189

Query  176  WQVYKACVPLS--ASARRLK  193
            WQVYK CVP+    SAR+L+
Sbjct  190  WQVYKQCVPIKRGGSARQLR  209

>PPTG_01148
Length=295

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 71/128 (55%), Gaps = 22/128 (17%)

Query  69   NNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM------RSTGY--THD  120
            N+ +KTL+A MD      T  +D  CG T+   +P  + S ++M         G+  +H 
Sbjct  72   NSKFKTLKAMMD------TVASD--CGKTSLTGSPVDVSSLSSMTWQNDQEQKGFIDSHR  123

Query  121  GPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            GPCE W+D TRV   D+C    +G   +  +D+SSC+G CT  +YWL +    +E +WQV
Sbjct  124  GPCEGWIDDTRVFHSDDCRADYTGYPAEIPVDFSSCSGDCTFTFYWLAL----HEPNWQV  179

Query  179  YKACVPLS  186
            YK C P++
Sbjct  180  YKQCAPIT  187

>PYAP_18138
Length=268

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 15/116 (13%)

Query  68   RNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR-STGYTHDGPCEVW  126
            + +G K LR+++D AK T        CG +  D +P+ IP  N +      TH GPCE W
Sbjct  80   KQHGVKDLRSYID-AKIT-------ECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEFW  131

Query  127  LDTTRVLTHDNCHEAISGKD-YTIDYSSCTG-TCTLRWYWLGVRFLKNEYSWQVYK  180
            +D TRV  +++C      K    +DYS CTG TC LR+YWLG++       WQVY+
Sbjct  132  IDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGLQ----NSDWQVYR  183

>PYVX_22511
Length=303

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 66/129 (51%), Gaps = 13/129 (10%)

Query  69   NNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSG------NAMRSTGYTHDGP  122
             +GY TL+ +++  K T+  GA   CG    DA PQ +P+       +       +H GP
Sbjct  31   TSGYSTLKNYVN-VKMTLIPGATEECGLAIPDATPQPLPAKYVEWYHSPTEGLTESHHGP  89

Query  123  CEVWLDTTRVLTHDNC--HEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYK  180
            CE++   TRV  +D+C  H       +  D +SC G   L +YWL +    +EY WQVY 
Sbjct  90   CEIYCGNTRVFKNDDCSTHYKTIPAQFPYDRASCLGASHLTFYWLTL----HEYQWQVYI  145

Query  181  ACVPLSASA  189
             CVPL A++
Sbjct  146  NCVPLVATS  154

>PHYKE_1913
Length=280

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 58/108 (54%), Gaps = 17/108 (16%)

Query  91   DYHCGFTNADAAPQAIPS-GNAM----RSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG-  144
            D  CG+T ADA P+ +PS G A+       G+TH GPCEV+++   VL  D+C +   G 
Sbjct  83   DKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVLHGDDCEDEYPGG  142

Query  145  -------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
                    +  IDYSSC G CTL  YWL  +  +    WQ Y  CVPL
Sbjct  143  PDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQAYINCVPL  186

>PYAP_24691
Length=145

 Score = 77.0 bits (188),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 3/82 (4%)

Query  119  HDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQ  177
            H GPCE+W D TRV    +C +   S   + IDYS C G C LR+YWLG++       WQ
Sbjct  3    HPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQ  60

Query  178  VYKACVPLSASARRLKGAANES  199
             YK CVP+    R L    +E+
Sbjct  61   SYKNCVPIGNGKRMLAEGDDEA  82

>H257_11265
Length=282

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 74/144 (51%), Gaps = 18/144 (13%)

Query  53   ENQGFETVDDFNAWRRN---NGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSG  109
            EN      D+  A+ R    + + +LRAF+D    T  +     CG T AD  P+++PS 
Sbjct  57   ENYNLSPQDNTIAFTRQLKKSSFASLRAFIDAQGNTGGE-----CGLTRADGTPRSLPSD  111

Query  110  NAMR----STGY--THDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWY  163
            + ++    S G+  +H+GPCE+W D TRV  +DNC   I      I+ S C G+  L   
Sbjct  112  SKVKWAHGSEGFVLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIML  171

Query  164  WLGVRFLKNEYSWQVYKACVPLSA  187
            WL +   +    WQVYK CV L++
Sbjct  172  WLALHTSQ----WQVYKNCVRLTS  191

>PPTG_07521
Length=281

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 54/110 (49%), Gaps = 17/110 (15%)

Query  89   GADYHCGFTNADAAPQAIPSGNAMR-----STGYTHDGPCEVWLDTTRVLTHDNCHEAIS  143
            GA   CG T AD   Q IPS    +       G+TH GPCE++LD   VL  DNC +   
Sbjct  81   GAGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYP  140

Query  144  G--------KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            G         D  +DYSSCT  CTL  YWL  +      +WQ Y  CVPL
Sbjct  141  GGDVGSTVTSDMPVDYSSCTEDCTLTIYWLAFQ----NANWQAYINCVPL  186

>SDRG_15426
Length=523

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 25/144 (17%)

Query  60   VDDFN-AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM----RS  114
            V +FN A+   + YKTLR  +D        G D  CG T  + AP+ IPS   M      
Sbjct  33   VANFNKAFAAQSQYKTLRDLLD------LSGPD--CGNTRTNVAPKPIPSDGMMTWQNPD  84

Query  115  TGY----THDGPCEVWLDTTRVLTHDNC---HEAISGKDYTIDYSSC-TGTCTLRWYWLG  166
            TG     +H GPCE+WLD  RV  +DNC             +DY+ C    C LR+YWL 
Sbjct  85   TGEGFIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLA  144

Query  167  VRFLKNEYSWQVYKACVPLSASAR  190
            +     +  WQVYK CVPL  + +
Sbjct  145  LH----QPQWQVYKNCVPLQGNEQ  164

>PHYRA_84732
Length=265

 Score = 79.0 bits (193),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 71/136 (52%), Gaps = 27/136 (20%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSG-------NAMRST  115
            F +   N GY +LR  +D     VTD     C  T  D +P  + SG       N     
Sbjct  72   FTSAFPNAGYSSLRDMLD---QQVTD-----CANTRTDVSPVDV-SGLTVLNWQNDQEQK  122

Query  116  GY--THDGPCEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSCTGTCTLRWYWLGVRF  169
            G+  +H GPCEVW+D T+V   D+C  A  G  Y    + D+S C+G CTLR+YWL +  
Sbjct  123  GFIDSHHGPCEVWIDDTKVDHQDDC-VATYGSGYPASVSADFSKCSGDCTLRFYWLAL--  179

Query  170  LKNEYSWQVYKACVPL  185
              +E +WQVYK CVP+
Sbjct  180  --HEPNWQVYKQCVPV  193

>PHYKE_3912
Length=252

 Score = 78.6 bits (192),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 13/108 (12%)

Query  93   HCGFTNADAAPQAIPS-GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT---  148
            +CGFT+ +A P+  P+ G+A  S G  H G CE+WLD T VL+ D+C  A   +D T   
Sbjct  74   NCGFTDPNATPKDPPTIGDATFSCGMMHIGSCEIWLDDTMVLSSDDCQAAY--RDDTQEK  131

Query  149  ------IDYSSCTGTC-TLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189
                  ID S C+ +   LR+YWL  + + ++  WQVYK CVPL+  A
Sbjct  132  ASVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVYKDCVPLTGPA  179

>PHYCA_122958
Length=260

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 30/148 (20%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSG-------NAMRST  115
            F +   N GY +LR  +D     V+D     C  T  D +P  + SG       N     
Sbjct  69   FTSSFPNTGYSSLRNMLD---QQVSD-----CANTKTDVSPVDV-SGLTVMNWQNDQEQK  119

Query  116  GY--THDGPCEVWLDTTRVLTHDNCHEAISGKDYTI----DYSSCTGTCTLRWYWLGVRF  169
            G+  +H GPCEVW+D T V   D+C  A  G  Y      DYS C+G CTLR+YWL +  
Sbjct  120  GFIDSHHGPCEVWIDDTMVDHQDDC-VATYGSSYPANVKADYSQCSGDCTLRFYWLALH-  177

Query  170  LKNEYSWQVYKACVPL---SASARRLKG  194
               E +WQ+YK CVP+   S +  +++G
Sbjct  178  ---EPNWQIYKQCVPIVNNSGTQSQVQG  202

>PHYSO_324715
Length=274

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 80/152 (53%), Gaps = 21/152 (14%)

Query  68   RNNGYKT-LRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS--GNAMRSTGYTHDGPCE  124
            +  GY+  +R  +DG   T   GAD  CG+++ +A+P+  PS  G A  S G  H GPCE
Sbjct  64   KAEGYENNIRKLLDGD--TKLYGAD--CGYSDPNASPKD-PSTDGTATFSRGIAHHGPCE  118

Query  125  VWLDTTRVLTHDNCHEAISGKDY--------TIDYSSCTGT-CTLRWYWL---GVRFLKN  172
            +WLD   +L  D+C E     DY         IDYSSC+   C L +YWL   G     +
Sbjct  119  IWLDDKMILHDDDCEETFGTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQGRTTGNS  178

Query  173  EYSWQVYKACVPLSA-SARRLKGAANESAAIE  203
            +Y WQ+YK  V L+  +A ++  A+N +   E
Sbjct  179  KYVWQIYKCYVALTGPAAGQVSTASNSTQTTE  210

>PITG_08202
Length=191

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 70/140 (50%), Gaps = 18/140 (13%)

Query  58   ETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS-GNAMRSTG  116
            ++VD F + +  N +K LR  MD    T   GAD  CGFTN +  PQ IPS G A  S  
Sbjct  62   KSVDTFKSLKAANNFKDLRTLMDD---TSVYGAD--CGFTNPNDTPQPIPSDGKATFSRA  116

Query  117  YTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCT-GTCT-LRWYWLGVRFLKNEY  174
              H GPC +WLD    +      ++I    + +DYSSC+ G C  +R+YWL  + L  + 
Sbjct  117  LVHHGPCGIWLDDKMDI------KSI----FPVDYSSCSNGGCKQMRFYWLAFQGLNKKT  166

Query  175  SWQVYKACVPLSASARRLKG  194
             WQ Y       A + +  G
Sbjct  167  VWQSYSKSPVTPAPSSKCNG  186

>PHYKE_10295
Length=292

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 67/125 (54%), Gaps = 22/125 (18%)

Query  72   YKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STGY--THDGPC  123
            +KTLRA MD    TV       CG T    +P  + + ++M+        G+  +H GPC
Sbjct  75   FKTLRALMD----TVAP----DCGNTALTGSPVDVSALSSMKWQNDQEQKGFIDSHHGPC  126

Query  124  EVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKA  181
            E W+D TRV+  D+C         +  IDYSSC+G CT  +YW+ +    +E +WQVYK 
Sbjct  127  EAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMAL----HEPNWQVYKQ  182

Query  182  CVPLS  186
            C P++
Sbjct  183  CAPIT  187

>PYVX_24563
Length=254

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 71/136 (52%), Gaps = 22/136 (16%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAP------QAIPSGNAMRSTG  116
            F +   + GY +LRA +D +   V+D     CG T  D +P      + +   N     G
Sbjct  69   FTSTFPSTGYTSLRAMIDES---VSD-----CGNTRTDVSPVDMTGKKVLHWQNDQEGVG  120

Query  117  Y--THDGPCEVWLDTTRVLTHDNCHEAISGKDYTID--YSSCTGTCTLRWYWLGVRFLKN  172
            +  +H GPCEVW+D   V   D+C    +     +D  +S C+G+CTLR+YWL +    +
Sbjct  121  FVSSHHGPCEVWIDDVMVTHQDDCRAVYTSYPANVDADFSKCSGSCTLRFYWLAL----H  176

Query  173  EYSWQVYKACVPLSAS  188
            E +WQ+YK C P++ S
Sbjct  177  EPNWQIYKQCAPITNS  192

>PYIW_24289
Length=196

 Score = 77.0 bits (188),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 61/125 (49%), Gaps = 8/125 (6%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGP  122
            F++   +  Y+ LR  +D  K   + G D  CGFTN  +A Q + S +A      TH GP
Sbjct  78   FSSQTDSIKYRNLRDLID-TKAVFSAGTDKECGFTNVTSAKQPL-SAHATGGFTPTHQGP  135

Query  123  CEVWLDTTRVLTHDNCHEAISGKDYTIDY--SSCTGTCTLRWYWLGVRFLKNEYSWQVYK  180
            CE+W D   V  +DNC +        + Y  S C G   L++YWL V  +K    W+ Y 
Sbjct  136  CEIWCDRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYI  191

Query  181  ACVPL  185
             C PL
Sbjct  192  NCAPL  196

>SPRG_07826
Length=371

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 71/140 (51%), Gaps = 14/140 (10%)

Query  50   AFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAA-PQAIPS  108
            A+ ++ G+     F A  + + YKTL+AF+D    +   G    CG T  DAA PQ +PS
Sbjct  54   AYNQDPGYNAAQ-FAANFKTSKYKTLKAFLDAWDTSAQCG---QCGITKVDAANPQPLPS  109

Query  109  GNAMR---STGYT--HDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWY  163
                R   + G+T  H+GPCE+W D TRV  +D+C + I      ID S C G   L   
Sbjct  110  IVKWRHGDNEGFTPSHEGPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTML  169

Query  164  WLGVRFLKNEYSWQVYKACV  183
            W+ +   +    WQ YK CV
Sbjct  170  WMALHTPQ----WQAYKNCV  185

>PYAP_18226
Length=226

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 71/145 (49%), Gaps = 27/145 (19%)

Query  68   RNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STGY--TH  119
            + +G K+LR  MD  KY         CG TN +  P+ +     M         G+  +H
Sbjct  78   KQSGLKSLRQLMD--KYVPG------CGNTNPNTTPRDVTKLKTMNWQNNEYKEGFLASH  129

Query  120  DGPCEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSC-TGTCTLRWYWLGVRFLKNEY  174
             GPCEVW+D TRV  +++C  A + K Y     +DYS C +  C LR+YWL +   K   
Sbjct  130  RGPCEVWIDNTRVFQNNDC--AGNYKSYPASLPVDYSKCKSSKCMLRFYWLALHSEK---  184

Query  175  SWQVYKACVPLSASARRLKGAANES  199
             WQ YK CVP+   A R     +ES
Sbjct  185  -WQAYKQCVPIKYGASRSMDDEDES  208

>PITG_01966
Length=327

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 69/128 (54%), Gaps = 22/128 (17%)

Query  69   NNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM------RSTGY--THD  120
            N+ +KTL+A MD      T  +D  CG T+   +P  + S ++M         G+  +H 
Sbjct  105  NSKFKTLKALMD------TVASD--CGKTSLTGSPVDVSSLSSMTWQNDQEQKGFIDSHH  156

Query  121  GPCEVWLDTTRVLTHDNCHEAIS--GKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            GPCE W+D  RV   D+C    +    +  ID+SSC+G CT  +YWL +    +E +WQV
Sbjct  157  GPCEAWIDDKRVFHSDDCRADFTTYPAEIPIDFSSCSGDCTFTFYWLAL----HEPNWQV  212

Query  179  YKACVPLS  186
            YK C P++
Sbjct  213  YKQCAPIT  220

>PYAR_24113
Length=192

 Score = 76.3 bits (186),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 61/127 (48%), Gaps = 8/127 (6%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGF-TNADAAPQAIPSGNAMRSTGYTHDG  121
            FNA  +N+ YK+L+  +      V+ GA   CGF T + A PQ +P          +H G
Sbjct  66   FNAAFKNSKYKSLKELVL-QNQKVSAGATAECGFATLSGATPQPLPDVVEWDEFTGSHTG  124

Query  122  PCEVWLDTTRVLTHDNCHEAISGKDYTIDYS--SCTGTCTLRWYWLGVRFLKNEYSWQVY  179
            PCEVW D       DNC + I G    ++Y   +C G   L  YW+ +   +    WQVY
Sbjct  125  PCEVWCDNNLAFQDDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQVY  180

Query  180  KACVPLS  186
              C PLS
Sbjct  181  TGCAPLS  187

>PYIW_24288
Length=201

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 61/129 (47%), Gaps = 13/129 (10%)

Query  65   AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS------GNAMRSTGYT  118
            A+   N Y+ LR  +D      + GAD  CGFT+A  A Q +P+          +    T
Sbjct  78   AFGNQNRYRNLRELVDFTA-VFSAGADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPT  136

Query  119  HDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDY--SSCTGTCTLRWYWLGVRFLKNEYSW  176
            H+GPCEVW D        NC +   G    + Y  S CTG   L++YWL +    +   W
Sbjct  137  HEGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREW  192

Query  177  QVYKACVPL  185
            +VY  CVPL
Sbjct  193  EVYINCVPL  201

>SPRG_07825
Length=337

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 74/146 (51%), Gaps = 14/146 (10%)

Query  50   AFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAA-PQAIPS  108
            A+ ++ G+     F A  + + YKTL+AF+D    +   G    CG T  DAA PQ +PS
Sbjct  54   AYNQDPGYNAAQ-FAANFKTSKYKTLKAFLDAWDTSAQCG---QCGITKVDAANPQPLPS  109

Query  109  GNAMR---STGYT--HDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWY  163
                R   + G+T  H+GPCE+W D TRV  +D+C + I      ID S C G   L   
Sbjct  110  IVKWRHGDNEGFTPSHEGPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTML  169

Query  164  WLGVRFLKNEYSWQVYKACVPLSASA  189
            W+ +   +    WQ YK CV + ++ 
Sbjct  170  WMALHTPQ----WQAYKNCVAIGSAG  191

>SDRG_16534
Length=320

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 64/134 (48%), Gaps = 14/134 (10%)

Query  60   VDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS----GNAMRST  115
             D F    + + +KTL+AF+D        G D  CG T+++   Q +PS     N     
Sbjct  64   TDQFTKHFKASSFKTLKAFLD----AYPTGGD--CGITDSNGPAQPLPSTVKWANGQEGF  117

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYS  175
              +H GPCE+W D TRV   DNC   +     +ID S C+G   L   WL +   +    
Sbjct  118  ISSHQGPCELWCDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----  173

Query  176  WQVYKACVPLSASA  189
            WQVYK CV LS  A
Sbjct  174  WQVYKNCVNLSGVA  187

>PHYRA_77293
Length=302

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 65/125 (52%), Gaps = 22/125 (18%)

Query  72   YKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------STGY--THDGPC  123
            +KTLRA MD A           CG T        + S ++M+        G+  +H GPC
Sbjct  75   FKTLRALMDTAAP--------DCGNTALTGTAVDVSSLSSMKWQNDQEQKGFIDSHHGPC  126

Query  124  EVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKA  181
            E W+D TRV   D+C    +G   +  ID+SSC+G CT  +YW+ +    +E +WQVYK 
Sbjct  127  EAWIDDTRVFQSDDCRADYTGYPAEIPIDFSSCSGDCTFTFYWMAM----HEPNWQVYKQ  182

Query  182  CVPLS  186
            C P++
Sbjct  183  CAPIA  187

>PPTG_10186
Length=270

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 65/129 (50%), Gaps = 25/129 (19%)

Query  69   NNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM------RSTGY--THD  120
            N GY +LR  +D     VTD     C  T  D +P  +   + M         G+  +H 
Sbjct  78   NAGYSSLRDMLD---QQVTD-----CANTRTDVSPVDVSGLSVMNWQNDQEQKGFIDSHH  129

Query  121  GPCEVWLDTTRVLTHDNCHEAISGKDYT----IDYSSCTGTCTLRWYWLGVRFLKNEYSW  176
            GPCEVW+D T V   D+C  A  G  Y      D+S C+G CTLR+YWL +     E +W
Sbjct  130  GPCEVWIDDTMVDHQDDCVAAY-GTGYPASVKADFSKCSGDCTLRFYWLALH----EPNW  184

Query  177  QVYKACVPL  185
            Q+YK CVP+
Sbjct  185  QIYKQCVPI  193

>SPRG_07799
Length=345

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 72/130 (55%), Gaps = 16/130 (12%)

Query  62   DFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAA-PQAIPSGNAMR---STGY  117
            DF    + + +KTL+  ++    +   G +  CG T  D + PQA+PS    R   + G+
Sbjct  68   DFTKHFKASRFKTLKDLIE----SQPSGGE--CGITKLDPSKPQALPSVVRWRHGDNEGF  121

Query  118  T--HDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYS  175
            T  H+GPCE+W D TRV  ++NC + I+     ID + C G  TLR++WL +    +  S
Sbjct  122  TPSHEGPCELWCDNTRVYDNENCAKNIADGSMAIDTTKCAGAKTLRFFWLAL----HSSS  177

Query  176  WQVYKACVPL  185
            WQVYK CV L
Sbjct  178  WQVYKNCVAL  187

>SDRG_08782
Length=450

 Score = 78.2 bits (191),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 72/145 (50%), Gaps = 25/145 (17%)

Query  59   TVDDFN-AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM----R  113
             V +FN A++  + +KTLR  +D        G D  CG+T  +   +AIP    M     
Sbjct  58   NVANFNKAFKAQSQFKTLRDMLD------PHGPD--CGYTLTNVDKKAIPGNGQMTWKNP  109

Query  114  STGY----THDGPCEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGT-CTLRWYWL  165
             TG     +H GPCEVW+D  RV  +D+C          +  +DYSSC    C LR+YWL
Sbjct  110  DTGEGFIPSHKGPCEVWIDNERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWL  169

Query  166  GVRFLKNEYSWQVYKACVPLSASAR  190
             +     E  WQVYK CVPL  + +
Sbjct  170  ALH----EPMWQVYKNCVPLKGNGQ  190

>SDRG_00972
Length=333

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 75/146 (51%), Gaps = 14/146 (10%)

Query  50   AFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAA-PQAIPS  108
            A+ ++ G+     F A  + + YKTL+AF+D    +   G    CG T  DAA PQ +PS
Sbjct  53   AYNQDPGYNAAQ-FAANFKASKYKTLKAFLDAWDTSAQCG---QCGITKVDAANPQPLPS  108

Query  109  GNAMR---STGYT--HDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWY  163
                R   + G+T  H+GPCE+W D TR+  +D+C + I      ID S C+G   L   
Sbjct  109  IVKWRHGDNEGFTPSHEGPCELWCDETRLYYNDDCAKNIPDGSMPIDTSKCSGAKQLTML  168

Query  164  WLGVRFLKNEYSWQVYKACVPLSASA  189
            W+ +   +    WQ YK CV + ++ 
Sbjct  169  WMALHTPQ----WQAYKNCVAIGSAG  190

>PHYKE_5749
Length=300

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 50/105 (48%), Gaps = 17/105 (16%)

Query  94   CGFTNADAAPQAIPSGNAMR-----STGYTHDGPCEVWLDTTRVLTHDNCHEAISG----  144
            CG T  D  PQ IPS    +       G+TH GPCE++LD   VL  D+C +   G    
Sbjct  87   CGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVLHSDDCEDEFKGGPVG  146

Query  145  ----KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
                 D  +DYSSC G C    YWL  +  +    WQ Y  CVPL
Sbjct  147  STQTSDMPVDYSSCNGKCLFTIYWLAFQNAQ----WQTYINCVPL  187

>PYIR_14463
Length=369

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 69/132 (52%), Gaps = 24/132 (18%)

Query  60   VDDF-NAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSG------NAM  112
            VD F  A+   + +KTLR  +         GAD  CG +  DA+ +AIP        N  
Sbjct  76   VDTFTKAFNAQSEFKTLRDLLKD------HGAD--CGDSKPDASRKAIPGDGKVVWQNPD  127

Query  113  RSTGY--THDGPCEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGTCTLRWYWLGV  167
               G+  +H GPCEVWLD  RV + +NC    + K   +  +D+SSC G C LR+YWL +
Sbjct  128  SGEGFVPSHTGPCEVWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKGDCMLRFYWLAL  187

Query  168  RFLKNEYSWQVY  179
                +E +WQVY
Sbjct  188  ----HEPTWQVY  195

>SPRG_07797
Length=318

 Score = 76.6 bits (187),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 63/134 (47%), Gaps = 14/134 (10%)

Query  60   VDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS----GNAMRST  115
             D+F    + + +KTL+AF+D        G D  CG T+A+   Q +PS     N     
Sbjct  64   TDEFTKHFKASSFKTLKAFLDAHP----SGGD--CGITDANGPAQPLPSTVKWANGQEGF  117

Query  116  GYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYS  175
              +H GPCE+W D  RV   +NC         +ID S C+G   L   WL +        
Sbjct  118  ISSHQGPCELWCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALH----SPQ  173

Query  176  WQVYKACVPLSASA  189
            WQVYK CV LS +A
Sbjct  174  WQVYKNCVNLSGAA  187

>PHYRA_84947
Length=265

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 64/135 (47%), Gaps = 19/135 (14%)

Query  57   FETVDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADY-HCGFTNADAAPQAIPSGNAMR--  113
            +E VD   +W   N   +L+      +Y  T G D   CG T  + APQ +PS    +  
Sbjct  63   YEAVD---SWFTKNNIASLK------EYITTYGTDISECGVTKKNGAPQPVPSDGYAQHD  113

Query  114  STGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD---YTIDYSSCTGTCTLRWYWLGVRFL  170
            + G +H GPCE+W D TRV    NC    SG+      ID S+C  +  L +YWL +   
Sbjct  114  NLGNSHPGPCEIWCDDTRVFHDSNCVAKFSGQSPAKIPIDVSTCKSSSELVFYWLALHI-  172

Query  171  KNEYSWQVYKACVPL  185
                 WQVY  CV L
Sbjct  173  ---QPWQVYINCVAL  184

>PHALS_02044
Length=237

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 61/130 (47%), Gaps = 21/130 (16%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGP  122
            FNA    + YKTL+ F   A   +  GA   CGF+  D  PQ +P      +  Y+H GP
Sbjct  76   FNA----SKYKTLKEFA-WATQKLEKGASNECGFSLVDGQPQELPEMVEWDAFSYSHMGP  130

Query  123  CEVWLDTTRVLTHDNCHEAISGKDYT-------IDYSSCTGTCTLRWYWLGVRFLKNEYS  175
            CEVW D  RV  + NC     G DYT        D +SC G   L  YW+ V  +     
Sbjct  131  CEVWCDDKRVFQNWNC-----GVDYTETPAKLPYDKASCEGAAVLSCYWIAVHTVP----  181

Query  176  WQVYKACVPL  185
            WQ+Y  C P+
Sbjct  182  WQIYTNCAPI  191

>PHYKE_2539
Length=258

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 69/136 (51%), Gaps = 27/136 (20%)

Query  63   FNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSG-------NAMRST  115
            F +   N GY +LR  +D     VTD     C  T  D +P  + SG       N     
Sbjct  59   FTSSFANAGYSSLRDMLD---QQVTD-----CANTRTDVSPVDV-SGLTTMNWQNDQEQK  109

Query  116  GY--THDGPCEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSCTGTCTLRWYWLGVRF  169
            G+  +H GPCEVW+D T V   D+C  A  G  Y      D+S C+G CTLR+YW+ +  
Sbjct  110  GFIDSHHGPCEVWIDDTLVDHQDDC-VATYGSGYPASVNADFSKCSGDCTLRFYWIAL--  166

Query  170  LKNEYSWQVYKACVPL  185
              +E +WQ+YK CVP+
Sbjct  167  --HEPNWQIYKQCVPV  180

>SPRG_07627
Length=536

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 70/139 (50%), Gaps = 25/139 (18%)

Query  60   VDDFN-AWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM----RS  114
            V +FN A+     YKTLR  +D        G D  CG T  + A +AIPS   M      
Sbjct  57   VANFNKAFAAQTQYKTLRDLLD------LHGPD--CGNTLPNVAAKAIPSDGKMTWKNPD  108

Query  115  TG----YTHDGPCEVWLDTTRVLTHDNC---HEAISGKDYTIDYSSC-TGTCTLRWYWLG  166
            TG     +H GPCE+WLD+TRV  +++C     A       +DY+ C    C LR+YWL 
Sbjct  109  TGEGFIPSHTGPCEIWLDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLA  168

Query  167  VRFLKNEYSWQVYKACVPL  185
            +     +  WQVYK CVPL
Sbjct  169  LH----QPQWQVYKNCVPL  183

>PHALS_05110
Length=195

 Score = 73.9 bits (180),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 23/132 (17%)

Query  68   RNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAM--------RSTGYTH  119
             N+ Y +LR  +D     V+D     CG T  D AP  + +   +        R    +H
Sbjct  70   HNSSYSSLREMLDP---VVSD-----CGNTREDVAPVNVTNAKELLWQNDEEHRGFVDSH  121

Query  120  DGPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSS-CTGTCTLRWYWLGVRFLKNEYSW  176
             GPCEVW+D  R L +D+C    +       ID+++ C G C L++YWL +    +E +W
Sbjct  122  HGPCEVWIDNHRALFNDDCRATFTSYPAHLPIDFNALCDGQCHLKFYWLAL----HEAAW  177

Query  177  QVYKACVPLSAS  188
            QVYKAC P+  S
Sbjct  178  QVYKACAPIVNS  189

>PYU1_G005867
Length=200

 Score = 73.9 bits (180),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 27/143 (19%)

Query  61   DDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMR------S  114
            + F A  + +GY +LR  +D        G    C  +  D  P  +    +M+       
Sbjct  69   NTFTAAFKKSGYTSLRQMLDKK----VPG----CQNSRTDITPVNVKGATSMKWQNDWEH  120

Query  115  TGY--THDGPCEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSC-TGTCTLRWYWLGV  167
             G+  +H GPCEVW+D TRV  H++C  A   K Y     I+Y++C T  CTL +YWL +
Sbjct  121  KGFIDSHHGPCEVWIDNTRVFHHNDCVAAY--KTYPAVLPINYAACKTSKCTLTFYWLAL  178

Query  168  RFLKNEYSWQVYKACVPLSASAR  190
                +E +WQ+YK CVP++ S +
Sbjct  179  ----HEPNWQIYKHCVPITNSKK  197

>PHYSO_476077
Length=268

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 64/127 (50%), Gaps = 25/127 (20%)

Query  71   GYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS------GNAMRSTGY--THDGP  122
            GY +LR  +D     VTD     C  T  D +P  +         N     G+  +H GP
Sbjct  80   GYSSLRDMLD---QQVTD-----CANTRTDVSPVDVSGLTTMSWQNDQEQKGFIDSHHGP  131

Query  123  CEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            CEVW+D T V   D+C  A  G  Y      D+S C+G CTLR+YWL +    +E +WQ+
Sbjct  132  CEVWIDDTMVEHQDDC-VAKYGSGYPAKVNADFSKCSGDCTLRFYWLAL----HEPNWQI  186

Query  179  YKACVPL  185
            YK CVP+
Sbjct  187  YKQCVPV  193

>PHYSO_472009
Length=268

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 64/127 (50%), Gaps = 25/127 (20%)

Query  71   GYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPS------GNAMRSTGY--THDGP  122
            GY +LR  +D     VTD     C  T  D +P  +         N     G+  +H GP
Sbjct  80   GYSSLRDMLD---QQVTD-----CANTRTDVSPVDVSGLTTMSWQNDQEQKGFIDSHHGP  131

Query  123  CEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178
            CEVW+D T V   D+C  A  G  Y      D+S C+G CTLR+YWL +    +E +WQ+
Sbjct  132  CEVWIDDTMVEHQDDC-VAKYGSGYPAKVNADFSKCSGDCTLRFYWLAL----HEPNWQI  186

Query  179  YKACVPL  185
            YK CVP+
Sbjct  187  YKQCVPV  193

Lambda      K        H        a         alpha
   0.320    0.133    0.432    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9439740474

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40