Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_69845698645045022700.0
PHYSO_4800105698665345022180.0
PHYRA_72463926265845022140.0
PHYSO_485614926765345022130.0
PHYCA_1043356903565645022080.0
PHYCA_104465926765345022070.0
PHYSO_344705926279845022050.0
PITG_11244926266345022040.0
PHYSO_486085926565345022030.0
PPTG_02122926265745022000.0
PHYRA_724155698665545021990.0
PYAP_173349729165045021790.0
PHALS_043303140378544721780.0
PITG_11249926765344721730.0
PYU1_G0139279729164945021710.0
PITG_11247926565344721700.0
PHYCA_1044294084764545021240.0
H310_0261014834765044221230.0
SPRG_04533926765244221200.0
SDRG_11899926765244221190.0
SDRG_1147312211563644421160.0
SPRG_0006812211564344420910.0
PYAP_192359943964344320690.0
PYU1_G013931926266344320590.0
PYIW_16876926264345020510.0
CCI4322116052066045020500.0
HYAP_01537927065144720330.0
PYAP_17333926265744320290.0
CCA14967152039143143820290.0
PITG_11252927065444320190.0
PPTG_196902483756644720160.0
H310_09557926764444320150.0
PYVX_15641926262945020120.0
PHYCA_5329125698662645020120.0
CCI40249926766044320060.0
PHYSO_482793927065844720050.0
H257_12958926764944020050.0
CCA16153926766344319980.0
PHYKE_7016927065044819970.0
PHALS_09802927065144319820.0
PHYRA_71655927065344719730.0
PHYCA_104444927064444819550.0
PYAR_198079262161345019520.0
CCI4024715245664344419260.0
PHALS_013383001738337719190.0
CCA1615115245664345119160.0
H257_1732214834760644118760.0
PYIR_15859926262644818550.0
PYVX_229818037761244917900.0
PHYRA_418886871958635116650.0
HYAP_015407534563445616230.0
PYIR_158579729157745015730.0
H310_026044159331229614680.0
H257_18885976178644814620.0
PHYSO_28637647866044414600.0
PYIW_2175547865845014570.0
H310_1475912754278744814570.0
HYAP_0100547866044914540.0
HYAP_010049399666044914540.0
PYAR_18354478108444414520.0
PPTG_0824547865844414520.0
PYAP_1334147865744414500.0
PHYRA_7104247865444414490.0
PHYCA_51069647865944914490.0
PYVX_1673847865844414480.0
PHYKE_799247865745014480.0
H257_0000712754278744814450.0
PHALS_0083347865244414440.0
SDRG_05777976178644914420.0
PYU1_G00409847865645014380.0
SPRG_1051912754278244914320.0
HYAP_12660976178644914310.0
H310_0943447865845214300.0
CCA20828976178744914290.0
PITG_0052747865644914270.0
CCI46091976178744914250.0
PYU1_G0015408493763344914240.0
PITG_11913976178644914240.0
SDRG_0356447865844514230.0
PYIW_2656716585556444714220.0
PPTG_03121976178644914210.0
PYIR_243878493763344914190.0
PHYKE_10815976178644914170.0
PYU1_G0040979399666344114160.0
PYIW_221448493763344914150.0
PYVX_18121976163344914130.0
PHALS_02079976178644914130.0
PHYRA_78193976178644914130.0
PYAP_222388493763344914100.0
PHYCA_509820976178644913980.0
PYIW_168739729149629013820.0
CCI5023447866544513630.0
CCA2493647866144513490.0
SPRG_10477976176244313541e-180
PHYRA_722386941960144812443e-166
SPRG_0033347861544512368e-165
PPTG_0212075345100127412522e-162
PITG_153701240847428911542e-154
PHYSO_5254295984561044011341e-149
PPTG_021219729122221010711e-145
PYIR_1673747851132410861e-143
PITG_05721486430229210554e-142
PHYKE_90081272865044610675e-139
PYVX_150511272863244610631e-138
PHYRA_711231272863344610613e-138
PITG_157861272863344610589e-138
H257_012771272865245410572e-137
H310_066311272865144710572e-137
PYU1_G0037541272865044610563e-137
PHALS_076161272867744610583e-137
PPTG_182741272864844610545e-137
PHYCA_5411341272863344610535e-137
PYAP_197381272864844610537e-137
PHYSO_5004801272863344610511e-136
SDRG_110431272864944710512e-136
PPTG_16727927021720610066e-136
CCI459821272866145610416e-135
SPRG_1113312787367643910401e-134
CCA215141272865945610321e-133
PYAR_221881272863442510057e-130
PYIR_19697127286084259906e-128
PHYSO_339666694195854439825e-127
SDRG_058161275424793289658e-126
SPRG_02294127286344469666e-124
PHYRA_7159130975704429433e-121
PHYSO_55211630975704429381e-120
HYAP_0199330975694429321e-119
PYAP_1621630975644429266e-119
PPTG_1012230975694429261e-118
SDRG_1003830975654439205e-118
SDRG_057781275266182409161e-116
PYU1_G00694030975654429092e-116
PITG_0354630975694429076e-116
H310_1276530975604449023e-115
PITG_15111122191861808612e-114
PYIR_2412330975674428902e-113
H257_0765030975634448884e-113
PHYKE_6430975694428851e-112
PYAR_14487569864672508701e-111
SPRG_1569530975814438703e-110
PHYCA_532207309711184449027e-110
PHALS_0039030975694438642e-109
PYAR_19930849376253188673e-109
PHYRA_47873690353961908396e-108
PYVX_1769230975514418395e-106
SDRG_171221278733613708034e-103
PYAR_2470430975254288175e-103
PITG_16528133105614507962e-99
CCI4758230975824567946e-99
PYIW_19165309711243758188e-98
PYU1_G002895133105614547859e-98
PHYSO_493381133105624537841e-97
PHYCA_6458133105604547814e-97
PHYRA_79054133105634547797e-97
PPTG_05819133105614527735e-96
CCA2022930975834567702e-95
PYAR_14579133105674547623e-94
PYIW_17320133105634477527e-93
PHYRA_4786592673811707332e-92
PYIR_13638133105434467438e-92
PHALS_02692133105574537413e-91
PYAR_246871058826184497445e-91
SPRG_01255133105664487353e-90
CCI45261133105584537317e-90
H310_03911133105704487274e-89
PHYRA_51904408471291286823e-88
PYVX_13615133105854757181e-87
H257_01680133105714517144e-87
HYAP_01857133104924156936e-85
SDRG_16621133105314396932e-84
PYAP_19903133105274376896e-84
PHYSO_5252361275422462286603e-83
CCA22305133105614666864e-83
PHYSO_249932300172322126011e-74
SPRG_06720139304253916172e-74
PHALS_09281139304654046184e-74
SDRG_010681221786213776242e-73
SDRG_16559139304613916106e-73
PHYCA_120845139304443965982e-71
PHYRA_53570139303953955916e-71
PPTG_09003139304494005958e-71
H257_04453139304233895893e-70
PITG_17383139304384025851e-69
PYIR_21692139304683975837e-69
H310_12260139304243915771e-68
SPRG_001821221786153735902e-68
PYIW_19956139304594015766e-68
PYAP_18643457648043915932e-67
PYVX_13288457648103935932e-67
PYU1_G006843139304813975715e-67
PHYCA_504114127148873985926e-67
PYIW_17145127284432665651e-66
PYU1_G008851457647953935842e-66
HYAP_07918127148973985855e-66
PPTG_19375457648093915801e-65
PHYCA_111740415938103915801e-65
PITG_15771127148833985794e-65
CCA159131523708573935766e-65
PYAP_19741127148853945769e-65
PHYRA_82545457648063915731e-64
SPRG_001831221796093805631e-64
PHALS_04095457648033915702e-64
PHALS_08498127148953965732e-64
CCI467091523708193935703e-64
PHYRA_73661127148843985723e-64
H310_062291261518003925694e-64
PHYKE_6664457648043915669e-64
PYAR_16202127148933945672e-63
CCA27145139304634075443e-63
H257_164841261517953915571e-62
PHYSO_2555061271412283985642e-62
PHYKE_9011127149023985592e-62
SDRG_010671221796113835431e-61
PYAP_21865139304814115341e-61
PYIR_16738939965551605346e-61
PHYSO_54956197613612105191e-60
SDRG_032661261517923915422e-60
SPRG_080601261517933915422e-60
PPTG_04054314033242555117e-60
PYAR_15468457647693625379e-60
PYIW_142318611412434925395e-59
PHYSO_285382139303793535062e-58
PYIR_25979861144384005102e-58
PYIR_24220127149083975312e-58
H310_014931481489093975302e-58
PYVX_15061127148913975293e-58
H310_01496127149043975294e-58
CCA21519127149293985279e-58
PPTG_17083237953042144922e-57
HYAP_015389267130954745e-57
PYU1_G003764127149103965172e-56
HYAP_04460457648183935142e-56
H257_00287127148933975128e-56
PHYSO_339667525751601524602e-54
PYU1_G000896861147114824953e-54
PPTG_18280242463843524764e-54
PHYSO_247517457647943504966e-54
CCI11769139303723614712e-53
PYIR_18381457647473934902e-53
SDRG_01828127148664034923e-53
HYAP_10418139303152914628e-53
CCI45987127149394014891e-52
SPRG_06288127148694034872e-52
HYAP_01856618952892894539e-52
PPTG_14555167767034704691e-50
PYVX_18450139303863604502e-50
SPRG_110071278024261904515e-50
PHYCA_55893426644894114503e-49
PYIW_19676457646643044503e-48
PPTG_13159224481972564179e-48
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_6984

Length=450
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_6984                                                            879        0.0   
PHYSO_480010                                                          858        0.0   
PHYRA_72463                                                           857        0.0   
PHYSO_485614                                                          857        0.0   
PHYCA_104335                                                          855        0.0   
PHYCA_104465                                                          854        0.0   
PHYSO_344705                                                          853        0.0   
PITG_11244                                                            853        0.0   
PHYSO_486085                                                          853        0.0   
PPTG_02122                                                            852        0.0   
PHYRA_72415                                                           851        0.0   
PYAP_17334                                                            843        0.0   
PHALS_04330                                                           843        0.0   
PITG_11249                                                            841        0.0   
PYU1_G013927                                                          840        0.0   
PITG_11247                                                            840        0.0   
PHYCA_104429                                                          822        0.0   
H310_02610                                                            822        0.0   
SPRG_04533                                                            821        0.0   
SDRG_11899                                                            820        0.0   
SDRG_11473                                                            819        0.0   
SPRG_00068                                                            810        0.0   
PYAP_19235                                                            801        0.0   
PYU1_G013931                                                          797        0.0   
PYIW_16876                                                            794        0.0   
CCI43221                                                              794        0.0   
HYAP_01537                                                            787        0.0   
PYAP_17333                                                            786        0.0   
CCA14967                                                              786        0.0   
PITG_11252                                                            782        0.0   
PPTG_19690                                                            781        0.0   
H310_09557                                                            780        0.0   
PYVX_15641                                                            779        0.0   
PHYCA_532912                                                          779        0.0   
CCI40249                                                              777        0.0   
PHYSO_482793                                                          776        0.0   
H257_12958                                                            776        0.0   
CCA16153                                                              774        0.0   
PHYKE_7016                                                            773        0.0   
PHALS_09802                                                           768        0.0   
PHYRA_71655                                                           764        0.0   
PHYCA_104444                                                          757        0.0   
PYAR_19807                                                            756        0.0   
CCI40247                                                              746        0.0   
PHALS_01338                                                           743        0.0   
CCA16151                                                              742        0.0   
H257_17322                                                            727        0.0   
PYIR_15859                                                            719        0.0   
PYVX_22981                                                            694        0.0   
PHYRA_41888                                                           645        0.0   
HYAP_01540                                                            629        0.0   
PYIR_15857                                                            610        0.0   
H310_02604                                                            570        0.0   
H257_18885                                                            567        0.0   
PHYSO_286376                                                          566        0.0   
PYIW_21755                                                            565        0.0   
H310_14759                                                            565        0.0   
HYAP_01005                                                            564        0.0   
HYAP_01004                                                            564        0.0   
PYAR_18354                                                            563        0.0   
PPTG_08245                                                            563        0.0   
PYAP_13341                                                            563        0.0   
PHYRA_71042                                                           562        0.0   
PHYCA_510696                                                          562        0.0   
PYVX_16738                                                            562        0.0   
PHYKE_7992                                                            562        0.0   
H257_00007                                                            561        0.0   
PHALS_00833                                                           560        0.0   
SDRG_05777                                                            560        0.0   
PYU1_G004098                                                          558        0.0   
SPRG_10519                                                            556        0.0   
HYAP_12660                                                            555        0.0   
H310_09434                                                            555        0.0   
CCA20828                                                              555        0.0   
PITG_00527                                                            554        0.0   
CCI46091                                                              553        0.0   
PYU1_G001540                                                          553        0.0   
PITG_11913                                                            553        0.0   
SDRG_03564                                                            552        0.0   
PYIW_26567                                                            552        0.0   
PPTG_03121                                                            551        0.0   
PYIR_24387                                                            551        0.0   
PHYKE_10815                                                           550        0.0   
PYU1_G004097                                                          550        0.0   
PYIW_22144                                                            549        0.0   
PYVX_18121                                                            548        0.0   
PHALS_02079                                                           548        0.0   
PHYRA_78193                                                           548        0.0   
PYAP_22238                                                            547        0.0   
PHYCA_509820                                                          543        0.0   
PYIW_16873                                                            536        0.0   
CCI50234                                                              529        0.0   
CCA24936                                                              524        0.0   
SPRG_10477                                                            526        1e-180
PHYRA_72238                                                           483        3e-166
SPRG_00333                                                            480        8e-165
PPTG_02120                                                            486        2e-162
PITG_15370                                                            449        2e-154
PHYSO_525429                                                          441        1e-149
PPTG_02121                                                            417        1e-145
PYIR_16737                                                            422        1e-143
PITG_05721                                                            410        4e-142
PHYKE_9008                                                            415        5e-139
PYVX_15051                                                            414        1e-138
PHYRA_71123                                                           413        3e-138
PITG_15786                                                            412        9e-138
H257_01277                                                            411        2e-137
H310_06631                                                            411        2e-137
PYU1_G003754                                                          411        3e-137
PHALS_07616                                                           412        3e-137
PPTG_18274                                                            410        5e-137
PHYCA_541134                                                          410        5e-137
PYAP_19738                                                            410        7e-137
PHYSO_500480                                                          409        1e-136
SDRG_11043                                                            409        2e-136
PPTG_16727                                                            392        6e-136
CCI45982                                                              405        6e-135
SPRG_11133                                                            405        1e-134
CCA21514                                                              402        1e-133
PYAR_22188                                                            391        7e-130
PYIR_19697                                                            385        6e-128
PHYSO_339666                                                          382        5e-127
SDRG_05816                                                            376        8e-126
SPRG_02294                                                            376        6e-124
PHYRA_71591                                                           367        3e-121
PHYSO_552116                                                          365        1e-120
HYAP_01993                                                            363        1e-119
PYAP_16216                                                            361        6e-119
PPTG_10122                                                            361        1e-118
SDRG_10038                                                            358        5e-118
SDRG_05778                                                            357        1e-116
PYU1_G006940                                                          354        2e-116
PITG_03546                                                            353        6e-116
H310_12765                                                            352        3e-115
PITG_15111                                                            336        2e-114
PYIR_24123                                                            347        2e-113
H257_07650                                                            346        4e-113
PHYKE_64                                                              345        1e-112
PYAR_14487                                                            339        1e-111
SPRG_15695                                                            339        3e-110
PHYCA_532207                                                          352        7e-110
PHALS_00390                                                           337        2e-109
PYAR_19930                                                            338        3e-109
PHYRA_47873                                                           327        6e-108
PYVX_17692                                                            327        5e-106
SDRG_17122                                                            313        4e-103
PYAR_24704                                                            319        5e-103
PITG_16528                                                            311        2e-99 
CCI47582                                                              310        6e-99 
PYIW_19165                                                            319        8e-98 
PYU1_G002895                                                          306        9e-98 
PHYSO_493381                                                          306        1e-97 
PHYCA_6458                                                            305        4e-97 
PHYRA_79054                                                           304        7e-97 
PPTG_05819                                                            302        5e-96 
CCA20229                                                              301        2e-95 
PYAR_14579                                                            298        3e-94 
PYIW_17320                                                            294        7e-93 
PHYRA_47865                                                           286        2e-92 
PYIR_13638                                                            290        8e-92 
PHALS_02692                                                           290        3e-91 
PYAR_24687                                                            291        5e-91 
SPRG_01255                                                            287        3e-90 
CCI45261                                                              286        7e-90 
H310_03911                                                            284        4e-89 
PHYRA_51904                                                           267        3e-88 
PYVX_13615                                                            281        1e-87 
H257_01680                                                            279        4e-87 
HYAP_01857                                                            271        6e-85 
SDRG_16621                                                            271        2e-84 
PYAP_19903                                                            270        6e-84 
PHYSO_525236                                                          258        3e-83 
CCA22305                                                              268        4e-83 
PHYSO_249932                                                          236        1e-74 
SPRG_06720                                                            242        2e-74 
PHALS_09281                                                           242        4e-74 
SDRG_01068                                                            244        2e-73 
SDRG_16559                                                            239        6e-73 
PHYCA_120845                                                          234        2e-71 
PHYRA_53570                                                           232        6e-71 
PPTG_09003                                                            233        8e-71 
H257_04453                                                            231        3e-70 
PITG_17383                                                            229        1e-69 
PYIR_21692                                                            229        7e-69 
H310_12260                                                            226        1e-68 
SPRG_00182                                                            231        2e-68 
PYIW_19956                                                            226        6e-68 
PYAP_18643                                                            233        2e-67 
PYVX_13288                                                            233        2e-67 
PYU1_G006843                                                          224        5e-67 
PHYCA_504114                                                          232        6e-67 
PYIW_17145                                                            222        1e-66 
PYU1_G008851                                                          229        2e-66 
HYAP_07918                                                            229        5e-66 
PPTG_19375                                                            228        1e-65 
PHYCA_111740                                                          228        1e-65 
PITG_15771                                                            227        4e-65 
CCA15913                                                              226        6e-65 
PYAP_19741                                                            226        9e-65 
PHYRA_82545                                                           225        1e-64 
SPRG_00183                                                            221        1e-64 
PHALS_04095                                                           224        2e-64 
PHALS_08498                                                           225        2e-64 
CCI46709                                                              224        3e-64 
PHYRA_73661                                                           224        3e-64 
H310_06229                                                            223        4e-64 
PHYKE_6664                                                            222        9e-64 
PYAR_16202                                                            223        2e-63 
CCA27145                                                              214        3e-63 
H257_16484                                                            219        1e-62 
PHYSO_255506                                                          221        2e-62 
PHYKE_9011                                                            219        2e-62 
SDRG_01067                                                            213        1e-61 
PYAP_21865                                                            210        1e-61 
PYIR_16738                                                            210        6e-61 
PHYSO_549561                                                          204        1e-60 
SDRG_03266                                                            213        2e-60 
SPRG_08060                                                            213        2e-60 
PPTG_04054                                                            201        7e-60 
PYAR_15468                                                            211        9e-60 
PYIW_14231                                                            212        5e-59 
PHYSO_285382                                                          199        2e-58 
PYIR_25979                                                            201        2e-58 
PYIR_24220                                                            209        2e-58 
H310_01493                                                            208        2e-58 
PYVX_15061                                                            208        3e-58 
H310_01496                                                            208        4e-58 
CCA21519                                                              207        9e-58 
PPTG_17083                                                            194        2e-57 
HYAP_01538                                                            187        5e-57 
PYU1_G003764                                                          203        2e-56 
HYAP_04460                                                            202        2e-56 
H257_00287                                                            201        8e-56 
PHYSO_339667                                                          181        2e-54 
PYU1_G000896                                                          195        3e-54 
PPTG_18280                                                            187        4e-54 
PHYSO_247517                                                          195        6e-54 
CCI11769                                                              186        2e-53 
PYIR_18381                                                            193        2e-53 
SDRG_01828                                                            194        3e-53 
HYAP_10418                                                            182        8e-53 
CCI45987                                                              192        1e-52 
SPRG_06288                                                            192        2e-52 
HYAP_01856                                                            179        9e-52 
PPTG_14555                                                            185        1e-50 
PYVX_18450                                                            177        2e-50 
SPRG_11007                                                            178        5e-50 
PHYCA_558934                                                          177        3e-49 
PYIW_19676                                                            177        3e-48 
PPTG_13159                                                            165        9e-48 
PITG_21580                                                            172        3e-46 
PITG_03068                                                            169        3e-45 
PHYSO_321565                                                          169        5e-45 
PHYSO_249902                                                          150        4e-43 
PPTG_10700                                                            147        9e-42 
PYIW_21045                                                            144        5e-36 
PYU1_G004743                                                          142        1e-35 
PPTG_22662                                                            134        2e-34 
PHYKE_7077                                                            138        3e-34 
PHALS_00479                                                           138        3e-34 
PPTG_17863                                                            127        6e-34 
PYAR_13948                                                            137        9e-34 
HYAP_01510                                                            126        9e-34 
PHYSO_353741                                                          134        1e-32 
PITG_02259                                                            131        7e-32 
PYAP_23247                                                            130        1e-31 
PPTG_18422                                                            129        5e-31 
SPRG_00713                                                            127        2e-30 
H257_18435                                                            127        2e-30 
PPTG_23878                                                            127        4e-30 
HYAP_00880                                                            125        6e-30 
SDRG_01561                                                            125        1e-29 
PHYKE_585                                                             123        4e-29 
PYIR_14416                                                            123        5e-29 
HYAP_06818                                                            118        8e-29 
PHYCA_502791                                                          121        2e-28 
PYAR_22140                                                            115        2e-27 
H310_05216                                                            116        7e-27 
PYVX_22905                                                            116        8e-27 
PHYRA_80453                                                           114        4e-26 
SPRG_10476                                                            108        1e-25 
PYVX_22561                                                            103        6e-23 
SPRG_17185                                                            92.0       7e-22 
HYAP_04461                                                            85.9       8e-19 
PYAP_20766                                                            91.3       1e-18 
PYVX_17117                                                            91.3       2e-18 
PYIW_19781                                                            89.0       7e-18 
PHYRA_46132                                                           82.0       9e-18 
PHYCA_549822                                                          86.7       2e-17 
PPTG_04864                                                            85.1       1e-16 
PHYRA_82300                                                           84.0       5e-16 
PYU1_G008203                                                          82.4       7e-16 
PYIR_20734                                                            77.0       5e-14 
PHYSO_342817                                                          72.8       7e-14 
PHYKE_9691                                                            74.3       6e-13 
PHYSO_532708                                                          71.2       9e-13 
SPRG_08648                                                            68.2       3e-11 
PITG_03970                                                            66.2       5e-11 
SDRG_10651                                                            67.0       7e-11 
HYAP_01511                                                            54.7       2e-07 
PYAR_19707                                                            56.2       2e-07 
H257_09465                                                            54.3       9e-07 
H257_16775                                                            53.5       9e-07 
PHYRA_81377                                                           51.6       5e-06 
H310_13261                                                            50.8       1e-05 
PHYRA_54751                                                           44.7       2e-05 
PPTG_09610                                                            43.5       5e-05 
PPTG_17862                                                            46.6       5e-05 
PPTG_03570                                                            45.8       6e-05 
PPTG_23039                                                            42.0       8e-04 
PPTG_22091                                                            37.7       0.007 
PPTG_05521                                                            37.7       0.007 
H257_18082                                                            38.1       0.045 
H310_10060                                                            38.1       0.045 
SDRG_11277                                                            35.4       0.051 
PYIW_26103                                                            38.5       0.085 
PPTG_23917                                                            33.5       0.22  
PYIW_17996                                                            35.0       1.1   
PYIW_26201                                                            34.7       1.2   
H310_03276                                                            34.7       1.5   
H257_04365                                                            32.7       4.7   
PHYSO_501600                                                          32.0       8.3   
H310_08191                                                            32.0       9.7   

>PHYKE_6984
Length=450

 Score = 879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/450 (100%), Positives = 450/450 (100%), Gaps = 0/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF
Sbjct  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN
Sbjct  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  361  GKEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  420

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450

>PHYSO_480010
Length=653

 Score = 858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/450 (98%), Positives = 445/450 (99%), Gaps = 2/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQTT+  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQTTS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFK+SSGAGDKPQITVQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  359  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  418

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  448

>PHYRA_72463
Length=658

 Score = 857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/450 (98%), Positives = 444/450 (99%), Gaps = 1/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ  TS GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQAKTS-GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  59

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFKL+SGAGDKPQITVQFKGESKTF
Sbjct  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  299

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  359

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  360  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  419

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  420  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  449

>PHYSO_485614
Length=653

 Score = 857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/450 (97%), Positives = 444/450 (99%), Gaps = 2/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQTT+  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQTTS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDP+VQ+DIKHWPFK+SSG GDKPQITVQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFKISSGPGDKPQITVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  359  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  418

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  448

>PHYCA_104335
Length=656

 Score = 855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/450 (97%), Positives = 444/450 (99%), Gaps = 1/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            M Q TTS GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA
Sbjct  1    MTQATTS-GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  59

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDP+VQ+DIKHWPF+++SGAGDKPQITVQFKGESKTF
Sbjct  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  240  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  299

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  359

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  360  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  419

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  420  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  449

>PHYCA_104465
Length=653

 Score = 854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/450 (97%), Positives = 444/450 (99%), Gaps = 1/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            M Q TTS GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA
Sbjct  1    MTQATTS-GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  59

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDP+VQ+DIKHWPF+++SGAGDKPQITVQFKGESKTF
Sbjct  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  240  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  299

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  359

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  360  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  419

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  420  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  449

>PHYSO_344705
Length=798

 Score = 853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/450 (97%), Positives = 444/450 (99%), Gaps = 2/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ+ +  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  142  MAQSVS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  199

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFK+SSGAGDKPQITVQFKGESKTF
Sbjct  200  KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTF  259

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  260  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  319

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  320  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  379

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  380  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  439

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  440  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  499

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  500  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  559

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  560  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  589

>PITG_11244
Length=663

 Score = 853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/450 (97%), Positives = 444/450 (99%), Gaps = 2/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ+ +  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQSVS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFK+++GAGDKPQITVQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITAGAGDKPQITVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  359  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  418

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  448

>PHYSO_486085
Length=653

 Score = 853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/450 (97%), Positives = 445/450 (99%), Gaps = 2/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQTT+  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQTTS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDP+VQ+DI+HWPFK+SSG GDKPQITVQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIQHWPFKISSGPGDKPQITVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLV++FV EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVEYFVQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  359  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  418

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  448

>PPTG_02122
Length=657

 Score = 852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/450 (97%), Positives = 443/450 (98%), Gaps = 2/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ+ +  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQSVS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFK++SG GDKPQITVQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  359  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  418

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  448

>PHYRA_72415
Length=655

 Score = 851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/450 (97%), Positives = 443/450 (98%), Gaps = 1/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ  TS GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQAKTS-GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  59

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFKL+SGAGDKPQITVQFKGESKTF
Sbjct  60   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  119

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  120  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  179

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  180  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  239

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  240  RLVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  299

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFN
Sbjct  300  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFN  359

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  360  GKEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLI  419

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKK+QTFSTYADNQPGVLIQVFE
Sbjct  420  ARNTTVPTKKAQTFSTYADNQPGVLIQVFE  449

>PYAP_17334
Length=650

 Score = 843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/450 (96%), Positives = 439/450 (98%), Gaps = 2/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ  +  G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA
Sbjct  1    MAQAVS--GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPF +S GAGDKPQITVQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFTVSPGAGDKPQITVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVL KMREVAEAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLTKMREVAEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHFVSEFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVDHFVSEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  299  TITRARFEDMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEPCKSINPDEAVAFGATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  359  GKEPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  418

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             RNTTVPTKK+QTFSTYADNQPGVLIQVFE
Sbjct  419  PRNTTVPTKKTQTFSTYADNQPGVLIQVFE  448

>PHALS_04330
Length=785

 Score = 843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/447 (97%), Positives = 440/447 (98%), Gaps = 2/447 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ+ +  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQSVS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDP+VQ+DIKHWPFK++SGAGDKPQI VQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPLVQADIKHWPFKVTSGAGDKPQIVVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  359  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  418

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQ  447
            ARNTTVPTKKSQTFSTYADNQPGVLIQ
Sbjct  419  ARNTTVPTKKSQTFSTYADNQPGVLIQ  445

>PITG_11249
Length=653

 Score = 841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/447 (95%), Positives = 440/447 (98%), Gaps = 0/447 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T  ++GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQ
Sbjct  2    TQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNA NTVFDAKRLIGRKFSDP+VQ+DIKHWPFK+++G GDKPQITVQFKGE+KTFQPE
Sbjct  62   VAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPT
Sbjct  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            +HFV EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTIT
Sbjct  242  EHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTIT  301

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLSDFFNGKE
Sbjct  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
            P KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARN
Sbjct  362  PNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARN  421

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            TTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  422  TTVPTKKSQTFSTYADNQPGVLIQVFE  448

>PYU1_G013927
Length=649

 Score = 840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/450 (95%), Positives = 438/450 (97%), Gaps = 2/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ     G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQAVA--GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+D KHWPF +S+G GDKPQITVQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADCKHWPFTVSAGPGDKPQITVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREV+EAFIGKEV+NAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVSEAFIGKEVRNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHFV EFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNS
Sbjct  239  RLVDHFVQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  299  TITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEPCKSINPDEAVAFGATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  359  GKEPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  418

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            +RNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  419  SRNTTVPTKKSQTFSTYADNQPGVLIQVFE  448

>PITG_11247
Length=653

 Score = 840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/447 (95%), Positives = 440/447 (98%), Gaps = 0/447 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T  ++GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQ
Sbjct  2    TQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNA NTVFDAKRLIGRKFSDP+VQ+DIKHWPFK+++G GDKPQITVQFKGE+KTFQPE
Sbjct  62   VAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPT
Sbjct  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            +HFV EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSS+QAYIEIDSLFDG+DFNSTIT
Sbjct  242  EHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFDGVDFNSTIT  301

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLSDFFNGKE
Sbjct  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
            P KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARN
Sbjct  362  PNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARN  421

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            TTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  422  TTVPTKKSQTFSTYADNQPGVLIQVFE  448

>PHYCA_104429
Length=645

 Score = 822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/450 (95%), Positives = 432/450 (96%), Gaps = 14/450 (3%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ+ +  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQSVS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFKL+SGAGDKPQITVQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP           
Sbjct  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP-----------  347

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
             KEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  348  -KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  406

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  407  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  436

>H310_02610
Length=650

 Score = 822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/442 (94%), Positives = 433/442 (98%), Gaps = 0/442 (0%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  68
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  69   HNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSM  128
             NTVFDAKRLIGRKF+DP++Q+DIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            VLIKM+EV+EA+IG  V NAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  189  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF +
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  249  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  308
            EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  309  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  368
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  369  NPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
            KKSQTFSTYADNQPGVLIQVFE
Sbjct  426  KKSQTFSTYADNQPGVLIQVFE  447

>SPRG_04533
Length=652

 Score = 821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/442 (94%), Positives = 430/442 (97%), Gaps = 0/442 (0%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  68
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  69   HNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSM  128
             NTVFDAKRLIGRKF+DP  Q+DIKHWPFK++ GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            VLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  189  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF +
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  249  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  308
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  309  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  368
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  369  NPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
            KKSQTFSTYADNQPGVLIQVFE
Sbjct  426  KKSQTFSTYADNQPGVLIQVFE  447

>SDRG_11899
Length=652

 Score = 820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/442 (94%), Positives = 430/442 (97%), Gaps = 0/442 (0%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  68
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  69   HNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSM  128
             NTVFDAKRLIGRKF+DP  Q+DIKHWPFK++ GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            VLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  189  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF +
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  249  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  308
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRARFE
Sbjct  246  EFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRARFE  305

Query  309  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  368
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  369  NPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
            KKSQTFSTYADNQPGVLIQVFE
Sbjct  426  KKSQTFSTYADNQPGVLIQVFE  447

>SDRG_11473
Length=636

 Score = 819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/444 (92%), Positives = 430/444 (97%), Gaps = 0/444 (0%)

Query  7    STGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            +T YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  2    TTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKRLIGRKF D +VQ+DIKHWPFK++SGA DKPQITVQFKGESKTFQPEEIS
Sbjct  62   NATNTVFDAKRLIGRKFHDAVVQADIKHWPFKVTSGAADKPQITVQFKGESKTFQPEEIS  121

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVLIKM+E++EA++G  V NAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAA
Sbjct  122  SMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  181

Query  187  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  182  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  241

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
             +EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRAR
Sbjct  242  TAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRAR  301

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FED+C DYFRKTMEPVEKVL+DAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGKEPCK
Sbjct  302  FEDLCADYFRKTMEPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPCK  361

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
            SINPDEAVAFGATVQAAILSG+  S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTTV
Sbjct  362  SINPDEAVAFGATVQAAILSGDTQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTV  421

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTYADNQPGVLIQV+E
Sbjct  422  PTKKSQTFSTYADNQPGVLIQVYE  445

>SPRG_00068
Length=643

 Score = 810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/444 (91%), Positives = 429/444 (97%), Gaps = 0/444 (0%)

Query  7    STGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            +T YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAKNQVAM
Sbjct  3    TTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKNQVAM  62

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKRLIGRKF D +VQ+DIKHWPFK++ GA DKPQITV+FKGESKTFQPEEIS
Sbjct  63   NAANTVFDAKRLIGRKFHDAVVQADIKHWPFKVTPGAADKPQITVEFKGESKTFQPEEIS  122

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVLIKM+E++EA++G  V NAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAA
Sbjct  123  SMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  182

Query  187  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  183  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  242

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
             +EFKRKHRKD+T+NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRAR
Sbjct  243  TAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSASAQAYIEIDSLFDGVDFNSTITRAR  302

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FED+C DYFRKTM+PVEKVL+DAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGKEPCK
Sbjct  303  FEDLCADYFRKTMDPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPCK  362

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
            SINPDEAVAFGATVQAAILSG++ S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTTV
Sbjct  363  SINPDEAVAFGATVQAAILSGDNQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTV  422

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTYADNQPGVLIQV+E
Sbjct  423  PTKKSQTFSTYADNQPGVLIQVYE  446

>PYAP_19235
Length=643

 Score = 801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/443 (90%), Positives = 424/443 (96%), Gaps = 0/443 (0%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  67
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  5    SGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  64

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            AHNTVFDAKRLIGRKF+DP+VQ+D+KHWPFK+ +GAGDKPQITV+FKGE K FQPEEISS
Sbjct  65   AHNTVFDAKRLIGRKFTDPVVQADMKHWPFKVVTGAGDKPQITVEFKGEKKVFQPEEISS  124

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KM+E+AEA++G +VKNAVITVPAYFNDSQRQAT+DAG IAG+NV+RIINEPTAAAI
Sbjct  125  MVLTKMKEIAEAYLGTDVKNAVITVPAYFNDSQRQATRDAGTIAGLNVMRIINEPTAAAI  184

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV++FV
Sbjct  185  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVEYFV  244

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
            +EFKRKH+KD+T NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDGIDFNSTITRARF
Sbjct  245  AEFKRKHKKDLTTNQRALRRLRTACERAKRTLSSSTQAYVEIDSLFDGIDFNSTITRARF  304

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            EDMC DYFRKTMEPVEKVL DAK+ K QVHEVVLVGGSTRIPKVQQLL DFFNGKEPCKS
Sbjct  305  EDMCADYFRKTMEPVEKVLHDAKICKGQVHEVVLVGGSTRIPKVQQLLVDFFNGKEPCKS  364

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            INPDEAVAFGA VQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLI RNT VP
Sbjct  365  INPDEAVAFGAAVQAAILSGDDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIPRNTAVP  424

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
            TKKSQTFSTYADNQPGVLIQVFE
Sbjct  425  TKKSQTFSTYADNQPGVLIQVFE  447

>PYU1_G013931
Length=663

 Score = 797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/443 (90%), Positives = 425/443 (96%), Gaps = 0/443 (0%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  67
            TG SVGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAA+NQVAMN
Sbjct  12   TGQSVGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAARNQVAMN  71

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            AHNTVFDAKRLIGRKF+DP+VQ+D KHWPFK+ +GA  KPQI VQFKGESKTFQPEEISS
Sbjct  72   AHNTVFDAKRLIGRKFTDPVVQADTKHWPFKVVAGAESKPQIVVQFKGESKTFQPEEISS  131

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KM+E+AEA+IGK+VKNAVITVPAYFNDSQRQATKDAG I+G+NVLRIINEPTAAAI
Sbjct  132  MVLTKMKEIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAI  191

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR+V++FV
Sbjct  192  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRIVEYFV  251

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
             EFKRKHRKD+T NQRALRRLRTACERAKRTLSSS+QAYIEIDSLF+GIDFNSTITRARF
Sbjct  252  QEFKRKHRKDMTGNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFEGIDFNSTITRARF  311

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            ED+C DYFRKTMEPVE+VLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK+  KS
Sbjct  312  EDLCADYFRKTMEPVERVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKDLYKS  371

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            INPDEAVAFGATVQAAILSG+D S +LQDLLLLDV PLS+GLETAGGVMTTLI RNTTVP
Sbjct  372  INPDEAVAFGATVQAAILSGSDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIPRNTTVP  431

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
            TKKSQTFSTYADNQPGVLIQVFE
Sbjct  432  TKKSQTFSTYADNQPGVLIQVFE  454

>PYIW_16876
Length=643

 Score = 794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/450 (89%), Positives = 425/450 (94%), Gaps = 2/450 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ     G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQAVA--GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMN  NTVFDAKRLIGRKFSD +VQ+D+KHWPFK+ +GA +KPQI V FKGE+KTF
Sbjct  59   KNQVAMNPANTVFDAKRLIGRKFSDQVVQADLKHWPFKVVAGADNKPQIVVHFKGETKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREV+EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAI+G+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVSEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAISGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLV+ F +EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVEFFTAEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFED+C DYFRKTMEPVE+VLRDAKLSK QV+E+VLVGGSTRIPKVQQ+LS+FFN
Sbjct  299  TITRARFEDLCADYFRKTMEPVERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSEFFN  358

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GK+  KSINPDEAVAFGATVQAAILSGND S +LQDLLLLDV PLS+GLETAGGVMTTLI
Sbjct  359  GKDLYKSINPDEAVAFGATVQAAILSGNDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLI  418

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             RNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  419  PRNTTVPTKKSQTFSTYADNQPGVLIQVFE  448

>CCI43221
Length=660

 Score = 794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/450 (89%), Positives = 428/450 (95%), Gaps = 3/450 (1%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ +   G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQVS---GPSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  57

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNA NTVFDAKRLIGR+ SDP+VQ+DIKHWPFK++S  GDK  ITVQ+KGE+K+F
Sbjct  58   KNQVAMNATNTVFDAKRLIGRRCSDPVVQADIKHWPFKVTSSEGDKTMITVQYKGETKSF  117

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            +PEEISSMVLIKMRE+AEAF+GK+VKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  118  RPEEISSMVLIKMREIAEAFLGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  177

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLD+KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDN
Sbjct  178  EPTAAAIAYGLDRKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN  237

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHFV+EF RKHRKDIT NQRALRRLRTACERAKRTLSSSAQA+IEIDSLF+G+DFNS
Sbjct  238  RLVDHFVAEFNRKHRKDITTNQRALRRLRTACERAKRTLSSSAQAHIEIDSLFEGVDFNS  297

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFED+C DYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFN
Sbjct  298  TITRARFEDLCADYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFN  357

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKE CKSINPDEAVAFGATVQAAILSG + SEKLQDLLLLDV PLSLGLETAGGVMTTLI
Sbjct  358  GKELCKSINPDEAVAFGATVQAAILSGTEQSEKLQDLLLLDVAPLSLGLETAGGVMTTLI  417

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             RNTT+PTKKSQ FSTY +NQPGV IQVFE
Sbjct  418  PRNTTLPTKKSQMFSTYQENQPGVCIQVFE  447

>HYAP_01537
Length=651

 Score = 787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/447 (88%), Positives = 422/447 (94%), Gaps = 0/447 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T + TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQ
Sbjct  2    TESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNAHNTVFDAKRLIGRKFSDP VQSDIKHWPFK++  + DKPQ+ VQFKGE+K FQPE
Sbjct  62   VAMNAHNTVFDAKRLIGRKFSDPEVQSDIKHWPFKVTRDSADKPQVEVQFKGETKRFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVLIKMRE+AEA+IGK+V+NAV+TVPAYFNDSQRQATKDAGAIAG+NVLRIINEPT
Sbjct  122  EISSMVLIKMREIAEAYIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKKGGE NVLIFDLGGGTFDVSLLSIE+GIFEVKATAGDTHLGGEDFDNRLV
Sbjct  182  AAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLV  241

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            DHFVSEFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSL DGIDFN+TIT
Sbjct  242  DHFVSEFKRKHRKDMTLNQRALRRLRTACERAKRTLSTSAQAYIEIDSLLDGIDFNTTIT  301

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFED+C D+FRKTMEPV +VLRD+KLSK +VHE+VLVGGSTRIPKVQQLL DFFNGKE
Sbjct  302  RARFEDLCADFFRKTMEPVAQVLRDSKLSKGEVHEIVLVGGSTRIPKVQQLLIDFFNGKE  361

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
              KSINPDEAVA+GATVQAAILSG  +S KLQDLLLLDV PLSLGLETAGGVMT LI RN
Sbjct  362  LFKSINPDEAVAYGATVQAAILSGGGASSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRN  421

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            TTVP KKSQ+FSTYADNQPGVLIQVFE
Sbjct  422  TTVPAKKSQSFSTYADNQPGVLIQVFE  448

>PYAP_17333
Length=657

 Score = 786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/443 (89%), Positives = 424/443 (96%), Gaps = 0/443 (0%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  67
            TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT TERLIGDAAKNQVAMN
Sbjct  7    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGTERLIGDAAKNQVAMN  66

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            AHNTVFDAKRLIGRKF DP+VQ+D+KHWPF++ +G  DKPQI V+FKGESK F  EEISS
Sbjct  67   AHNTVFDAKRLIGRKFRDPVVQADLKHWPFQVVAGPDDKPQIIVEFKGESKRFYAEEISS  126

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KMR++AEA+IGK+VKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAI
Sbjct  127  MVLTKMRDIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV++FV
Sbjct  187  AYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYFV  246

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
             EFKRKHR+D++ NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++GIDFNSTITRARF
Sbjct  247  GEFKRKHRRDMSNNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGIDFNSTITRARF  306

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            ED+CGD+FRKTMEPVE+VLRD+KLSKSQV EVVLVGGSTRIPK+QQ+LSD+FNGKE  KS
Sbjct  307  EDLCGDFFRKTMEPVERVLRDSKLSKSQVQEVVLVGGSTRIPKIQQMLSDYFNGKELYKS  366

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            INPDEAVAFGATVQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVP
Sbjct  367  INPDEAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVP  426

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
            TKKSQTFSTYADNQPGVLIQVFE
Sbjct  427  TKKSQTFSTYADNQPGVLIQVFE  449

>CCA14967
Length=1431

 Score = 786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/438 (89%), Positives = 420/438 (96%), Gaps = 0/438 (0%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
             IDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA NTV
Sbjct  22   SIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAINTV  81

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            FDAKRLIGR+ SDP+VQ+DIKHWPFK++S  GDKP ITVQ+KGE+K+F+PEEISSMVLIK
Sbjct  82   FDAKRLIGRRCSDPVVQADIKHWPFKVTSCEGDKPMITVQYKGETKSFRPEEISSMVLIK  141

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            MRE+A+A++G +VKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAIAYGLD
Sbjct  142  MREIAQAYLGNDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  201

Query  193  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKR  252
            +KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFV+EF R
Sbjct  202  RKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVAEFNR  261

Query  253  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  312
            KHRKDI  NQRALRRLRTACERAKRTLSSSAQA IEIDSLF+G+DFNSTITRARFED+CG
Sbjct  262  KHRKDIATNQRALRRLRTACERAKRTLSSSAQAQIEIDSLFEGVDFNSTITRARFEDLCG  321

Query  313  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDE  372
            DYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGK+ CKSINPDE
Sbjct  322  DYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKDLCKSINPDE  381

Query  373  AVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQ  432
            AVAFGATVQAAILSG + SEKLQDLLLLDV PLSLGLETAGGVMTTLI RNTT+PTKKSQ
Sbjct  382  AVAFGATVQAAILSGTEKSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTLPTKKSQ  441

Query  433  TFSTYADNQPGVLIQVFE  450
            TFSTY +NQPGV IQVFE
Sbjct  442  TFSTYQENQPGVCIQVFE  459

>PITG_11252
Length=654

 Score = 782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/443 (89%), Positives = 420/443 (95%), Gaps = 0/443 (0%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  67
            TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            AHNTVFD KRLIGRKF+DP VQSDIKHWPF +  GA  KPQ+ VQFKGE KTFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFTDPEVQSDIKHWPFNVIRGAESKPQVVVQFKGEKKTFQPEEISS  125

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVLIKMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAI
Sbjct  126  MVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV+ FV
Sbjct  186  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEFFV  245

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
            +EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRARF
Sbjct  246  TEFKRKHRKDMTSNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNSTITRARF  305

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            ED+C +YFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIPKVQQLL DFFNGKE  KS
Sbjct  306  EDLCSEYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPKVQQLLKDFFNGKELFKS  365

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            INPDEAVA+GATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAGGVMT LI RNTTVP
Sbjct  366  INPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVP  425

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
            +KK+Q+FSTYADNQ GVLIQVFE
Sbjct  426  SKKTQSFSTYADNQSGVLIQVFE  448

>PPTG_19690
Length=566

 Score = 781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/447 (89%), Positives = 419/447 (94%), Gaps = 0/447 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T   TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  2    TEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNAHNTVFD KRLIGRKF+DP VQSDIKHWPFK+  GA +KPQ+ VQFKGESKTFQPE
Sbjct  62   VAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVLIKMREVAEAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAG+NVLRIINEPT
Sbjct  122  EISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  182  AAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLV  241

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            ++FV EFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAY+EIDSL DGIDFNSTIT
Sbjct  242  EYFVQEFKRKYRKDMTVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLLDGIDFNSTIT  301

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFED+C DYFRKTMEPV +VLRD+KLSK+QV E+VLVGGSTRIPKVQQLL  FFNGK+
Sbjct  302  RARFEDLCSDYFRKTMEPVAQVLRDSKLSKNQVDEIVLVGGSTRIPKVQQLLMGFFNGKD  361

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
              KSINPDEAVA+GATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAGGVMT LI RN
Sbjct  362  LFKSINPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRN  421

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            TTVP KK+QTFSTY DNQPGVLIQVFE
Sbjct  422  TTVPAKKTQTFSTYTDNQPGVLIQVFE  448

>H310_09557
Length=644

 Score = 780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/443 (89%), Positives = 422/443 (95%), Gaps = 0/443 (0%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  67
            T  SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  4    TEQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  63

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
              NTVFDAKRLIGRKF+DP++Q+DIKHWPFK+ +G GDKPQI V+FKGESKTFQPEEISS
Sbjct  64   PSNTVFDAKRLIGRKFNDPMIQADIKHWPFKVVAGPGDKPQIVVEFKGESKTFQPEEISS  123

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVLIKM++VAEAFIG EV+NAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAI
Sbjct  124  MVLIKMKQVAEAFIGVEVQNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  183

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAG+THLGGEDFDNRLVDHF 
Sbjct  184  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGNTHLGGEDFDNRLVDHFT  243

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
             EFKRK++ D+  NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDG+D+N+TITRARF
Sbjct  244  DEFKRKYKGDLKTNQRALRRLRTACERAKRTLSSSTQAYLEIDSLFDGMDYNTTITRARF  303

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            ED+C DYFRKTMEPV+ VL+DAKLSK+QVHEVVLVGGSTRIPKVQQLLSDFF+GKE  KS
Sbjct  304  EDLCSDYFRKTMEPVKSVLQDAKLSKNQVHEVVLVGGSTRIPKVQQLLSDFFHGKELYKS  363

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            INPDEAVAFGATVQAAILSG+  S+KLQDLLLLDVTPLSLGLETAGGVMTTLI+RNTTVP
Sbjct  364  INPDEAVAFGATVQAAILSGSSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLISRNTTVP  423

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
            TKKSQTFSTYADNQPGVLIQV+E
Sbjct  424  TKKSQTFSTYADNQPGVLIQVYE  446

>PYVX_15641
Length=629

 Score = 779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/450 (91%), Positives = 414/450 (92%), Gaps = 26/450 (6%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ  +  G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA
Sbjct  1    MAQAVS--GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPF L+SG GDKPQI VQFKGESKTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFTLTSGPGDKPQIQVQFKGESKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  239  RLVDHFTQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFED+                        QVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  299  TITRARFEDI------------------------QVHEVVLVGGSTRIPKVQQLLSDFFN  334

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  335  GKEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  394

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             RNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  395  PRNTTVPTKKSQTFSTYADNQPGVLIQVFE  424

>PHYCA_532912
Length=626

 Score = 779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/450 (90%), Positives = 414/450 (92%), Gaps = 31/450 (7%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            M Q TTS GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA
Sbjct  1    MTQATTS-GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  59

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDP+VQ+DIKHWPF+++SGAGDKPQITVQFKGESKTF
Sbjct  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMRE                              DAGAIAG+NVLRIIN
Sbjct  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  269

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  270  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  329

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  330  GKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  389

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  390  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  419

>CCI40249
Length=660

 Score = 777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/443 (89%), Positives = 416/443 (94%), Gaps = 0/443 (0%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  67
            T  ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  2    TDKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  61

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            A NTVFDAKRLIGR FSDPIVQ+D+KHWPF + +G G+KP I V FKGE K FQPEEISS
Sbjct  62   AANTVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVTFKGEKKIFQPEEISS  121

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL+KMREV+EA+IGK+VKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAI
Sbjct  122  MVLVKMREVSEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  181

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGL+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHFV
Sbjct  182  AYGLEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFV  241

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
            +EFKRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARF
Sbjct  242  AEFKRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARF  301

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            ED+C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN KEPCKS
Sbjct  302  EDLCSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKS  361

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            INPDEAVAFGATVQAAILSGND SEKLQDLLLLDV PLSLGLETAGGVMT LI RNTT+P
Sbjct  362  INPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIP  421

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
            TKKSQ FST+ DNQ  V IQVFE
Sbjct  422  TKKSQLFSTFQDNQCSVCIQVFE  444

>PHYSO_482793
Length=658

 Score = 776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/447 (87%), Positives = 422/447 (94%), Gaps = 0/447 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T   TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  2    TEPVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNAHNTVFD KRLIGRKF+DP VQSDIKHWPFK++ G  +KPQ+ VQFKGESKTFQPE
Sbjct  62   VAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVARGPENKPQLVVQFKGESKTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVLIKMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAGAIAG+NVLRIINEPT
Sbjct  122  EISSMVLIKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  182  AAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLV  241

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            ++FV EFKRKHR+D++ N RA+RRLRTACERAKRTLS+SAQAYIEIDSL DG DFNSTIT
Sbjct  242  EYFVQEFKRKHRRDLSVNSRAMRRLRTACERAKRTLSTSAQAYIEIDSLLDGTDFNSTIT  301

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFED+C ++FRKTM+PV +VLRD+KLSK+QV+EVVLVGGSTRIPKVQQLL DFFNGKE
Sbjct  302  RARFEDLCNEFFRKTMDPVAQVLRDSKLSKNQVNEVVLVGGSTRIPKVQQLLVDFFNGKE  361

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
              KSINPDEAVA+GATVQAAILSGNDSS KLQDLLLLDV PLSLGLETAGGVMT LI RN
Sbjct  362  LFKSINPDEAVAYGATVQAAILSGNDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRN  421

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            TT+P+KK+Q+FSTYADNQPGVLIQVFE
Sbjct  422  TTIPSKKTQSFSTYADNQPGVLIQVFE  448

>H257_12958
Length=649

 Score = 776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/440 (89%), Positives = 418/440 (95%), Gaps = 0/440 (0%)

Query  11   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  70
            SVGIDLGTTYSCVG WQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  N
Sbjct  8    SVGIDLGTTYSCVGTWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  67

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            TVFDAKRLIGRKF+DP++Q+DIKHWPFK+ +GAGDKPQI V+FKGE KTFQPEEISSMVL
Sbjct  68   TVFDAKRLIGRKFNDPMIQADIKHWPFKVIAGAGDKPQIVVEFKGERKTFQPEEISSMVL  127

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            IKM+EVAEA++G +V+NAVITVPAYFNDSQRQATKDAGAIAG+ V+RIINEPTAAAIAYG
Sbjct  128  IKMKEVAEAYLGLDVQNAVITVPAYFNDSQRQATKDAGAIAGLTVMRIINEPTAAAIAYG  187

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            LDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFV EF
Sbjct  188  LDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVDEF  247

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  310
            KRK+RKD+  NQRALRRLRTA ERAKRTLSSS QA++EIDSLFDGID+N+TITRARFED+
Sbjct  248  KRKYRKDMKTNQRALRRLRTASERAKRTLSSSTQAHLEIDSLFDGIDYNTTITRARFEDL  307

Query  311  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINP  370
            C DYFRKTM PVE VLRDAKLSK+QV+EVVLVGGSTRIPKVQQLLSDFFNGKE  KSINP
Sbjct  308  CSDYFRKTMGPVETVLRDAKLSKNQVNEVVLVGGSTRIPKVQQLLSDFFNGKELYKSINP  367

Query  371  DEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  430
            DEAVAFGATVQAAILSG   S+KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK
Sbjct  368  DEAVAFGATVQAAILSGTSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK  427

Query  431  SQTFSTYADNQPGVLIQVFE  450
            SQTFSTYADNQPGVLIQVFE
Sbjct  428  SQTFSTYADNQPGVLIQVFE  447

>CCA16153
Length=663

 Score = 774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/443 (89%), Positives = 415/443 (94%), Gaps = 0/443 (0%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  67
            T  ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  2    TDKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  61

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            A NTVFDAKRLIGR FSDPIVQ+D+KHWPF + +G G+KP I V FKGE K FQPEEISS
Sbjct  62   AANTVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVIFKGEKKIFQPEEISS  121

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL+KMREV+EA+IGK VKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAI
Sbjct  122  MVLVKMREVSEAYIGKTVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  181

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGL+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHFV
Sbjct  182  AYGLEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFV  241

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
            +EFKRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARF
Sbjct  242  AEFKRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARF  301

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            ED+C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN KEPCKS
Sbjct  302  EDLCSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKS  361

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            INPDEAVAFGATVQAAILSGND SEKLQDLLLLDV PLSLGLETAGGVMT LI RNTT+P
Sbjct  362  INPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIP  421

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
            TKKSQ FST+ DNQ  V IQVFE
Sbjct  422  TKKSQLFSTFQDNQCSVCIQVFE  444

>PHYKE_7016
Length=650

 Score = 773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/448 (88%), Positives = 421/448 (94%), Gaps = 1/448 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            ++  TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  3    SSVVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  62

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNAHNTVFDAKRLIGRKFSD  VQSDIKHWPFK+  G  +KPQ+ VQFKGESKTFQPE
Sbjct  63   VAMNAHNTVFDAKRLIGRKFSDLEVQSDIKHWPFKVVRGPDNKPQVVVQFKGESKTFQPE  122

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVLIKMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAGAIAG+NVLRIINEPT
Sbjct  123  EISSMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  182

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKK GE NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  183  AAAIAYGLDKKRGEHNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            ++FV++FKRKHRKD++ + RA+RRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTIT
Sbjct  243  EYFVTDFKRKHRKDMSTSSRAMRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNSTIT  302

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFE +C D+FRKTMEPV +VL DAKLSK  V EVVLVGGSTRIPKVQQLL+DFF+GKE
Sbjct  303  RARFESLCDDFFRKTMEPVAQVLHDAKLSKGHVQEVVLVGGSTRIPKVQQLLTDFFHGKE  362

Query  364  PCKSINPDEAVAFGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIAR  422
              KSINPDEAVAFGATVQAAILSG  D+S KLQDLLLLDV PLSLGLETAGGVMTTLIAR
Sbjct  363  LFKSINPDEAVAFGATVQAAILSGAGDTSSKLQDLLLLDVAPLSLGLETAGGVMTTLIAR  422

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            NTTVP+KKSQTFSTY+DNQPGVLIQVFE
Sbjct  423  NTTVPSKKSQTFSTYSDNQPGVLIQVFE  450

>PHALS_09802
Length=651

 Score = 768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/443 (87%), Positives = 418/443 (94%), Gaps = 0/443 (0%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  67
            TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            AHNTVFD KRLIGRKF+D  VQSDIKHWPFK+  G  +KPQ+ VQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFADSEVQSDIKHWPFKVVCGPENKPQVVVQFKGESKTFQPEEISS  125

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVLIKMRE+AEAFIGK+V+NAV+TVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAI
Sbjct  126  MVLIKMREIAEAFIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGLDKKGGE +VLIFDLGGGTFDVSLL+IEEGIFEV ATAGDTHLGGEDFDNRLV++FV
Sbjct  186  AYGLDKKGGEHHVLIFDLGGGTFDVSLLTIEEGIFEVMATAGDTHLGGEDFDNRLVEYFV  245

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
            +EFKRKHRKD++ NQRALRRLRTACERAKRTLS+SAQAY+EIDSLFDGIDFNSTITRARF
Sbjct  246  AEFKRKHRKDLSVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLFDGIDFNSTITRARF  305

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            ED+C +YFRKTM+PV +VLRD+KLSKSQV+E+VLVGGSTRIPKVQQ+L DFFNGK+  KS
Sbjct  306  EDLCAEYFRKTMDPVAQVLRDSKLSKSQVNEIVLVGGSTRIPKVQQMLMDFFNGKDLFKS  365

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            INPDEAVA+GATVQAAILSG++SS KLQDLLLLDV PLSLGLETAGGVMT LI RNTTVP
Sbjct  366  INPDEAVAYGATVQAAILSGSESSAKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVP  425

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
             KK Q+FSTY DNQ GVLIQVFE
Sbjct  426  AKKMQSFSTYTDNQSGVLIQVFE  448

>PHYRA_71655
Length=653

 Score = 764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/447 (86%), Positives = 418/447 (94%), Gaps = 0/447 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T + TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  2    TESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNAHNTVFD KRLIGRKF+DP VQSDI+HWPFK++ G  +KP++ VQFKGE  TFQPE
Sbjct  62   VAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVL+KMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRIINEPT
Sbjct  122  EISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV
Sbjct  182  AAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLV  241

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            + FV EFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNSTIT
Sbjct  242  EFFVQEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNSTIT  301

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPKVQQLL DFFNGK+
Sbjct  302  RARFEDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPKVQQLLIDFFNGKK  361

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
              KSINPDEA+A+GATVQAAILSG+DSS KLQDLLLLDV PLSLGLETAGGVMT LI RN
Sbjct  362  LFKSINPDEAIAYGATVQAAILSGHDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRN  421

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            TTVP KK+Q+FSTYADNQ GVLIQVFE
Sbjct  422  TTVPAKKAQSFSTYADNQSGVLIQVFE  448

>PHYCA_104444
Length=644

 Score = 757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/448 (86%), Positives = 414/448 (92%), Gaps = 1/448 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T   TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  2    TEAVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNAHNTVFD KRLIGRKF+DP VQSDIKHWPFKL  G   KP + VQFKGE +TFQPE
Sbjct  62   VAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKLVRGPESKPLVEVQFKGEKRTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVL+KMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRIINEPT
Sbjct  122  EISSMVLVKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV
Sbjct  182  AAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLV  241

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            + FV EFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDGIDFNSTIT
Sbjct  242  EFFVLEFKRKYRKDMTGNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGIDFNSTIT  301

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFED+C +YFRKTM PV +VL+D+KLSK+ V+EVVLVGGSTRIPKVQQLL +FFNGKE
Sbjct  302  RARFEDLCSEYFRKTMGPVAQVLQDSKLSKNHVNEVVLVGGSTRIPKVQQLLMEFFNGKE  361

Query  364  PCKSINPDEAVAFGATVQAAILSGN-dsseklqdlllldvtplslglETAGGVMTTLIAR  422
              KSINPDEAVA+GATVQAAILSG+ + S KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  362  LFKSINPDEAVAYGATVQAAILSGSGNMSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  421

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            NTTVP KK+Q+FSTY+DNQ GVLIQVFE
Sbjct  422  NTTVPAKKTQSFSTYSDNQSGVLIQVFE  449

>PYAR_19807
Length=1613

 Score = 756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/450 (86%), Positives = 415/450 (92%), Gaps = 12/450 (3%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            M+  +  TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA
Sbjct  1    MSDASVVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  60

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKF+D +VQ+DIKHWPF++ + + +KPQI VQFKGE+K F
Sbjct  61   KNQVAMNAHNTVFDAKRLIGRKFTDAVVQADIKHWPFRVMADSANKPQIVVQFKGETKKF  120

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
              EEISSMVL KMR+VAEAFIGK+VKNA            RQATKDAGAIAG+NVLRIIN
Sbjct  121  YAEEISSMVLTKMRDVAEAFIGKQVKNA------------RQATKDAGAIAGLNVLRIIN  168

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDN
Sbjct  169  EPTAAAIAYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN  228

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLV++FV EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++G+DFNS
Sbjct  229  RLVEYFVGEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGVDFNS  288

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFED+C D+FRKTMEPVE+VLRDAKLSK+QV EVVLVGGSTRIPK+QQLLSDFFN
Sbjct  289  TITRARFEDLCADFFRKTMEPVERVLRDAKLSKNQVQEVVLVGGSTRIPKIQQLLSDFFN  348

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKE  KSINPDEAVAFGATVQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  349  GKELYKSINPDEAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLI  408

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  409  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  438

>CCI40247
Length=643

 Score = 746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/444 (81%), Positives = 397/444 (89%), Gaps = 1/444 (0%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  67
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AAKNQVAMN
Sbjct  7    SGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAKNQVAMN  66

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            A NTVFDAKRLIGRKF D  VQ D KHWPF++  G  DKPQI V+ KG  K F  EEIS+
Sbjct  67   AENTVFDAKRLIGRKFHDQAVQQDTKHWPFRVVCGPEDKPQIVVEVKGAKKMFYAEEISA  126

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KMRE+AEA++G++VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+NEPTAAAI
Sbjct  127  MVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNEPTAAAI  186

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDNRLV+HF+
Sbjct  187  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDNRLVEHFL  246

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
            +EFKRK+RKD+++NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNSTITRARF
Sbjct  247  AEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNSTITRARF  306

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            ED+C DYFRKTMEPVEKVLRDAKL+K+Q+HE+VLVGGSTRIPKVQQ+LSDFFNGKE  KS
Sbjct  307  EDLCSDYFRKTMEPVEKVLRDAKLAKNQLHEIVLVGGSTRIPKVQQMLSDFFNGKELYKS  366

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslg-lETAGGVMTTLIARNTTV  426
            INPDEAVA+GATVQAAILSG     +    ++L         LETAGGVMT LIARNTTV
Sbjct  367  INPDEAVAYGATVQAAILSGGSDQSERLQNVVLLDVAPLSMGLETAGGVMTVLIARNTTV  426

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PT+KSQTFSTYADNQ GVLIQV+E
Sbjct  427  PTRKSQTFSTYADNQSGVLIQVYE  450

>PHALS_01338
Length=383

 Score = 743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/377 (93%), Positives = 371/377 (98%), Gaps = 0/377 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T  ++GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQ
Sbjct  2    TQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMN+ NTVFDAKRLIGRK+SDP+V++DIKHWPFK+++G GDKPQITVQFKGE+KTFQPE
Sbjct  62   VAMNSSNTVFDAKRLIGRKYSDPVVKADIKHWPFKVTAGPGDKPQITVQFKGETKTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVLIKMREVAEA+IGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPT
Sbjct  122  EISSMVLIKMREVAEAYIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            DHFV EFKRKHRKD+++NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT
Sbjct  242  DHFVQEFKRKHRKDLSQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE
Sbjct  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361

Query  364  PCKSINPDEAVAFGATV  380
            P KSINPDEAVA+GAT+
Sbjct  362  PNKSINPDEAVAYGATI  378

>CCA16151
Length=643

 Score = 742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/451 (82%), Positives = 414/451 (92%), Gaps = 2/451 (0%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            M +TT S G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AA
Sbjct  1    MVETTVS-GLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAA  59

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNA NTVFDAKRLIGRKF D  VQ D KHWPF +  G  DKPQI V+  G  K F
Sbjct  60   KNQVAMNAENTVFDAKRLIGRKFHDQTVQQDTKHWPFSVVCGPEDKPQIVVEVNGAKKMF  119

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
              EEIS+MVL KMRE+AEA++G++VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+N
Sbjct  120  YAEEISAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILN  179

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDN
Sbjct  180  EPTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDN  239

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            RLV+HF++EFKRK+RKD+++NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNS
Sbjct  240  RLVEHFLTEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNS  299

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFED+C DYFRKTM+PVE+VLRDAKLSK+Q++E+VLVGGSTRIPKVQQLLSDFFN
Sbjct  300  TITRARFEDLCSDYFRKTMDPVERVLRDAKLSKNQLNEIVLVGGSTRIPKVQQLLSDFFN  359

Query  361  GKEPCKSINPDEAVAFGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTL  419
            GKE  KSINPDEAVA+GATVQAAILSG +D SE+LQ+++LLDV PLS+GLETAGGVMT L
Sbjct  360  GKELYKSINPDEAVAYGATVQAAILSGASDQSERLQNVVLLDVAPLSMGLETAGGVMTVL  419

Query  420  IARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            I RNTTVPT+KSQTFSTYADNQPGVLIQV+E
Sbjct  420  IPRNTTVPTRKSQTFSTYADNQPGVLIQVYE  450

>H257_17322
Length=606

 Score = 727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/441 (86%), Positives = 396/441 (90%), Gaps = 28/441 (6%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  68
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  69   HNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSM  128
             NTVFDAKRLIGRKF+D ++Q+DIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDSVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            VLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  189  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF +
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  249  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  308
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  309  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  368
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPK             P    
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPK-------------PW---  349

Query  369  NPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
                        QAAILSGNDSSEKLQDLLLLDVTPL L LETAGGVM TLI RNTTVPT
Sbjct  350  ------------QAAILSGNDSSEKLQDLLLLDVTPLLLTLETAGGVMATLIQRNTTVPT  397

Query  429  KKSQTFSTYADNQPGVLIQVF  449
            KKSQTFST A+NQ GVLIQVF
Sbjct  398  KKSQTFSTCANNQSGVLIQVF  418

>PYIR_15859
Length=626

 Score = 719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/448 (83%), Positives = 397/448 (89%), Gaps = 27/448 (6%)

Query  3    QTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  62
            Q    TG +VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  5    QPAQVTGQTVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  64

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
            QVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFK+S GAGDKPQITV+FKGE+KTFQP
Sbjct  65   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQP  124

Query  123  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEP  182
            EEISSMVLIKM+E++EA+IGK+VKNAVITVPAYFNDSQRQATKDAG IAG+N        
Sbjct  125  EEISSMVLIKMKEISEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVIAGLN--------  176

Query  183  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
                        GGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  177  ------------GGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  224

Query  243  VDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  302
            V+ F +EFKRK +KD+T+NQR+LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  225  VEFFTAEFKRKFKKDMTQNQRSLRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  284

Query  303  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  362
            TRARFED+C DYFRKTMEPVE+VLRDAKLSK QV+E+VLVGGSTRIPKVQQ+LSDFFNGK
Sbjct  285  TRARFEDLCADYFRKTMEPVERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSDFFNGK  344

Query  363  EPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  422
            +  KSINPDEAVAFGATVQAAILSG D S +LQDLLLLDV PLSLGLETAGGVMTTLI  
Sbjct  345  DLYKSINPDEAVAFGATVQAAILSGADKSSRLQDLLLLDVAPLSLGLETAGGVMTTLIP-  403

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
                      TFSTYADNQPGVLIQVFE
Sbjct  404  ------XXXXTFSTYADNQPGVLIQVFE  425

>PYVX_22981
Length=612

 Score = 694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/449 (80%), Positives = 385/449 (86%), Gaps = 44/449 (10%)

Query  2    AQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  61
            A ++  TG SVGIDLGTTYSCVGVWQN+RVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  7    ATSSGVTGQSVGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  66

Query  62   NQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQ  121
            NQVAMNA NTVFDAKRLIGRKF+DP+VQ DI+HWPFK+S+G+  KPQITVQF+GE KTFQ
Sbjct  67   NQVAMNAANTVFDAKRLIGRKFNDPVVQQDIRHWPFKVSAGSDSKPQITVQFQGERKTFQ  126

Query  122  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINE  181
            PEEISSMVL+KMR+VAEAFIGK VKNAVITVPAYFNDSQRQATKDAG IAG+N       
Sbjct  127  PEEISSMVLMKMRDVAEAFIGKPVKNAVITVPAYFNDSQRQATKDAGVIAGLN-------  179

Query  182  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
                                                 EGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  -------------------------------------EGIFEVKATAGDTHLGGEDFDNR  202

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            LV+HF +EFKRK+RKD++E+QRALRRLRTACERAKRTLSSSAQAY+EIDSL+DG+DFN+T
Sbjct  203  LVEHFAAEFKRKYRKDLSESQRALRRLRTACERAKRTLSSSAQAYVEIDSLYDGVDFNTT  262

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            ITRARFE+MCGDYFRKTMEPVE VLRDAKL K QVHEVVLVGGSTRIPKVQQLLS FFNG
Sbjct  263  ITRARFEEMCGDYFRKTMEPVETVLRDAKLGKGQVHEVVLVGGSTRIPKVQQLLSQFFNG  322

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KEPCKSINPDEAVAFGATVQAAILSG+DSS KLQDLLLLDV PLSLGLETAGGVMTTLI 
Sbjct  323  KEPCKSINPDEAVAFGATVQAAILSGHDSSAKLQDLLLLDVAPLSLGLETAGGVMTTLIP  382

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNTTVP KKSQTFSTYADNQPGVLIQVFE
Sbjct  383  RNTTVPAKKSQTFSTYADNQPGVLIQVFE  411

>PHYRA_41888
Length=586

 Score = 645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/351 (87%), Positives = 330/351 (94%), Gaps = 0/351 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T + TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  2    TESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNAHNTVFD KRLIGRKF+DP VQSDI+HWPFK++ G  +KP++ VQFKGE  TFQPE
Sbjct  62   VAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVL+KMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRIINEPT
Sbjct  122  EISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV
Sbjct  182  AAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLV  241

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            + FV EFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNSTIT
Sbjct  242  EFFVQEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNSTIT  301

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  354
            RARFED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPKVQQ 
Sbjct  302  RARFEDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPKVQQF  352

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)

Query  426  VPTKKSQTFSTYADNQPGVLIQVFE  450
            VP KK+Q+FSTYADNQ GVLIQVFE
Sbjct  364  VPAKKAQSFSTYADNQSGVLIQVFE  388

>HYAP_01540
Length=634

 Score = 629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/456 (77%), Positives = 363/456 (80%), Gaps = 52/456 (11%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQT +   YSVGID+GT YS VGVWQND VEIIA DQGNRT+                 
Sbjct  1    MAQTMSD--YSVGIDVGTMYSRVGVWQNDSVEIIAKDQGNRTSAV---------------  43

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
               VAMNAHNTVFD KRLIGRKFSD +VQ+D+KHWPFKL+SGAGDKPQITVQFKGESKTF
Sbjct  44   ---VAMNAHNTVFDGKRLIGRKFSDAVVQADVKHWPFKLTSGAGDKPQITVQFKGESKTF  100

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAI------AGMN  174
            Q EEISSMVLIKMREVAEAF+GKEVK AVITVPAYFNDSQRQ  +  G +        + 
Sbjct  101  QSEEISSMVLIKMREVAEAFMGKEVKKAVITVPAYFNDSQRQRRRMQGPLLDSTCSVSLT  160

Query  175  VLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLG  234
              R+   PT              R          T+               ATAGDTHLG
Sbjct  161  SRRLRPSPTVWT-----------RRAASAMCSSSTW---------------ATAGDTHLG  194

Query  235  GEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  294
            GEDFDNRLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD
Sbjct  195  GEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  254

Query  295  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  354
            GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL
Sbjct  255  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  314

Query  355  LSDFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGG  414
            LSDFFNGKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGG
Sbjct  315  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGG  374

Query  415  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  375  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  410

>PYIR_15857
Length=577

 Score = 610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/450 (75%), Positives = 351/450 (78%), Gaps = 77/450 (17%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ     G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQAVA--GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFK+S GAGDKPQITV+FKGE+KTF
Sbjct  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTF  118

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVLIKMREV+EAFIGKE    +  V A   D+                     
Sbjct  119  QPEEISSMVLIKMREVSEAFIGKE---GIFEVKATAGDTH--------------------  155

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
                                    LGG  FD  L+                H  GE    
Sbjct  156  ------------------------LGGEDFDNRLVD---------------HFVGE----  172

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
                     FKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNS
Sbjct  173  ---------FKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNS  223

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            TITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  224  TITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  283

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEPCK+INPDEAVAFGATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  284  GKEPCKAINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  343

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  344  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  373

>H310_02604
Length=312

 Score = 570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/296 (91%), Positives = 288/296 (97%), Gaps = 0/296 (0%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  68
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  69   HNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSM  128
             NTVFDAKRLIGRKF+DP++Q+DIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            VLIKM+EV+EA+IG  V NAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  189  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGG+DFDNRLVDHF +
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGKDFDNRLVDHFTA  245

Query  249  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  304
            EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT+
Sbjct  246  EFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITQ  301

>H257_18885
Length=786

 Score = 567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/448 (65%), Positives = 362/448 (81%), Gaps = 7/448 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  247

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+++G  DKP I V FKGE+K+F PEEIS
Sbjct  248  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITAGDDDKPLIEVTFKGEAKSFTPEEIS  307

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  187  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  368  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  427

Query  244  DHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  302
            D+ ++EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  428  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  487

Query  303  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  362
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  488  TRAKFESLNDECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQNMLSGLFGGK  547

Query  363  EPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  422
            E  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI R
Sbjct  548  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKR  606

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            NT +P KK++ ++T AD Q  V + ++E
Sbjct  607  NTAIPVKKTRVYTTEADYQTQVNVVIYE  634

>PHYSO_286376
Length=660

 Score = 566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/444 (64%), Positives = 357/444 (80%), Gaps = 4/444 (1%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
               T+FD KRLIGRK++D  VQ+D K  P++L +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVEVKGEKRQFAPEEVSA  147

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  188  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKSQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
            + ++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP +
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
             +NPDEAVA+GA VQ  ILSG    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILSGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTY DNQP VLIQVFE
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFE  470

>PYIW_21755
Length=658

 Score = 565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/450 (64%), Positives = 355/450 (79%), Gaps = 4/450 (1%)

Query  3    QTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK  61
            +T    G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   ETKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  62   NQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQ  121
            NQ  +N   T+FD KRLIGR ++D  VQ+D K  P+ + +  G KP I V  KGE KTF 
Sbjct  83   NQATINPEQTLFDVKRLIGRGYNDKSVQADKKLLPYNIINKDG-KPLIEVSVKGEKKTFS  141

Query  122  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINE  181
            PEE+S+M+L KM++VAE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGM V RIINE
Sbjct  142  PEEVSAMILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINE  201

Query  182  PTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            PTAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD 
Sbjct  202  PTAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQ  261

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            R++  F+ ++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  
Sbjct  262  RIMQFFIKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTE  321

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            +++RARFE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ D+FN
Sbjct  322  SLSRARFEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFN  381

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP + +NPDEAVA+GA VQ  IL G    E  +D+LL+DV PLS G+ET GGVMT LI
Sbjct  382  GKEPSRGVNPDEAVAYGAAVQGGILGGE-QDELTKDVLLIDVVPLSQGIETVGGVMTKLI  440

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             RNT +PTKKSQTFSTY DNQP VLIQVFE
Sbjct  441  NRNTVIPTKKSQTFSTYQDNQPAVLIQVFE  470

>H310_14759
Length=787

 Score = 565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/448 (65%), Positives = 358/448 (80%), Gaps = 7/448 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  248

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+S G GDKP I V F+GE K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKISKGEGDKPLIQVTFRGEDKSFTPEEIS  308

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AE F+G+E+K AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENFLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  187  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDSNMV  428

Query  244  DHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  302
            D  V+EFKRK+R  D T + R++RRLRTACE AKR LS++  A IE+D+LF+G+DF+ST+
Sbjct  429  DFLVTEFKRKNRNLDPTSSARSMRRLRTACESAKRMLSTTTSATIEVDALFEGVDFSSTM  488

Query  303  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  362
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS+ F GK
Sbjct  489  TRAKFESLNEECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQTMLSNLFGGK  548

Query  363  EPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  422
            E  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            NT +P KK++ ++T  D Q    + ++E
Sbjct  608  NTAIPVKKTRIYTTEEDFQTSEKVVIYE  635

>HYAP_01005
Length=660

 Score = 564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/449 (63%), Positives = 357/449 (80%), Gaps = 4/449 (1%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  62
            T    G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  24   TKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  83

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
            Q  +N   T+FD KRLIGRK++D  VQSD K  P++L +  G KP I VQ KGE++ F P
Sbjct  84   QATINPEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAP  142

Query  123  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEP  182
            EE+S+MVL KM+ +AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEP
Sbjct  143  EEVSAMVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEP  202

Query  183  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  203  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  262

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            ++ +F+ ++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +
Sbjct  263  IMQYFIKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTES  322

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            ++RARFE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNG
Sbjct  323  LSRARFEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNG  382

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KEP + +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI 
Sbjct  383  KEPSRGVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLIN  441

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +PTKKSQTFSTY DNQP VLIQVFE
Sbjct  442  RNTVIPTKKSQTFSTYQDNQPAVLIQVFE  470

>HYAP_01004
Length=660

 Score = 564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/449 (63%), Positives = 357/449 (80%), Gaps = 4/449 (1%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  62
            T    G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  24   TKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  83

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
            Q  +N   T+FD KRLIGRK++D  VQSD K  P++L +  G KP I VQ KGE++ F P
Sbjct  84   QATINPEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAP  142

Query  123  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEP  182
            EE+S+MVL KM+ +AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEP
Sbjct  143  EEVSAMVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEP  202

Query  183  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  203  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  262

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            ++ +F+ ++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +
Sbjct  263  IMQYFIKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTES  322

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            ++RARFE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNG
Sbjct  323  LSRARFEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNG  382

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KEP + +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI 
Sbjct  383  KEPSRGVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLIN  441

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +PTKKSQTFSTY DNQP VLIQVFE
Sbjct  442  RNTVIPTKKSQTFSTYQDNQPAVLIQVFE  470

>PYAR_18354
Length=1084

 Score = 563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/444 (65%), Positives = 352/444 (79%), Gaps = 4/444 (1%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  30   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  89

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
               T+FD KRLIGR ++D  VQ+D K  PF + +  G KP I V  KGE K F PEEIS+
Sbjct  90   PEKTLFDVKRLIGRPYNDKSVQADKKLLPFDIVNKDG-KPFIQVTIKGEKKQFSPEEISA  148

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KM+ +AEA+IG+EV +AV+TVPAYFND+QRQATKDAG IAGM V RIINEPTAAAI
Sbjct  149  MVLSKMKTIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  208

Query  188  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            AYG+DKK  GE+NVL+FDLGGGTFDV+LLSI+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  209  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLSIDAGVFEVLATNGDTHLGGEDFDQRVMQYF  268

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
            + ++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++RAR
Sbjct  269  IKKWKKDKNIDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALSRAR  328

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP +
Sbjct  329  FEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  388

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
             +NPDEAVAFGA VQ  IL G    +  +D+LL+DV PLSLG+ET GGVMT LI RNT +
Sbjct  389  GVNPDEAVAFGAAVQGGILGGE-QDDTNKDILLIDVAPLSLGIETVGGVMTKLINRNTVI  447

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTY DNQP VLIQVFE
Sbjct  448  PTKKSQTFSTYQDNQPAVLIQVFE  471

>PPTG_08245
Length=658

 Score = 563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/444 (64%), Positives = 355/444 (80%), Gaps = 4/444 (1%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
               T+FD KRLIGRK++D  VQ+D K  P+ L +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYNLVNKDG-KPFIEVEVKGEKRQFAPEEVSA  147

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  188  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
            + ++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP +
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
             +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTY DNQP VLIQVFE
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFE  470

>PYAP_13341
Length=657

 Score = 563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/444 (64%), Positives = 356/444 (80%), Gaps = 4/444 (1%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
               T+FD KRLIGR ++D  VQ+D K  P+++ +  G KP I V  KGE+K F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPFIQVTIKGENKLFAPEEVSA  147

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KM+++AEA+IG+EV +AV+TVPAYFND+QRQATKDAG I+GM V RIINEPTAAAI
Sbjct  148  MVLTKMKQIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTISGMTVQRIINEPTAAAI  207

Query  188  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
            + ++K+    DI +++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++RAR
Sbjct  268  IKKWKKDKSIDIGKDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALSRAR  327

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP +
Sbjct  328  FEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
             +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLSLG+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDVTKDILLIDVVPLSLGIETVGGVMTKLINRNTVI  446

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTY DNQP VLIQVFE
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFE  470

>PHYRA_71042
Length=654

 Score = 562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/444 (63%), Positives = 356/444 (80%), Gaps = 4/444 (1%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  25   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  84

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
               T+FD KRLIGRK++D  VQSD K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  85   PEKTLFDVKRLIGRKYNDKSVQSDKKLLPYEIINKDG-KPFIQVEVKGEKREFAPEEVSA  143

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  144  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  203

Query  188  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  204  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  263

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
            + ++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  264  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  323

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP +
Sbjct  324  FEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  383

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
             +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  384  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  442

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTY DNQP VLIQVFE
Sbjct  443  PTKKSQTFSTYQDNQPAVLIQVFE  466

>PHYCA_510696
Length=659

 Score = 562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/449 (63%), Positives = 357/449 (80%), Gaps = 4/449 (1%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  62
            T    G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  23   TKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  82

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
            Q  +N   T+FD KRLIGRK++D  VQ+D K  P+++ +  G KP I V+ KGE + F P
Sbjct  83   QATINPEKTLFDVKRLIGRKYNDKSVQADKKLLPYEIVNKEG-KPFIEVEVKGEKRQFAP  141

Query  123  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEP  182
            EE+S+MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEP
Sbjct  142  EEVSAMVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEP  201

Query  183  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  202  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  261

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            ++ +F+ ++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +
Sbjct  262  IMQYFIKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTES  321

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            ++RARFE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNG
Sbjct  322  LSRARFEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNG  381

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KEP + +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI 
Sbjct  382  KEPSRGVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLIN  440

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +PTKKSQTFSTY DNQP VLIQVFE
Sbjct  441  RNTVIPTKKSQTFSTYQDNQPAVLIQVFE  469

>PYVX_16738
Length=658

 Score = 562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/444 (64%), Positives = 353/444 (80%), Gaps = 4/444 (1%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
               T+FD KRLIGRK++D  VQ+D K  P+ ++   G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYADKSVQADKKLLPYHIADKQG-KPFIEVTVKGEKRQFAPEEVSA  146

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KM+++AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGM V RIINEPTAAAI
Sbjct  147  MVLTKMKQIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  206

Query  188  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
            + ++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKSVDIGSDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  326

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQ L+ D+FNGKEP +
Sbjct  327  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQTLIKDYFNGKEPSR  386

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
             +NPDEAVA+GA VQ  IL G    E  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGG-ADDELTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTY DNQP VLIQVFE
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFE  469

>PHYKE_7992
Length=657

 Score = 562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/450 (63%), Positives = 357/450 (79%), Gaps = 4/450 (1%)

Query  3    QTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK  61
            +T    G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  22   ETKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  81

Query  62   NQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQ  121
            NQ  +N   T+FD KRLIGRK++D  VQ+D K  P+ L +  G KP I V+ KGE + F 
Sbjct  82   NQATINPEKTLFDVKRLIGRKYTDKSVQADKKLLPYDLINKDG-KPFIQVEVKGEKRQFA  140

Query  122  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINE  181
            PEE+S+MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINE
Sbjct  141  PEEVSAMVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINE  200

Query  182  PTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            PTAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD 
Sbjct  201  PTAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQ  260

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            R++ +F+ ++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  
Sbjct  261  RIMQYFIKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTE  320

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            +++RARFE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FN
Sbjct  321  SLSRARFEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFN  380

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP + +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI
Sbjct  381  GKEPSRGVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLI  439

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             RNT +PTKKSQTFSTY DNQP VLIQVFE
Sbjct  440  NRNTVIPTKKSQTFSTYQDNQPAVLIQVFE  469

>H257_00007
Length=787

 Score = 561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/448 (64%), Positives = 359/448 (80%), Gaps = 7/448 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANAEGNRTTPSWVAFNETERLIGEAAKLQAAS  248

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK++ G GDKP I V F+GE+K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITKGEGDKPLIEVSFRGEAKSFTPEEIS  308

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  187  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  428

Query  244  DHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  302
            D+ ++EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  429  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  488

Query  303  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  362
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  489  TRAKFESLNDECFKRTEETVLKVLQDANMEPGQITELVLVGGSTRIPKVQNMLSGLFGGK  548

Query  363  EPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  422
            E  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            NT +P KK++ ++T  D Q    + ++E
Sbjct  608  NTAIPVKKTRIYTTEEDFQTTEKVVIYE  635

>PHALS_00833
Length=652

 Score = 560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/444 (64%), Positives = 355/444 (80%), Gaps = 4/444 (1%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVG++++ +VEII NDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIPNDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
               T+FD KRLIGRK++D  VQ+D K  P++L +  G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVVIKGEKRQFAPEEVSA  146

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  147  MVLSKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  188  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
            + ++K+    DI+ ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNIDISSDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP +
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
             +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTY DNQP VLIQVFE
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFE  469

>SDRG_05777
Length=786

 Score = 560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/449 (64%), Positives = 357/449 (80%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAAS  247

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  187  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            VD  V+EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  428  VDFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSST  487

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIPKVQ +LS  F G
Sbjct  488  MTRAKFESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGG  547

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIK  606

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P KK++ ++T +D Q  V + ++E
Sbjct  607  RNTAIPIKKTRVYTTESDYQTQVNVVIYE  635

>PYU1_G004098
Length=656

 Score = 558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/450 (63%), Positives = 356/450 (79%), Gaps = 4/450 (1%)

Query  3    QTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK  61
            +T    G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  22   ETKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  81

Query  62   NQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQ  121
            NQ  +N   T+FD KRLIGR ++D  VQ+D K  P+++ +  G KP I V  KGE K F 
Sbjct  82   NQATINPEKTLFDVKRLIGRGYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGEKKHFS  140

Query  122  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINE  181
            PEE+S+M+L KM++ AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG++V RIINE
Sbjct  141  PEEVSAMILTKMKQTAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINE  200

Query  182  PTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            PTAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD 
Sbjct  201  PTAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQ  260

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            R++  F+ ++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  
Sbjct  261  RVMQFFIKKWKKDKSVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTE  320

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            +++RARFE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ D+FN
Sbjct  321  SLSRARFEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFN  380

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKEP + +NPDEAVA+GA VQ  IL G  + +  +D+LL+DV PLS G+ET GGVMT LI
Sbjct  381  GKEPSRGVNPDEAVAYGAAVQGGILGGE-TDDLTKDVLLIDVVPLSQGIETVGGVMTKLI  439

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             RNT +PTKKSQTFSTY DNQP VLIQVFE
Sbjct  440  NRNTVIPTKKSQTFSTYQDNQPAVLIQVFE  469

>SPRG_10519
Length=782

 Score = 556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/449 (64%), Positives = 353/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  183  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  242

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G GDKP I V FKGE K F PEEIS
Sbjct  243  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGEGDKPLIQVTFKGEEKNFSPEEIS  302

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  303  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  362

Query  187  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  363  LAYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  422

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            VD+ ++EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  423  VDYLITEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSST  482

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++T E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  F G
Sbjct  483  MTRAKFESLNEECFKRTEETVLKVLADANMQPGDITELVLVGGSTRIPKVQNMLSAVFGG  542

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI 
Sbjct  543  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIK  601

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P KK++ ++T  D Q    + +FE
Sbjct  602  RNTAIPVKKTRIYTTEEDWQTTEKVVIFE  630

>HYAP_12660
Length=786

 Score = 555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/449 (63%), Positives = 354/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSD +V+ D KH+PFK+  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFKIKEGDDDKVLIEVEFKGEKKSFTPEEIS  306

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  366

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKVCNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V++ ++EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLAEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPENVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  634

>H310_09434
Length=658

 Score = 555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/452 (64%), Positives = 359/452 (79%), Gaps = 6/452 (1%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDA  59
            MAQ     G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD 
Sbjct  23   MAQE--PKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDG  80

Query  60   AKNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKT  119
            AKNQ  +N  NT+FD KRLIGR ++D  VQ+D K  PF + +  G +P I V+ KGE+K 
Sbjct  81   AKNQATINPENTLFDVKRLIGRSYNDKSVQADKKLLPFHIVNKDG-RPFIEVKIKGEAKQ  139

Query  120  FQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRII  179
            F PEE+S+M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAG+ V RII
Sbjct  140  FSPEEVSAMILTKMKTIAENYLGKEVHDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRII  199

Query  180  NEPTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  238
            NEPTAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDF
Sbjct  200  NEPTAAAIAYGIDKKAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDF  259

Query  239  DNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  298
            D R++  F+ +++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF
Sbjct  260  DQRIMQFFIKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDF  319

Query  299  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  358
            + T+TRARFE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ DF
Sbjct  320  DETLTRARFEELNNDLFKKTLTPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDF  379

Query  359  FNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  418
            FNGKEP + INPDEAVA+GA VQ  IL G  +   L ++LLLDV PLSLG+ET GGVMT 
Sbjct  380  FNGKEPSRGINPDEAVAYGAAVQGGILGGE-NDSNLNEILLLDVAPLSLGIETVGGVMTK  438

Query  419  LIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            +I RNT VPTKKSQTFSTY DNQP V IQVFE
Sbjct  439  IINRNTVVPTKKSQTFSTYQDNQPAVSIQVFE  470

>CCA20828
Length=787

 Score = 555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/449 (64%), Positives = 352/449 (78%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTDTERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDTERLIGEAAKIQAAS  247

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            N  NTVFDAKR+IGR F+D  VQ D +H+PFK+ SG GDKP I V++K E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEYKKETKQFTPEEIS  307

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            +MVL +M+E AEA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  308  AMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAA  367

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGEDFDN +
Sbjct  368  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGEDFDNNM  427

Query  243  VDHFVSEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            VD+ + EFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+GIDF+ T
Sbjct  428  VDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEGIDFSLT  487

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ LLS  FNG
Sbjct  488  VTRAKFESLNEELFKRCEETVLKVLADAAMKPGDISEIVLVGGSTRIPKVQNLLSGVFNG  547

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  606

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  607  RNTAIPVRKTRVYTTEEDYQTAVDVCIYE  635

>PITG_00527
Length=656

 Score = 554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/449 (63%), Positives = 358/449 (80%), Gaps = 4/449 (1%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  62
            T    G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  23   TKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  82

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
            Q  +N   T+FD KRLIGRK++D  VQ+D K  P++L +  G KP I V+ KGE + F P
Sbjct  83   QATINPEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIEVEVKGEKRQFAP  141

Query  123  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEP  182
            EE+S+MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEP
Sbjct  142  EEVSAMVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEP  201

Query  183  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  202  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  261

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            ++ +F+ ++K+  + D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +
Sbjct  262  IMQYFIKKWKKDKKIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTES  321

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            ++RARFE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNG
Sbjct  322  LSRARFEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNG  381

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KEP + +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI 
Sbjct  382  KEPSRGVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLIN  440

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +PTKKSQTFSTY DNQP VLIQVFE
Sbjct  441  RNTVIPTKKSQTFSTYQDNQPAVLIQVFE  469

>CCI46091
Length=787

 Score = 553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/449 (64%), Positives = 352/449 (78%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTD+ERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDSERLIGEAAKIQAAS  247

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            N  NTVFDAKR+IGR F+D  VQ D +H+PFK+ SG GDKP I V+FK E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEFKKETKQFTPEEIS  307

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            +MVL +M+E AEA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  308  AMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAA  367

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGEDFDN +
Sbjct  368  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGEDFDNNM  427

Query  243  VDHFVSEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            VD+ + EFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+GIDF+ T
Sbjct  428  VDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEGIDFSLT  487

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DA +   ++ E+VLVGGSTRIPKVQ LLS  F G
Sbjct  488  VTRAKFESLNEELFKRCEETVLKVLADAAMKPDEISEIVLVGGSTRIPKVQNLLSAVFGG  547

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  606

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  607  RNTAIPVRKTRVYTTEEDYQTAVDVCIYE  635

>PYU1_G001540
Length=633

 Score = 553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/449 (63%), Positives = 354/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  93

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NAHNTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGE K F PEEIS
Sbjct  94   NAHNTVFDAKRIIGRNFNDEIVKKDAKHFPFKIVEGDDNKVLIEVEFKGEQKRFTPEEIS  153

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGNNGQKTNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  273

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V++ ++EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLADANMKPEDITELVLVGGSTRIPKVQTMLSSLFNG  393

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  481

>PITG_11913
Length=786

 Score = 553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/449 (63%), Positives = 353/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDEDKVLIEVEFKGEKKSFTPEEIS  306

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V+H +SEFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLSEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  634

>SDRG_03564
Length=658

 Score = 552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/445 (64%), Positives = 359/445 (81%), Gaps = 5/445 (1%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
              NT+FD KRLIGR+++D  VQ+D K  P+++ +  G +P I V  KGE+KTF  EE+S+
Sbjct  89   PENTLFDVKRLIGRQYNDKSVQADKKLLPYEIVNKEG-RPYIQVIVKGETKTFSAEEVSA  147

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  148  MILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  188  AYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  245
            AYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD R++  
Sbjct  208  AYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFDQRVMQF  267

Query  246  FVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  305
            F+ +++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF+ T+TRA
Sbjct  268  FIKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDFDETLTRA  327

Query  306  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPC  365
            RFE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ DFFNGKEP 
Sbjct  328  RFEELNNDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFFNGKEPS  387

Query  366  KSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  425
            + INPDEAVA+GA VQ  IL+G  + E  +D+LLLDV PLSLG+ET GGVMT +I RNT 
Sbjct  388  RGINPDEAVAYGAAVQGGILAG-VNDESTKDILLLDVAPLSLGIETVGGVMTKIINRNTV  446

Query  426  VPTKKSQTFSTYADNQPGVLIQVFE  450
            VPTKKSQTFSTY DNQP V IQV+E
Sbjct  447  VPTKKSQTFSTYQDNQPAVSIQVYE  471

>PYIW_26567
Length=564

 Score = 552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/447 (63%), Positives = 353/447 (79%), Gaps = 4/447 (1%)

Query  6    TSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV  64
            TS G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ 
Sbjct  27   TSRGPIIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQA  86

Query  65   AMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEE  124
             +N   T+FD KRLIGR +SD  VQ+D K  P+ + +  G KP I V  KGE K F PEE
Sbjct  87   TINPEKTIFDVKRLIGRDYSDKSVQADKKLLPYHIVNKDG-KPMIEVLIKGEKKLFSPEE  145

Query  125  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTA  184
            IS+M+L KM+++AE+++G+EV +A++TVPAYFND+QRQATKDAG IAG+ V RIINEPTA
Sbjct  146  ISAMILTKMKQIAESYLGREVHDAIVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTA  205

Query  185  AAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAIAYG+DK+  GE++VL+FDLGGGTFDV+LL+IE G+FEV AT GDTHLGGEDFD R++
Sbjct  206  AAIAYGIDKQSEGEKHVLVFDLGGGTFDVTLLAIEGGVFEVLATNGDTHLGGEDFDQRVM  265

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
              F+ ++K+    DI  ++RAL++LR   ER KR LS+  QA +EIDSL DG DF+ T++
Sbjct  266  QFFIKKWKKDRGIDIGSDKRALQKLRREAERVKRALSTQTQARLEIDSLLDGEDFSETLS  325

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RARFE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIPKVQQL+ DFFNGKE
Sbjct  326  RARFEKLNEDLFKKTLTPVEKVLKDAGIKKSEVDEIVLVGGSTRIPKVQQLIKDFFNGKE  385

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
            P + +NPDEAVA+GA VQ  IL G  + + L D++L+DV PLS G+ET GGVMT LI RN
Sbjct  386  PSRGVNPDEAVAYGAAVQGGILGG-MNQKDLGDIVLIDVVPLSQGIETVGGVMTKLINRN  444

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            T +P KKSQ FST+ DNQP V I+V+E
Sbjct  445  TAIPNKKSQVFSTHVDNQPAVSIKVYE  471

>PPTG_03121
Length=786

 Score = 551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/449 (63%), Positives = 354/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSD +V+ D  H+PFK+  G  DK  I V+FKGE+K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFKIKEGDDDKVLIEVEFKGENKSFTPEEIS  306

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V+H ++EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  634

>PYIR_24387
Length=633

 Score = 551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/449 (63%), Positives = 355/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  187  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V++ ++EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLSDANMKPEDITELVLVGGSTRIPKVQTMLSGLFNG  393

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  481

>PHYKE_10815
Length=786

 Score = 550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/449 (63%), Positives = 353/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEMVKKDAKHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL++M+E AEAF+G+++  AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQKIGQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V+H ++EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  427  VEHLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  486

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVTKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  634

>PYU1_G004097
Length=663

 Score = 550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/441 (64%), Positives = 357/441 (81%), Gaps = 4/441 (1%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNAHN  70
            +GIDLGTTYSCVGV+++ +V+IIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N   
Sbjct  36   IGIDLGTTYSCVGVFKDGKVDIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATINPEK  95

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T+FD KRLIGR ++D  VQ+D K  P+++ +  G KP I V  KG++K F PEEIS+MVL
Sbjct  96   TIFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGQTKLFSPEEISAMVL  154

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+++AEA++G++V++AV+TVPAYFND+QRQATKDAG IAG++V RIINEPTAAAIAYG
Sbjct  155  GKMKQIAEAYLGRDVRDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAIAYG  214

Query  191  LDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            +DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F+ +
Sbjct  215  IDKKAQGEKNVLVFDLGGGTFDVTLLAIDNGVFEVLATNGDTHLGGEDFDQRVMQFFIKK  274

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            +K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF+ T+TRARFE 
Sbjct  275  WKQDKGVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLNGEDFSETLTRARFEK  334

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  D F+KT+ PVEKVL+DA L KSQV E+VLVGGSTRIPKVQQ++ D+FNGKEP + +N
Sbjct  335  LNEDLFKKTLGPVEKVLKDAGLKKSQVDEIVLVGGSTRIPKVQQMIKDYFNGKEPSRGVN  394

Query  370  PDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  429
            PDEAVA+GA +Q  IL G+   EKLQDL+L+DV PLS G+ET GGVMT LI RNT +PTK
Sbjct  395  PDEAVAYGAAIQGGILGGD-QDEKLQDLVLIDVVPLSQGIETVGGVMTKLINRNTAIPTK  453

Query  430  KSQTFSTYADNQPGVLIQVFE  450
            KSQ FST+ DNQ  V I+VFE
Sbjct  454  KSQVFSTHVDNQAAVSIKVFE  474

>PYIW_22144
Length=633

 Score = 549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/449 (63%), Positives = 356/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  187  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V++ ++EFKRK+R  D + + RA+RRL TACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSSSPRAMRRLHTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL+DA +   ++ E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLQDANMKPGEITELVLVGGSTRIPKVQTMLSGLFNG  393

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  481

>PYVX_18121
Length=633

 Score = 548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/449 (63%), Positives = 353/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSD +V+ D  H+PFK+  G  +K  I V+FKGE+K F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFSDEVVKKDATHFPFKIVEGDDNKVLIEVEFKGEAKRFTPEEIS  153

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL++M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  154  SMVLLRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  213

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V+H ++EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  274  VEHLLTEFKRKNRSLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  333

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DA +    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  334  VTRAKFESLNEELFKRCEETVLKVLSDANMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  393

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  481

>PHALS_02079
Length=786

 Score = 548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/449 (63%), Positives = 351/449 (78%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  246

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NT+FDAKR+IGR FSD +V+ D  H+PF +  G  DK  I V FKGE K+F PEEIS
Sbjct  247  NATNTIFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVDFKGEKKSFTPEEIS  306

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQNISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V++ +SEFKRK+R  D + + RA+RRLRTACE AKR LSS+  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLSEFKRKNRNMDPSTSARAMRRLRTACESAKRMLSSTTSASVEVDSLFEGVDFSST  486

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  634

>PHYRA_78193
Length=786

 Score = 548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/449 (63%), Positives = 353/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FKG+ K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDDDKVLIEVEFKGDKKSFTPEEIS  306

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGTACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V+H ++EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  + V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEDTVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  634

>PYAP_22238
Length=633

 Score = 547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/449 (63%), Positives = 354/449 (79%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAS  93

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            N  NTVFDAKR+IGR FSD IV+ D  H+PFK++ G  +K  I V+FKGE+K+F PEEIS
Sbjct  94   NPSNTVFDAKRIIGRNFSDEIVKKDATHFPFKITEGDDNKVLIQVEFKGETKSFTPEEIS  153

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  213

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G+     NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGQSGKGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  273

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            VD+ +SEFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VDYLLSEFKRKNRGLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSTT  333

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            ITRA+FE +  + F++  E V KVL DA +    + EVVLVGGSTRIPKVQ +LS  F G
Sbjct  334  ITRAKFESLNEELFKRCEETVVKVLSDANMKPEDITEVVLVGGSTRIPKVQTMLSAQFGG  393

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  481

>PHYCA_509820
Length=786

 Score = 543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/449 (63%), Positives = 350/449 (78%), Gaps = 8/449 (2%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSD +V+ D  H+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAG++V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  187  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            IAYGLD   G      NVLIFDLGGGTFDVSLLSIEEGIF VK+T GDT+LG EDFDN +
Sbjct  367  IAYGLDTNAGTDGKACNVLIFDLGGGTFDVSLLSIEEGIFGVKSTGGDTYLGSEDFDNNM  426

Query  243  VDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            V+H ++EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
            KE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            RNT +P +K++ ++T  D Q  V + ++E
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYE  634

>PYIW_16873
Length=496

 Score = 536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/290 (97%), Positives = 287/290 (99%), Gaps = 0/290 (0%)

Query  161  RQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  220
            RQATKDAGAIAG+NVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG
Sbjct  1    RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  60

Query  221  IFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLS  280
            IFEVKATAGDTHLGGEDFDNRLVDHFV EFKRKHRKDIT NQRALRRLRTACERAKRTLS
Sbjct  61   IFEVKATAGDTHLGGEDFDNRLVDHFVGEFKRKHRKDITSNQRALRRLRTACERAKRTLS  120

Query  281  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  340
            SSAQAYIEIDSLFDG+DFNSTITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVV
Sbjct  121  SSAQAYIEIDSLFDGVDFNSTITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVV  180

Query  341  LVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdllll  400
            LVGGSTRIPKVQQLLSDFFNGKEPCK+INPDEAVAFGATVQAAILSGND SEKLQDLLLL
Sbjct  181  LVGGSTRIPKVQQLLSDFFNGKEPCKAINPDEAVAFGATVQAAILSGNDQSEKLQDLLLL  240

Query  401  dvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            DVTPLSLGLETAGGVMTTLI+RNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  241  DVTPLSLGLETAGGVMTTLISRNTTVPTKKSQTFSTYADNQPGVLIQVFE  290

>CCI50234
Length=665

 Score = 529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/445 (62%), Positives = 344/445 (77%), Gaps = 4/445 (1%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  66
            TG  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  RLIGDAAKNQ   
Sbjct  34   TGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDATGTRLIGDAAKNQAVH  93

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            N   T+FD KRLIGRKF+D  VQ+D K  P+++ +  G KP I V  KGE K F PEEIS
Sbjct  94   NPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTVKGEQKVFAPEEIS  152

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            +MVL KM+++AE  IG  VK+AV+TVPAYFND+QRQATKDAG+IAG+ V RIINEPTAAA
Sbjct  153  AMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEPTAAA  212

Query  187  IAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  245
            IAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  
Sbjct  213  IAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRVMQF  272

Query  246  FVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  305
            F+ ++ ++   +I +++RA++++R   ER KR LS++ QA IE++SL DGIDF+  ++RA
Sbjct  273  FIKKWNKEKTIEIEKDKRAVQKIRREAERVKRALSTNTQARIEVESLIDGIDFSDNLSRA  332

Query  306  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPC  365
             FE +  D FRKT+ PV+KVL+DA L KS+V EVVLVGGSTRIPKVQ+LL  +FNGKE  
Sbjct  333  LFEKLNNDLFRKTLAPVDKVLKDAGLKKSEVDEVVLVGGSTRIPKVQELLKAYFNGKELN  392

Query  366  KSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  425
            + +NPDEAVA+GA VQ  IL G    +  +DLLL+DV PLS G+ET GGVMT +I RNT 
Sbjct  393  RGVNPDEAVAYGAAVQGGILGGE-QDDLNKDLLLIDVIPLSQGIETVGGVMTKIINRNTV  451

Query  426  VPTKKSQTFSTYADNQPGVLIQVFE  450
            +PTKKSQ FST +DNQ  V I V E
Sbjct  452  IPTKKSQVFSTSSDNQNAVSISVLE  476

>CCA24936
Length=661

 Score = 524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/445 (62%), Positives = 342/445 (77%), Gaps = 4/445 (1%)

Query  8    TGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  66
            TG  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  R+IGDAAKNQ   
Sbjct  30   TGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDVTGTRMIGDAAKNQAIH  89

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            N   T+FD KRLIGRKF+D  VQ+D K  P+++ +  G KP I V  K E K F PEEIS
Sbjct  90   NPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTIKDEQKVFAPEEIS  148

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            +MVL KM+++AE  IG  VK+AV+TVPAYFND+QRQATKDAG+IAG+ V RIINEPTAAA
Sbjct  149  AMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEPTAAA  208

Query  187  IAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  245
            IAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  
Sbjct  209  IAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQF  268

Query  246  FVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  305
            F+ ++ ++ + +I +++RA+++LR   ER KR LS+  QA +E++SL DG DF+  ++RA
Sbjct  269  FIKKWNKEKKINIEQDKRAIQKLRRESERVKRALSTLPQARLEVESLIDGQDFSDVLSRA  328

Query  306  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPC  365
             FE +  D FRKT+ PVEKVL+DA L KS++ EVVLVGGSTRIPKVQ+LL  FFNGKE  
Sbjct  329  MFEKLNNDLFRKTLAPVEKVLKDAGLKKSEIDEVVLVGGSTRIPKVQELLKAFFNGKELN  388

Query  366  KSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  425
            + +NPDEAVA+GA VQ  IL G    +  +DLLL+DV PLS G+ET GGVMT +I RNT 
Sbjct  389  RGVNPDEAVAYGAAVQGGILGGE-QDDLNKDLLLIDVIPLSQGIETVGGVMTKIINRNTV  447

Query  426  VPTKKSQTFSTYADNQPGVLIQVFE  450
            +PTKK+Q FST +DNQ  V I V E
Sbjct  448  IPTKKAQLFSTSSDNQNAVSISVLE  472

>SPRG_10477
Length=762

 Score = 526 bits (1354),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 277/443 (63%), Positives = 338/443 (76%), Gaps = 19/443 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A NA NT
Sbjct  184  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAASNATNT  243

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
            VFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEISSMVL 
Sbjct  244  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDDDKPLIQVSFKGEDKRFTPEEISSMVLT  303

Query  132  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGL  191
            +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA+AYGL
Sbjct  304  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  363

Query  192  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            D   G    + N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLG +  D  L     
Sbjct  364  DTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGVQAQDKGL-----  418

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
                     D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+TRA+F
Sbjct  419  ---------DPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSSTMTRAKF  469

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            E +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIPKVQ +LS  F GKE  KS
Sbjct  470  ESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGGKELSKS  529

Query  368  INPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            INPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P
Sbjct  530  INPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIP  588

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
             KK++ ++T  D Q  V + ++E
Sbjct  589  VKKTRVYTTEEDYQTQVDVCIYE  611

>PHYRA_72238
Length=601

 Score = 483 bits (1244),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 254/448 (57%), Positives = 328/448 (73%), Gaps = 3/448 (1%)

Query  5    TTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  64
            +T  G  VGIDLGTT++ VGVWQN+RVEI+ +  G+ +TPSYVAFT+T RLIG AAK Q+
Sbjct  4    STPEGPVVGIDLGTTFARVGVWQNNRVEIVPSCDGSYSTPSYVAFTETSRLIGHAAKYQL  63

Query  65   AMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEE  124
              NA NTVF   +L+GRKFSDP VQ  +KHWPFK+  G  D P++ VQF+GE+KTFQP E
Sbjct  64   TRNARNTVFGMNQLVGRKFSDPEVQRSMKHWPFKVICGQNDNPEVEVQFRGETKTFQPVE  123

Query  125  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTA  184
            I +M+L ++RE+AE   GK VK  V+TVP+ FN SQR+A KDAG IAG+NVLR +N  TA
Sbjct  124  ILAMLLAELRELAEKHTGKTVKEVVLTVPSCFNHSQRRAMKDAGEIAGLNVLRFVNPATA  183

Query  185  AAIAYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            A+IAYG DK    GE +VL+FDLGGG  DVS+++IE+GI+EVKA   D  LGG+  DNRL
Sbjct  184  ASIAYGFDKDWTDGEHDVLVFDLGGGMLDVSVVTIEQGIYEVKAAVTDARLGGQVLDNRL  243

Query  243  VDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  302
            V+H V++F+R H K++  N RA+ RLR ACE+AKR LSSS + YIE+D+L DGID+ +TI
Sbjct  244  VEHCVTDFERVHDKNLRVNLRAITRLRLACEQAKRALSSSTETYIELDALHDGIDYYATI  303

Query  303  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  362
            TRA  E++  D F K ++ V+KVLRDA+++K +V EVV+ GGS R PK+ QLL DFF+ K
Sbjct  304  TRAEMENLSADLFDKALQLVQKVLRDARVAKDRVREVVVGGGSARSPKMLQLLKDFFSDK  363

Query  363  EPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  422
                 I PDE  AFG TVQAAIL+   +S  L D ++LDVTPLSL  E  G     +I R
Sbjct  364  ALSSPIRPDEGAAFGVTVQAAILNC-VASPTLYDFIMLDVTPLSLWAEVDGTNSLVVIYR  422

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            +TTVPTK++  FST  DNQ  + +++FE
Sbjct  423  HTTVPTKRTVPFSTSEDNQAVMRVRIFE  450

>SPRG_00333
Length=615

 Score = 480 bits (1236),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 259/445 (58%), Positives = 327/445 (73%), Gaps = 48/445 (11%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
              NT+FD KRLIGR+++D  VQ+D K  PF++ +  G +P I V+ KGE+KTF  EE+S+
Sbjct  89   PENTLFDVKRLIGRQYNDKSVQADKKLLPFEIINKEG-RPYIQVKVKGETKTFSAEEVSA  147

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  148  MILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  188  AYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  245
            AYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD R++  
Sbjct  208  AYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFDQRVMQF  267

Query  246  FVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  305
            F+ +++++ + DI+ ++RAL++LR   E+  R                            
Sbjct  268  FIKKWQKQKKIDISSDKRALQKLRREAEQDAR----------------------------  299

Query  306  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPC  365
                           PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ DFFNGKEP 
Sbjct  300  ---------------PVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFFNGKEPS  344

Query  366  KSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  425
            + INPDEAVA+GA VQ  IL+G  + +  +D+LLLDV PLSLG+ET GGVMT +I RNT 
Sbjct  345  RGINPDEAVAYGAAVQGGILAG-VNDDGTKDILLLDVAPLSLGIETVGGVMTKIINRNTV  403

Query  426  VPTKKSQTFSTYADNQPGVLIQVFE  450
            VPTKKSQTFSTY DNQP V IQV+E
Sbjct  404  VPTKKSQTFSTYQDNQPAVSIQVYE  428

>PPTG_02120
Length=1001

 Score = 486 bits (1252),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 259/274 (95%), Positives = 265/274 (97%), Gaps = 0/274 (0%)

Query  177  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  236
            R +  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE
Sbjct  521  RGLYHPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  580

Query  237  DFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  296
            DFDNRLVDHF  EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+
Sbjct  581  DFDNRLVDHFTQEFKRKHRKDLTHNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGV  640

Query  297  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  356
            DFNSTITRARFED+C DYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLS
Sbjct  641  DFNSTITRARFEDLCADYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLS  700

Query  357  DFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  416
            DFFNGKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM
Sbjct  701  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM  760

Query  417  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  761  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  794

>PITG_15370
Length=474

 Score = 449 bits (1154),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 244/289 (84%), Positives = 264/289 (91%), Gaps = 3/289 (1%)

Query  150  ITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGT  209
            +TVPAYFNDSQRQAT  AGAIAG+NVLRIINEPTAAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  150  VTVPAYFNDSQRQATIYAGAIAGLNVLRIINEPTAAAIAYGLDKKGGEHNVLIFDLGGGT  209

Query  210  FDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLR  269
            FDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV+ FV+EFKRKHRKD+T NQRALRRLR
Sbjct  210  FDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEFFVTEFKRKHRKDMTSNQRALRRLR  269

Query  270  TACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDA  329
            TACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRARFED+C DYFRKTM+PV +VLRD+
Sbjct  270  TACERAKRTLSTSAQAYIEIDSLFDGVDFNSTITRARFEDLCSDYFRKTMDPVAQVLRDS  329

Query  330  KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGNd  389
            KLSK+QV+E+VLVG STR  KVQQLL DFFNGKE  KSINPDEAVA+GATVQAAILSGN+
Sbjct  330  KLSKNQVNEIVLVGSSTR-SKVQQLLKDFFNGKELFKSINPDEAVAYGATVQAAILSGNE  388

Query  390  sseklqdlllldvtplslglETAGGVMTTLIARN--TTVPTKKSQTFST  436
            SS KLQDLLLLDV PLSLGLETAGGVMT LI RN  T   T K ++ ST
Sbjct  389  SSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNNSTLSLTGKYRSLST  437

>PHYSO_525429
Length=610

 Score = 441 bits (1134),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 235/440 (53%), Positives = 311/440 (71%), Gaps = 8/440 (2%)

Query  16   LGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDA  75
            + TT   VGVW N+ V ++ +D   R  PS+VAFTDTERL+GD AK QVA N +NTVF  
Sbjct  1    MRTTCLRVGVWVNNNVAVLTSD---RPLPSFVAFTDTERLVGDVAKRQVATNVNNTVFGT  57

Query  76   KRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMRE  135
             RLIGRKFSD  VQ D+KHWPFK+  G  D P + VQ  G++KTF+P EI +M+L + RE
Sbjct  58   TRLIGRKFSDLEVQEDLKHWPFKVVGGPNDGPLVEVQAAGQTKTFRPVEILAMLLAEARE  117

Query  136  VAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDK--  193
              E  +GK V+NAV+TVPA FN +QRQA KDAGA+AG+NV R+I+  TAAAIA+GL+   
Sbjct  118  TVETHLGKRVENAVVTVPASFNYAQRQAIKDAGAVAGLNVARLISASTAAAIAHGLENKT  177

Query  194  KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRK  253
            K G+RN+L+ DLGGGT DVSL++IEE I+EV ATAG+ HLGGEDFD+RLV+H V+EFKR 
Sbjct  178  KAGQRNLLVLDLGGGTLDVSLVAIEEEIYEVLATAGNAHLGGEDFDSRLVEHCVAEFKRM  237

Query  254  HRKDITENQRALRRLRTACERAKRTL--SSSAQAYIEIDSLFDGIDFNSTITRARFEDMC  311
            HRKD++ N RA+ RLR ACE AKR L    S +  IE+D+L++GIDF++ ITRA+FE +C
Sbjct  238  HRKDLSTNARAMMRLRMACESAKRALFAPESVEKLIELDALYEGIDFHTKITRAQFEKLC  297

Query  312  GDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPD  371
             D     M PV++VL DA + +S+V EVV+VGGS RI KV++LL +FFNGK+  +S + +
Sbjct  298  ADLSDDIMLPVQQVLSDASVLRSKVDEVVMVGGSMRITKVEELLKEFFNGKKIIRSRHEE  357

Query  372  EAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT-LIARNTTVPTKK  430
            E    GAT+ AA+L+   S  K  +  +L                T+ +I R+TT+PT+K
Sbjct  358  ELNVLGATMHAAMLTDELSVIKPLEEFMLLDVTPLSLGVKIDDTNTSVMIPRSTTIPTRK  417

Query  431  SQTFSTYADNQPGVLIQVFE  450
            ++TFST  DNQ  V I++ E
Sbjct  418  TRTFSTSQDNQSVVQIELLE  437

>PPTG_02121
Length=222

 Score = 417 bits (1071),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 199/210 (95%), Positives = 206/210 (98%), Gaps = 0/210 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T  ++GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQ
Sbjct  2    TQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNA NTVFDAKRLIGRKFSDPIVQ+DIKHWPFK++SG GDKPQITVQFKGESKTFQPE
Sbjct  62   VAMNAANTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIINEPT
Sbjct  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVS  213
            AAAIAYGLDKKGGERNVLIFDLGGGTFDVS
Sbjct  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVS  211

>PYIR_16737
Length=511

 Score = 422 bits (1086),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 215/324 (66%), Positives = 263/324 (81%), Gaps = 2/324 (1%)

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            M+L KM++VAE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGM V RIINEPTAAAI
Sbjct  1    MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  60

Query  188  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  61   AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQFF  120

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
            + ++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  121  IKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  180

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP +
Sbjct  181  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  240

Query  367  SINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
             +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  241  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  299

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            PTKKSQTFSTY DNQP VLIQVFE
Sbjct  300  PTKKSQTFSTYQDNQPAVLIQVFE  323

>PITG_05721
Length=302

 Score = 410 bits (1055),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 225/292 (77%), Positives = 249/292 (85%), Gaps = 12/292 (4%)

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            +L K +      I  + K + +TVPAYFNDSQ QATKDAGAIAG+NVLRIINEPTAAAIA
Sbjct  1    MLQKCKPTTHRKIKNKTKTSEVTVPAYFNDSQHQATKDAGAIAGLNVLRIINEPTAAAIA  60

Query  189  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            YGLD+KGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGG DFDNR+V+ FV+
Sbjct  61   YGLDEKGGENNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGGDFDNRMVEFFVT  120

Query  249  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  308
            E K  HR            LRTACER KRTLS+SAQAYIEIDSLFDG+DFNSTITRARFE
Sbjct  121  EVKPLHR------------LRTACERTKRTLSTSAQAYIEIDSLFDGVDFNSTITRARFE  168

Query  309  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  368
            D+C DYFRKTM+PV +VLRD+KLSK+Q +E+VLVGGSTRIPKVQQLL DFFNGKE  KS+
Sbjct  169  DLCSDYFRKTMDPVAQVLRDSKLSKNQGNEIVLVGGSTRIPKVQQLLKDFFNGKELFKSV  228

Query  369  NPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            NPDEAVA+GATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAG VMT LI
Sbjct  229  NPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGSVMTKLI  280

>PHYKE_9008
Length=650

 Score = 415 bits (1067),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 239/446 (54%), Positives = 302/446 (68%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  28   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAIIDNDERLVGMPAKRQAVTNPEN  87

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKFSD   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  88   TFYAVKRLIGRKFSDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  144

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  145  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  204

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ + V EF
Sbjct  205  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  263

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  264  KKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  321

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  + DFF GK+P
Sbjct  322  ATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEDFF-GKKP  380

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  381  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  435

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  436  TIPTKKSQVFSTAADSQTQVGIKVLQ  461

>PYVX_15051
Length=632

 Score = 414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 303/446 (68%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKAPRVIENSEGARTTPSVVAILENDERLVGMPAKRQAVTNPQN  70

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKF+D   Q   K   +++ SG   K    V+ KG  K + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFTDKETQEVSKVVSYEIVSGPNGK-DAWVEAKG--KKYSPSQIGSMVL  127

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  128  TKMKETAEGFLGKSITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD  L+ + VSEF
Sbjct  188  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVSEF  246

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE +  +   +T+ P +K ++DA L K  ++EV+LVGG +R+PKVQQ + DFF GK+P
Sbjct  305  ATFEKLVANLIDRTIGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQSVEDFF-GKKP  363

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  418

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQ  444

>PHYRA_71123
Length=633

 Score = 413 bits (1061),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 238/446 (53%), Positives = 301/446 (67%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKAARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKYSPSQIGSMVL  127

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ + V EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  246

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  305  ATFEQLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEEFF-GKKP  363

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  418

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQ  444

>PITG_15786
Length=633

 Score = 412 bits (1058),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 237/446 (53%), Positives = 302/446 (68%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ + V+EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVNEF  246

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  305  ATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEEFF-GKKP  363

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  418

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQ  444

>H257_01277
Length=652

 Score = 411 bits (1057),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 235/454 (52%), Positives = 308/454 (68%), Gaps = 19/454 (4%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKN  62
            ++ S    +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK 
Sbjct  20   SSASGAEVIGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKR  79

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
            Q   N +NT++  KRLIGRKF D   Q   K   +K+ +G  +     V+ +G+   + P
Sbjct  80   QAVTNPYNTLYAVKRLIGRKFQDKETQEVAKVVSYKIVAGT-NGTDAWVEAQGQK--YSP  136

Query  123  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEP  182
             +I SMVL KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEP
Sbjct  137  SQIGSMVLTKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEP  196

Query  183  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            TAAA+AYGLDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L
Sbjct  197  TAAALAYGLDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEEL  255

Query  243  VDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID-----  297
            + H VSEFKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D     
Sbjct  256  LRHLVSEFKRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPK  313

Query  298  -FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  356
              N  ITRA+FE +      +T+ P +K ++DA ++K +++EV+LVGG +R+PKVQ  + 
Sbjct  314  HLNIKITRAQFEKLVNHLIERTLNPCKKCVKDAGVTKDEINEVILVGGMSRMPKVQTSVE  373

Query  357  DFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  416
            +FF GK P K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV 
Sbjct  374  EFF-GKRPSKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVF  427

Query  417  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            T LI RNTT+PTKKSQ FST +DNQ  V I+V +
Sbjct  428  TKLIPRNTTIPTKKSQVFSTASDNQTQVGIKVLQ  461

>H310_06631
Length=651

 Score = 411 bits (1057),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 234/447 (52%), Positives = 304/447 (68%), Gaps = 21/447 (5%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  28   IGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPFN  87

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQIT-VQFKGESKTFQPEEISSMV  129
            T++  KRLIGRK+ D   Q   K   +K+ +G    P  T    + + + + P +I SMV
Sbjct  88   TLYAVKRLIGRKYQDKETQDVSKVVSYKIVAG----PNGTDAWVEAQGQKYSPSQIGSMV  143

Query  130  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAY  189
            L KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AY
Sbjct  144  LTKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAY  203

Query  190  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            GLDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H VSE
Sbjct  204  GLDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHLVSE  262

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTIT  303
            FKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  IT
Sbjct  263  FKRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKIT  320

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RA+FE + G    +T+ P +K ++DA ++K +++EV+LVGG +R+PKVQ  + +FF GK 
Sbjct  321  RAQFEKLVGHLIERTLNPCKKCVKDAGVTKEEINEVILVGGMSRMPKVQTSVEEFF-GKR  379

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
            P K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RN
Sbjct  380  PSKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRN  434

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            TT+PTKKSQ FST +DNQ  V I+V +
Sbjct  435  TTIPTKKSQVFSTASDNQTQVGIKVLQ  461

>PYU1_G003754
Length=650

 Score = 411 bits (1056),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 239/446 (54%), Positives = 300/446 (67%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  30   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  89

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKF D   Q   K   +K+ SG   K    V+ KG  K + P +I SMVL
Sbjct  90   TFYAVKRLIGRKFQDKETQEVSKVVSYKIVSGPNGK-DAWVEAKG--KKYSPSQIGSMVL  146

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  147  TKMKETADGFLGKSVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  206

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+   V EF
Sbjct  207  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGEF  265

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  266  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  323

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A+FE + G    +TM P +K ++DA L K  ++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  324  AQFEKLVGHLIERTMTPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTSVEEFF-GKKP  382

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  383  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  437

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  438  TIPTKKSQVFSTAADSQTQVGIKVLQ  463

>PHALS_07616
Length=677

 Score = 412 bits (1058),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 302/446 (68%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  55   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  114

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  115  TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKYSPSQIGSMVL  171

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A+ F+GK +  AVITVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  172  TKMKETADGFLGKPITQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  231

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ + VSEF
Sbjct  232  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVSEF  290

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   +++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  291  KKETSINLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASGPKHLNMKITR  348

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE + G    +TM P +K ++DA LSKS ++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  349  ATFEKLVGKLIERTMGPCKKCVKDAGLSKSDINEVILVGGMSRMPKVQASVEEFF-GKKP  407

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  408  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  462

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  463  TIPTKKSQVFSTAADSQTQVGIKVLQ  488

>PPTG_18274
Length=648

 Score = 410 bits (1054),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 238/446 (53%), Positives = 300/446 (67%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  86

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG    + P +I SMVL
Sbjct  87   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGTK--YSPSQIGSMVL  143

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  144  TKMKETADGFLGKPVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  203

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ + V EF
Sbjct  204  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  262

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  263  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  320

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  321  ATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEEFF-GKKP  379

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  380  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  434

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  435  TIPTKKSQVFSTAADSQTQVGIKVLQ  460

>PHYCA_541134
Length=633

 Score = 410 bits (1053),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 237/446 (53%), Positives = 300/446 (67%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ + V EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  246

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE + G    +TM P +K ++DA L KS ++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  305  ATFEKLVGKLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQTSVEEFF-GKKP  363

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  418

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQ  444

>PYAP_19738
Length=648

 Score = 410 bits (1053),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 239/446 (54%), Positives = 301/446 (67%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  29   IGIDLGTTNSCVAVMEGKTPRVIENAEGARTTPSVVAILENDERLVGMPAKRQAVTNPDN  88

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  89   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVPGPNGK-DAWVEAKG--KKYSPSQIGSMVL  145

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A++F+GK V  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  146  TKMKETADSFLGKSVSQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  205

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD  L+ + V+EF
Sbjct  206  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVAEF  264

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  265  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  322

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PKVQQ + +FF GK+P
Sbjct  323  ATFEKLVSGLVERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFF-GKKP  381

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  382  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  436

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  437  TIPTKKSQVFSTAADSQTQVGIKVLQ  462

>PHYSO_500480
Length=633

 Score = 409 bits (1051),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 236/446 (53%), Positives = 301/446 (67%), Gaps = 19/446 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKHVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ + V EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  246

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            +++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  I+R
Sbjct  247  RKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKISR  304

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE + G+   +TM P +K ++DA L KS ++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  305  ATFEKLVGNLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQSTVEEFF-GKKP  363

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  418

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQ  444

>SDRG_11043
Length=649

 Score = 409 bits (1051),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 234/447 (52%), Positives = 302/447 (68%), Gaps = 21/447 (5%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGA-GDKPQITVQFKGESKTFQPEEISSMV  129
            T++  KRLIGRKF+D   Q   K   +K+  G  G    +  Q     + + P +I SMV
Sbjct  87   TLYAVKRLIGRKFNDKETQEVSKVVSYKIVPGTNGSDAWVEAQ----GQKYSPSQIGSMV  142

Query  130  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAY  189
            L KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AY
Sbjct  143  LTKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAY  202

Query  190  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            G+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+   V E
Sbjct  203  GMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGE  261

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTIT  303
            FKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  IT
Sbjct  262  FKRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKIT  319

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            RA+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PKVQQ + DFF GK 
Sbjct  320  RAQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPKVQQSVEDFF-GKR  378

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
            P K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RN
Sbjct  379  PSKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRN  433

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            TT+PTKKSQ FST +DNQ  V I+V +
Sbjct  434  TTIPTKKSQVFSTASDNQTQVGIKVLQ  460

>PPTG_16727
Length=217

 Score = 392 bits (1006),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 194/206 (94%), Gaps = 0/206 (0%)

Query  4    TTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63
            T   TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  2    TEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            VAMNAHNTVFD KRLIGRKF+DP VQSDIKHWPFK+  GA +KPQ+ VQFKGESKTFQPE
Sbjct  62   VAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQPE  121

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMVLIKMREVAEAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAG+NVLRIINEPT
Sbjct  122  EISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGT  209
            AAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  182  AAAIAYGLDKKGGEHNVLIFDLGGGT  207

>CCI45982
Length=661

 Score = 405 bits (1041),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 235/456 (52%), Positives = 305/456 (67%), Gaps = 19/456 (4%)

Query  2    AQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  60
            AQ    +G  +GIDLGTT SCV   +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  26   AQNVAGSGAVIGIDLGTTNSCVATMEGKTPRVIENSEGARTTPSVVAILDGGERLVGMPA  85

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            K Q   N  +T +  KRLIGRK++D       +   +K+  G   K    V+ KG+   +
Sbjct  86   KRQAVTNPESTFYAVKRLIGRKYNDGETNKVKEVVSYKIVPGPNGK-DAWVETKGQK--Y  142

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
             P +I SMVL KM+E A++F+G+ V  AVITVPAYFNDSQRQATKDAG IAG++VLRIIN
Sbjct  143  SPSQIGSMVLAKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIIN  202

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  203  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  261

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  297
             L+ H VS+FK++   D++++  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  262  ELLRHLVSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASG  319

Query  298  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  354
                N  ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PKVQQ 
Sbjct  320  PKHLNMKITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQA  379

Query  355  LSDFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGG  414
            + DFF GK+P K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GG
Sbjct  380  VEDFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGG  433

Query  415  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +
Sbjct  434  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQ  469

>SPRG_11133
Length=676

 Score = 405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 227/439 (52%), Positives = 301/439 (69%), Gaps = 18/439 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GIDLGTT   VGVW++ +VE++ ND GN +TPS VAFTD  RL+GD AK+Q   NA NT
Sbjct  10   IGIDLGTTTCSVGVWRHGQVEMVRNDNGNLSTPSCVAFTDAGRLVGDFAKSQAPRNAPNT  69

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
            VF+  R+IGR++ +   ++       ++  G  + P I V  KGE+K   PEEI + +++
Sbjct  70   VFNIMRIIGRRYDEVRKKT-------QVVCGPKNNPMIRVVEKGETKELHPEEILAELVV  122

Query  132  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGL  191
            K+++    +    +++AV+TVP  FN  QRQA +DA AIAG+   RI + PT AA+A+  
Sbjct  123  KLKDDVVTYTNARIEHAVVTVPTGFNLLQRQAVRDACAIAGLAKYRISDAPTTAAVAH-T  181

Query  192  DKKGGER---NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
              KG  R   + ++ D+GGG   VSLL+IE+GIFEVKA AGD  LGGEDFD+ L DHF +
Sbjct  182  SIKGAPRCEVHDMVVDMGGGHLSVSLLAIEDGIFEVKAVAGDACLGGEDFDDVLFDHFAA  241

Query  249  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  308
            EF R++RKD+T   RA+RRLRTACE+AKR LS S  A +E++ LF  IDF S+ITRARFE
Sbjct  242  EFARQYRKDMTTCDRAVRRLRTACEKAKRDLSISNTATLELEVLFGSIDFRSSITRARFE  301

Query  309  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN----GKEP  364
            D+C   FRK  +P+EKVLRDAK+ KSQV +VVL GGS R+PK+QQLLS FF      K+ 
Sbjct  302  DLCSGLFRKVTQPIEKVLRDAKIDKSQVRDVVLAGGSMRMPKMQQLLSSFFGERYADKKL  361

Query  365  CKSI-NPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
            C SI N +EA A GATV AA+   +++S     LL+L V P S+G+ET GGVMTTLI+RN
Sbjct  362  CHSILNNNEAAAHGATVMAAL--NDETSPDDMHLLVLHVVPYSVGIETGGGVMTTLISRN  419

Query  424  TTVPTKKSQTFSTYADNQP  442
            TT+P+KKS+ F       P
Sbjct  420  TTIPSKKSEKFKISQPQSP  438

>CCA21514
Length=659

 Score = 402 bits (1032),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 234/456 (51%), Positives = 304/456 (67%), Gaps = 19/456 (4%)

Query  2    AQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  60
            AQ    +G  +GIDLGTT SCV         +I N +G RTTPS VA  D  ERL+G  A
Sbjct  25   AQNAAGSGAVIGIDLGTTNSCVATMDGKTPRVIENSEGARTTPSVVAILDGGERLVGMPA  84

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            K Q   N  +T +  KRLIGRK++D       +   +K+  G+  K    V+ KG+   +
Sbjct  85   KRQAVTNPESTFYAVKRLIGRKYNDHETNKVKEVVSYKIVPGSNGK-DAWVETKGQK--Y  141

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
             P +I SMVL KM+E A++F+G+ V  AVITVPAYFNDSQRQATKDAG IAG+ VLRIIN
Sbjct  142  SPSQIGSMVLGKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIIN  201

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  202  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  260

Query  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  297
             L+ H VS+FK++   D++++  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  261  ELLRHLVSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASG  318

Query  298  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  354
                N  ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PKVQQ 
Sbjct  319  PKHLNMKITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQA  378

Query  355  LSDFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGG  414
            + +FF GK+P K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GG
Sbjct  379  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGG  432

Query  415  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +
Sbjct  433  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQ  468

>PYAR_22188
Length=634

 Score = 391 bits (1005),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 228/425 (54%), Positives = 290/425 (68%), Gaps = 19/425 (4%)

Query  33   IIANDQGNRTTPSYVAFTDTE-RLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQSD  91
            +I N +G RTTPS VA  D E RL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENAEGARTTPSVVAILDNEERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  92   IKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVIT  151
             K   +K+ +G   K    V+ KG  K + P +I SMVL KM+E A+ F+GK +  AV+T
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKPITQAVVT  124

Query  152  VPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  211
            VPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  212  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTA  271
            VS+L I  G+FEVKAT GDT LGGEDFD  L+ + V+EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVTEFKKETSIDLSGDNLAMQRLREA  243

Query  272  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  325
             E+AKR L   AQ  I +   F   D       N  ITRA FE + G+   +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVGNLVERTMGPCKKC  301

Query  326  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAIL  385
            ++DA L K  ++EV+LVGG +R+PKVQQ + +FF GK+P K +NPDE VA GA +Q  +L
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFF-GKKPSKGVNPDEVVAMGAAIQGGVL  360

Query  386  SGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVL  445
             G+     ++D+LLLDVTPLSLG+ET GGV T LI RNTT+PTKKSQ FST AD+Q  V 
Sbjct  361  RGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVG  415

Query  446  IQVFE  450
            I+V +
Sbjct  416  IKVLQ  420

>PYIR_19697
Length=608

 Score = 385 bits (990),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 286/425 (67%), Gaps = 19/425 (4%)

Query  33   IIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQSD  91
            +I N +G RTTPS VA  D  ERL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  92   IKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVIT  151
             K   +K+ +G   K    V+ KG  K + P +I SMVL KM+E A+ F+GK +  AV+T
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKTITQAVVT  124

Query  152  VPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  211
            VPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  212  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTA  271
            VS+L I  G+FEVK+T GDT LGGEDFD  L+ + V EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEFKKETSIDLSSDNLAMQRLREA  243

Query  272  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  325
             E+AKR L   AQ  I +   F   D       N  ITRA FE +      +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVSHLIERTMTPCKKC  301

Query  326  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAIL  385
            ++DA L K  ++EV+LVGG +R+PKVQ  + +FF GK+P K +NPDE VA GA +Q  +L
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQTTVEEFF-GKKPSKGVNPDEVVAMGAAIQGGVL  360

Query  386  SGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVL  445
             G+     ++D+LLLDVTPLSLG+ET GGV T LI RNTT+PTKKSQ FST AD+Q  V 
Sbjct  361  RGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVG  415

Query  446  IQVFE  450
            I+V +
Sbjct  416  IKVLQ  420

>PHYSO_339666
Length=585

 Score = 382 bits (982),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 211/443 (48%), Positives = 283/443 (64%), Gaps = 35/443 (8%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            VGIDLGTT S VGVW+N+RVE I N Q    TPSYVAFT+T  L+G+AAK Q+  N  NT
Sbjct  5    VGIDLGTTGSRVGVWRNERVEFIPNRQQAYWTPSYVAFTETALLVGEAAKRQLTTNPENT  64

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
            VFD  + +GRKFS+  ++  +  WPFK+  G  D PQ+ VQ+KGE+K+F P EI +++L 
Sbjct  65   VFDLTQFVGRKFSE--LRESVIDWPFKVECGPEDTPQVVVQYKGETKSFMPVEIMAILLY  122

Query  132  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGL  191
            +MR++AE ++ +EV  AV TVP  FN  QRQA KDAGAIAG++V+R++N  T A I YG 
Sbjct  123  EMRKIAEIYLDQEVTKAVFTVPGSFNYFQRQAMKDAGAIAGLDVIRLVNSATVACIEYGF  182

Query  192  DK---KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            +    + GE NVL+ D G  + +                          FD+RLV+HF +
Sbjct  183  NTLVGRVGELNVLVVDYGASSLN--------------------------FDSRLVEHFAA  216

Query  249  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  308
            EF+R+H KD+  +  A+ RLRTACE AKR LSSS +A+IE+D+L DGI+F S I     E
Sbjct  217  EFQRRHGKDLRSDSSAVMRLRTACEHAKRALSSSMEAFIELDALHDGINFYSMIRCVWME  276

Query  309  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  368
             +C D F K +  VEK+LR+A+L K QV E+VLVGGST +PKVQQ L DFFNGK    S+
Sbjct  277  RLCADLFDKMLRLVEKLLREARLRKDQVDEIVLVGGSTHVPKVQQKLKDFFNGK--MLSL  334

Query  369  NPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL-IARNTTVP  427
              DEA AFG  VQ   L G   S KL + +LLD   L   +E    +M  + +++N+T+P
Sbjct  335  RQDEAAAFGVAVQGDFL-GGLPSPKLDEYMLLDTASLEFSVEIDDCMMKEVPVSKNSTLP  393

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
             +KS+TF T   N+  + I+ FE
Sbjct  394  MRKSRTFLTANANKSTMRIKAFE  416

>SDRG_05816
Length=479

 Score = 376 bits (965),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 202/328 (62%), Positives = 254/328 (77%), Gaps = 6/328 (2%)

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA+
Sbjct  1    MVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAAL  60

Query  188  AYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  61   AYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  120

Query  244  DHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  302
            D  V+EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  121  DFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSSTM  180

Query  303  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  362
            TRA+FE +  + F++T E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  181  TRAKFESLNEECFKRTEETVLKVLADANMQPGDITELVLVGGSTRIPKVQNMLSAVFGGK  240

Query  363  EPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  422
            E  KSINPDEAVA+GA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  241  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  299

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            NT +P KK++ ++T  D Q    + +FE
Sbjct  300  NTAIPVKKTRIYTTEEDWQTTEKVVIFE  327

>SPRG_02294
Length=634

 Score = 376 bits (966),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 222/446 (50%), Positives = 291/446 (65%), Gaps = 34/446 (8%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            T++  KRLIGRKFSD   Q   K   + + +G   +       + + + + P +I SMVL
Sbjct  87   TLYAVKRLIGRKFSDKETQEVSKVVSYNIVAGTNGQ---DAWVEAQGQKYSPSQIGSMVL  143

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAG++VLRIINEPTAAA+AYG
Sbjct  144  TKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  203

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+   V EF
Sbjct  204  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGEF  262

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            KR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  ITR
Sbjct  263  KRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKITR  320

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PKVQQ + DFF GK P
Sbjct  321  AQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPKVQQSVEDFF-GKRP  379

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             +                 +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  380  RR---------------GGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  419

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST +DNQ  V I+V +
Sbjct  420  TIPTKKSQVFSTASDNQTQVGIKVLQ  445

>PHYRA_71591
Length=570

 Score = 367 bits (943),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 195/442 (44%), Positives = 283/442 (64%), Gaps = 4/442 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KRL+G+  +D   +  +K WPF +++GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVSDRDYVKEWPFNVTAGADGVAQAETQRNGEKHPVTPVEFMALLLQN  124

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++E+AE F G+++++ VI  PA+ ++S  +    A A AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGEKLEHVVINKPAHTDESYTELLDAAAAKAGVNVLTYLSEPLAAAIAYGLD  184

Query  193  KKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   L +H    
Sbjct  185  EASNNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFSAALFEHCAKS  244

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G D +  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRSLSTQTQANIEVDSLMEGEDLSLKLSRPRFEE  304

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  DY  +T+  ++ +L +  L K  +  VVLVGGSTRIP VQ L+  +F GK     ++
Sbjct  305  LISDYVHETITEIDAILEENDLEKDDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVHTQLS  364

Query  370  PDEAVAFGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            PDEAVAFGAT++A+ L+      E  + L L++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAFGATIEASGLAELVGVPEPKKPLNLVNVVPLNLSVALANGSVSELIQRDTVLPA  424

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
              ++ F+T  DNQ  V +Q++E
Sbjct  425  TATELFTTSEDNQEAVFLQIYE  446

>PHYSO_552116
Length=570

 Score = 365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/442 (43%), Positives = 283/442 (64%), Gaps = 4/442 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KRL+G+  +D   +  +K WPF +++GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVADRDFVKEWPFDITAGADGVAQAETQRNGEKHPVSPVEFMALLLQN  124

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++++AE F G+++++ VI+ PA+ +DS  +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVISKPAHTDDSYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  184

Query  193  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   + +H    
Sbjct  185  EAANNAKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAAVFEHCAKS  244

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F RK + D+  NQ+A  RLR ACE AK+TLS+  QA IE+D+L +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRIACEVAKKTLSTQTQANIEVDTLMEGEDFSLKLSRPRFEE  304

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  DY  +T+  +E +L + +L K  +  +VLVGGSTRIP VQ L+  FF+GK     ++
Sbjct  305  LITDYVHETITEIEAILEENELEKEDIDHIVLVGGSTRIPLVQNLVKKFFDGKNVHTQLS  364

Query  370  PDEAVAFGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            PDEAVA+GAT++ + L+           L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAYGATIEGSGLAELVGVPAPKNPLNMVNVVPLNLSVALANGSVSELIQRDTVLPA  424

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
              ++ F+T  DNQ  V +Q++E
Sbjct  425  TATELFTTSEDNQEAVYLQIYE  446

>HYAP_01993
Length=569

 Score = 363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/442 (43%), Positives = 282/442 (64%), Gaps = 4/442 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+GTT+ CVGVWQN +V IIANDQG RTTP+YV F   E ++GD A N++A +A NT+
Sbjct  5    GIDIGTTHGCVGVWQNGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKLASHADNTI  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KRL+G+  +D   +  +K WPF ++ GA    Q   Q  GE     P E   ++L  
Sbjct  65   FHLKRLLGKAHADVKDREFVKEWPFGVTEGADGVAQAETQRNGEKHAVDPVEFMMLLLQN  124

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++++AE F G+++++ VI  PA+ ++   +    A    G+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVINKPAHTDEKYTELLDAAAKKVGVNVLTYLSEPLAAAIAYGLD  184

Query  193  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G+  LGGEDF   + +H    
Sbjct  185  EAANNDKPEFVLVFDIGGATHDVTLLNADKGLFEVVASKGNDTLGGEDFTAAIFEHCAKS  244

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  245  FLRKTKLDVKPNQKASSRLRLACEAAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  304

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  D  +KT+  +E +L+D +L K  +  VVLVGGS+RIP VQ L+  FF  K     ++
Sbjct  305  LINDDVQKTITEIEAILKDNELEKEDIDHVVLVGGSSRIPLVQTLIKKFFENKTLHTQLS  364

Query  370  PDEAVAFGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            PDEAVAFGAT++A+ L+    S    + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAFGATIEASCLAELLGSEAPAKPLNMVNVVPLTLSVALANGSVSELIQRDTILPA  424

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
              ++ F+T +DNQ    +Q++E
Sbjct  425  SATEVFTTSSDNQEAAFLQIYE  446

>PYAP_16216
Length=564

 Score = 361 bits (926),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 184/442 (42%), Positives = 286/442 (65%), Gaps = 4/442 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+G+T+ CVGVWQN +V IIANDQG RTTP++V F   E ++GD A N++  +A NTV
Sbjct  5    GIDIGSTHGCVGVWQNGKVNIIANDQGFRTTPAFVCFEGEEVIVGDTAVNKLHSHAANTV  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KR++G+   +   +  +  W F+L+ GA           GE+    P +  S+++  
Sbjct  65   FHLKRVLGKNHEEIASRDFVSEWSFELTKGADGLAVAKTARNGEAHEVSPVDFVSILIKN  124

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++++AE F G+ V + VI +PA+  +SQ++  + A   AG+NV+  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGETVDSIVINIPAHAGESQKELIRAAATKAGVNVMSYLSEPLAAAIAYGLD  184

Query  193  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
               K       L+FD+GG T DV+LLS+++G+FE+ AT+G+  LGGEDF   + +H    
Sbjct  185  ENTKNSHAEYALVFDIGGATHDVTLLSVDKGLFEIVATSGNDALGGEDFTKAIFEHCAKS  244

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F+RK + ++ +NQ+A  RLR ACE AKR+LS+ +Q  IE+DSL +G DF   ++R RFE+
Sbjct  245  FQRKTKLNVKDNQKASSRLRAACETAKRSLSTQSQVNIEVDSLMEGEDFALKLSRPRFEE  304

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  D+ + +++ VEK+L +A++ K+ +  V+L+GGS+RIP VQ  +  FF+GK+    I+
Sbjct  305  LIADFVKDSLKEVEKLLEEAEIEKADIDHVILIGGSSRIPLVQNSVKKFFDGKKTHMHIS  364

Query  370  PDEAVAFGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            PDE VA GAT++AA +       E       ++VTPL+L +  A G ++ +I R+T +PT
Sbjct  365  PDEVVAHGATLEAAAIGDIAALGEPKSAQNDVNVTPLTLSVALANGSVSEVIHRDTVLPT  424

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
              ++ F+T  DNQ  + IQV+E
Sbjct  425  SATEVFTTSVDNQDSIFIQVYE  446

>PPTG_10122
Length=569

 Score = 361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/442 (43%), Positives = 285/442 (64%), Gaps = 5/442 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KRL+G+  +D   +  +K WPF ++ GA +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVKDRDFVKEWPFDVTQGA-EGAQVETQRSGEKHPVTPVEFMAVLLQN  123

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++E+AE F G+++++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  183

Query  193  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H    
Sbjct  184  EAANNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKASSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP VQ L+  +F+GK     ++
Sbjct  304  LISDYVHETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFDGKNVRTQMS  363

Query  370  PDEAVAFGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            PDEAVA+GAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAYGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
              ++ F+T  DNQ  V +Q++E
Sbjct  424  TATELFTTSEDNQEAVFLQIYE  445

>SDRG_10038
Length=565

 Score = 358 bits (920),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 192/443 (43%), Positives = 281/443 (63%), Gaps = 4/443 (1%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA NT
Sbjct  4    IGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAANT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
            V+  KR++G+K SD      IK W F + + A       V  K   +     E +S+VL 
Sbjct  64   VYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKRDVSATEFASLVLG  123

Query  132  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGL  191
            K++ +AE + G +VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AAAIAYG 
Sbjct  124  KLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAYGF  183

Query  192  D--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV+H V  
Sbjct  184  DETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALVEHCVKT  243

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F+R+ + D+ +N RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D    ++R+RFE+
Sbjct  244  FERQKKVDLKDNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRFEE  303

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            M GD+ RK +  +E +L +A L K  +  V+L GGSTRIPKVQ  +  FF+GK+   +I 
Sbjct  304  MIGDHVRKMVTDIETLLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKKASSTIV  363

Query  370  PDEAVAFGATVQAAILS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            PDE +A+GATV+AA LS      +     L +++  PL+L L  A G +  +I RNT +P
Sbjct  364  PDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVLP  423

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
                + F+T+ DNQ  V +Q++E
Sbjct  424  ATTQEVFTTHVDNQKAVYLQIYE  446

>SDRG_05778
Length=618

 Score = 357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 199/240 (83%), Gaps = 6/240 (3%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  247

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAG++V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  187  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

 Score = 39.7 bits (91),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 0/40 (0%)

Query  411  TAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            T G VM+ LI RNT +P KK++ ++T  D Q  V + ++E
Sbjct  428  TVGRVMSVLIKRNTAIPIKKTRVYTTEEDYQTQVDVCIYE  467

>PYU1_G006940
Length=565

 Score = 354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/442 (42%), Positives = 280/442 (63%), Gaps = 4/442 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLHSHAENTI  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KR++G+   D +    I+ W FK+S              GE     P E  S+++  
Sbjct  65   FHLKRVLGKNHEDVVDHDYIQEWSFKVSKADDGAVHAATSRNGEPHHVTPVEFVSLLIKN  124

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++++AE F G+ V + V+++PA+  + Q++  ++A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEAVDSVVLSIPAHATEKQKELLQEAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  193  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
               K      VL+FD+GG T DV+L++ ++G+FE+ A+AG+  LGGEDF   LV+H    
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVASAGNDKLGGEDFTKALVEHCAKA  244

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F+RK + ++ +N++A  RLR ACE AKRTLS+  Q  IEIDSL +G DF+  ++R RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQTQVNIEIDSLMEGEDFSLKLSRPRFEE  304

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  DY    ++ V+ +L  A + K  V  V+LVGGS+RIP +Q  +  +F+GK     ++
Sbjct  305  LINDYVTAALKEVDALLESADVEKEHVDHVILVGGSSRIPLLQNAVKKYFDGKTTHLHLS  364

Query  370  PDEAVAFGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            PDE VA GATV+A++ +   +     + L  ++VTPL+L +  A G +T LI R T +P 
Sbjct  365  PDEVVAHGATVEASLRADLANFEAPKKALDNVNVTPLTLSVALANGSVTELIHRETVLPA  424

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
              ++TF+T  DNQ  + +Q++E
Sbjct  425  TATETFTTSQDNQTAIFLQIYE  446

>PITG_03546
Length=569

 Score = 353 bits (907),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 188/442 (43%), Positives = 282/442 (64%), Gaps = 5/442 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F   R++G+  +D   +  +K WPF ++ G+ +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLNRILGKAHADIKDRDFVKEWPFDVTQGS-EGAQVETQRNGEKHPVTPVEFMAVLLQN  123

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++E+AE F G+++++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGLD  183

Query  193  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H    
Sbjct  184  EATSNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F RK + D+  NQ+   RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKTSSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP VQ L+  +F GK     ++
Sbjct  304  LITDYVNETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVRTQMS  363

Query  370  PDEAVAFGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            PDEAVAFGAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAFGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
              ++ F+T  DNQ  V +Q++E
Sbjct  424  TATELFTTSEDNQEAVFLQIYE  445

>H310_12765
Length=560

 Score = 352 bits (902),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 280/444 (63%), Gaps = 6/444 (1%)

Query  11   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  70
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCMVSFASDDVVVGDSAVAKLHNNAAN  62

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            TV+  KR++G+K  D      +K W F L++     P I     G S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKDVHAHEYVKDWSFDLAADKHGAP-IAKILDG-SRDIHAVEFCTIVL  120

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             K++ +AE + G  VKN+V+TVP  ++D Q+   ++A + A +NVLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGSSVKNSVLTVPEGYSDEQKALLQEAASAADLNVLRYISEPIAAAIAYG  180

Query  191  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            LD  KK   +  ++ D+GG + D++LLS+++G+F V ATA D  LGGE F N +V+H + 
Sbjct  181  LDEDKKNESKLAVVVDIGGASTDLTLLSVDKGLFNVIATASDHALGGEVFTNSVVEHCIK  240

Query  249  EFKRKHRKDIT-ENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
             F+R+ +  I  +N RAL R++ A E+AK++LS+  Q  IE+DSL DG D    ++R+RF
Sbjct  241  TFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQTQVTIEVDSLADGQDLIVKLSRSRF  300

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            EDM  D+ RK  + +  +L  A   K  +  V+L+GGSTRIPKVQ  + DFF+GK+   +
Sbjct  301  EDMVIDHIRKVTKDIAALLEGAGYEKDSIDHVLLIGGSTRIPKVQTAVEDFFDGKKALVT  360

Query  368  INPDEAVAFGATVQAAILSGNds-seklqdlllldvtplslglETAGGVMTTLIARNTTV  426
            I PDEAVAFGATV++  LS     +     L  ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESGTLSETADWTLPEDPLNNVEAVPLNLSLGLADGTVYDMIHRGTIL  420

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            P    + F+T  DNQ  V +QV+E
Sbjct  421  PANHQEVFTTQVDNQHAVYLQVYE  444

>PITG_15111
Length=186

 Score = 336 bits (861),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 173/180 (96%), Gaps = 0/180 (0%)

Query  182  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  7    PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR  66

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            LV+ FV+EFKRKHRKD+T NQRALRRLRTACERAKRTL +SAQAYIEIDSL+DG+DFNST
Sbjct  67   LVEFFVTEFKRKHRKDMTSNQRALRRLRTACERAKRTLFTSAQAYIEIDSLYDGVDFNST  126

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            ITRARFED+C DYFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIPKVQQLL DFFNG
Sbjct  127  ITRARFEDLCSDYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPKVQQLLKDFFNG  186

>PYIR_24123
Length=567

 Score = 347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/442 (40%), Positives = 279/442 (63%), Gaps = 4/442 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E ++GD A N+++ +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIVGDTAVNKLSSHAENTI  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KR++G+   + + +  I+ W FK++              GE+    P E  S+++  
Sbjct  65   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSEDGAVHAATSRNGEAHHVTPVEFVSLLIKN  124

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++++AE F G+ V N V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGESVDNVVLSIPAHVTEKQKELLQAAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  193  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
               K      VL+FD+GG T DV+L++ ++G+FE+ AT+G  +LGGEDF   L +H    
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVATSGKDNLGGEDFTKALFEHCAKA  244

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F+RK + ++ +N++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  304

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP +Q  +   F+GK     ++
Sbjct  305  LISDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVKKHFDGKTTHLHLS  364

Query  370  PDEAVAFGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            PDE VA GAT++A++ +   +     + L  ++VTPL+L +  A G +  +I R+T +P 
Sbjct  365  PDEVVAHGATIEASLRADLANFESPKKALNHVNVTPLTLSVALANGSVAEVIHRDTVLPA  424

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
              ++TF+T  DNQ  + +QV+E
Sbjct  425  TATETFTTSQDNQTAIFLQVYE  446

>H257_07650
Length=563

 Score = 346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 195/444 (44%), Positives = 282/444 (64%), Gaps = 6/444 (1%)

Query  11   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  70
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCIVSFASDDVVVGDSAVAKLHNNAAN  62

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            TV+  KR++G+K  +      +K W F L++     P I     G S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKEVHEHDYVKDWSFDLAADTHGAP-IAKILDG-SRDISSVEFCTIVL  120

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
             K++ +AE + G  VKNAV+TVP  ++D Q+   ++A   A ++VLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGVVVKNAVLTVPEGYSDEQKALLEEAATAADLSVLRYISEPIAAAIAYG  180

Query  191  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            LD  KK   + V++ D+GG + D++LLSI++G+F V ATA D  LGGE F N +V+H V 
Sbjct  181  LDEDKKNESKLVVVVDIGGASTDLTLLSIDKGLFNVIATASDHALGGEVFTNSIVEHCVK  240

Query  249  EFKRKHRKDIT-ENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
             F+R+ +  I  +N RAL R++ A E+AK++LS+ +Q  IE+DSL DG D    ++R+RF
Sbjct  241  AFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRF  300

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            EDM  D+ RK  + +  +L  A  +K  +  V+LVGGS+RIPK Q  + DFF+GK+   S
Sbjct  301  EDMVSDHVRKVTKDIAALLDGAGYAKDTIDHVLLVGGSSRIPKAQSAVEDFFDGKKALVS  360

Query  368  INPDEAVAFGATVQAAILSGNds-seklqdlllldvtplslglETAGGVMTTLIARNTTV  426
            I PDEAVAFGATV++A LS     +        ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESATLSETADWTLPTDPHNNVEAVPLTLSLGLADGTVYEMIHRGTVL  420

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            P    + F+T ADNQ  V +QV+E
Sbjct  421  PANVQEVFTTNADNQDAVYLQVYE  444

>PHYKE_64
Length=569

 Score = 345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/442 (41%), Positives = 276/442 (62%), Gaps = 4/442 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A +T+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADSTI  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            +  KRL+G+  +D   +  +K WPF +  GA           GE     P +  +++L  
Sbjct  65   YHLKRLLGKSHADVASRDFVKSWPFDVMEGAKGGAHAETVRNGEKHEVSPVDFMALLLQN  124

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++E+AE F G+ +++ VI+ PA+ ++  ++    A   AG+ VL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGETLEHVVISKPAHADEKHQELLNAAAEKAGVKVLTYLSEPLAAAIAYGLD  184

Query  193  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            +         VL+FD+GG T DV+LL+ ++G+FEV ++ G   LGGEDF N + +H    
Sbjct  185  EAANNPKPEYVLVFDIGGATHDVTLLNADKGLFEVLSSKGKDTLGGEDFTNAVFEHCAKS  244

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F RK + D+  NQ+A  RLR ACE AKRTLS+  Q+ IE+DSL +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRTLSTQTQSNIEVDSLMEGEDFSLKLSRPRFEE  304

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  DY    M+ V+ +L + +L K  +  VVLVGGSTRIP VQ ++   F GK     + 
Sbjct  305  LIIDYVTDIMKEVDAILEENELEKDDIDHVVLVGGSTRIPLVQSMIKKSFEGKTTHLQMP  364

Query  370  PDEAVAFGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  428
            PDE +A+GAT++A+ L+    + E  + + +++V PL+L +  A G ++ LI R T +P 
Sbjct  365  PDEVIAYGATIEASGLAELVDAPEPKKPVNMVNVVPLNLSVALANGSVSELIQRETILPA  424

Query  429  KKSQTFSTYADNQPGVLIQVFE  450
              ++ F+T  DNQ  V +Q++E
Sbjct  425  THTELFTTSEDNQEAVFLQIYE  446

>PYAR_14487
Length=467

 Score = 339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 188/250 (75%), Gaps = 42/250 (17%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MAQ+ T  G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA
Sbjct  1    MAQSVT--GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  58

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120
            KNQVAMNA NT                                     ITV FKGESKTF
Sbjct  59   KNQVAMNAENT-------------------------------------ITVTFKGESKTF  81

Query  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            QPEEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  82   QPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  141

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV---KATAGDTHLGGED  237
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE     AT     L G D
Sbjct  142  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201

Query  238  FDNRLVDHFV  247
               +L D  +
Sbjct  202  QSEKLQDLLL  211

 Score = 105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 75/79 (95%), Gaps = 0/79 (0%)

Query  372  EAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKS  431
            EAVAFGATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  184  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243

Query  432  QTFSTYADNQPGVLIQVFE  450
            QTFSTYADNQPGVLIQVFE
Sbjct  244  QTFSTYADNQPGVLIQVFE  262

>SPRG_15695
Length=581

 Score = 339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 188/443 (42%), Positives = 272/443 (61%), Gaps = 14/443 (3%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA NT
Sbjct  30   IGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAANT  89

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
            V+  KR++G+K SD      IK W F + + A       V  K   +     E +S+VL 
Sbjct  90   VYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKREISATEFASLVLG  149

Query  132  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGL  191
            K++ +AE + G +VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AAAIAYG 
Sbjct  150  KLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAYGF  209

Query  192  D--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
            D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV+H V  
Sbjct  210  DETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALVEHCVKT  269

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F+R+ + D+  N RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D            
Sbjct  270  FERQKKVDLKNNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLI----------  319

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            M GD+ RK +  +E +L +A L K  +  V+L GGSTRIPKVQ  +  FF+GK+   +I 
Sbjct  320  MIGDHVRKMITDIEALLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKKASSTIV  379

Query  370  PDEAVAFGATVQAAILS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            PDE +A+GATV+AA LS      +     L +++  PL+L L  A G +  +I RNT +P
Sbjct  380  PDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVLP  439

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
                + F+T+ DNQ  V +Q++E
Sbjct  440  ATTQEVFTTHVDNQKAVYLQIYE  462

>PHYCA_532207
Length=1118

 Score = 352 bits (902),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 190/444 (43%), Positives = 283/444 (64%), Gaps = 6/444 (1%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GID+GTT+ CVGVW N +V +IANDQG RTTP+YV F   E ++GD A N++  +A NT
Sbjct  552  IGIDIGTTHGCVGVWHNGKVNVIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNT  611

Query  72   VFDAKRLIGRKFSDPIVQSD-IKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
            +F  KRL+G K  D I   D +K WPF ++ GA    Q   +  GE     P E  +++L
Sbjct  612  IFHLKRLLG-KAHDEIKDRDFVKEWPFDVTEGAEGVAQAETKRNGEKHPVTPVEFMTLLL  670

Query  131  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
              ++++AE F G+++++ VI+ PA+ ++   +    A   AG+NVL  ++EP AAAIAYG
Sbjct  671  QNLKDLAEDFTGEKLEHVVISKPAHTDEKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYG  730

Query  191  LDKKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            LD+         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   + +H  
Sbjct  731  LDEAANNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAAVFEHCA  790

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
              F RK + D+  NQ+A  RLR ACE AKRTLS+  QA IE+D+L +G DF   ++R RF
Sbjct  791  KSFLRKTKLDVKTNQKASSRLRIACETAKRTLSTQTQANIEVDTLMEGEDFALKLSRPRF  850

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
            E++  DY  +T+  ++ +L + +L K  +  +VLVGGSTRIP VQ L+  +F GK     
Sbjct  851  EELINDYVHETITEIDAILEENELEKEDIDHIVLVGGSTRIPLVQTLVKKYFEGKTVHTQ  910

Query  368  INPDEAVAFGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTV  426
            ++PDEAVA+GAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +
Sbjct  911  LSPDEAVAYGATIEASGLAELVDVPEPKKPLNMVNVVPLNLSVALANGSVSELIQRDTIL  970

Query  427  PTKKSQTFSTYADNQPGVLIQVFE  450
            P   ++ F+T  DNQ  V +Q++E
Sbjct  971  PATATELFTTSEDNQEAVFLQIYE  994

>PHALS_00390
Length=569

 Score = 337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/443 (42%), Positives = 281/443 (63%), Gaps = 7/443 (2%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KRL+G+   +   ++ +K W F ++  A +   +  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKNHDEIKDRNFVKEWSFSVAQNA-EGVTVETQRNGEKHHVTPVEFMALLLQN  123

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAI-AGMNVLRIINEPTAAAIAYGL  191
            ++E+AE F G+++++ VI+ PA+  DS+     DA A  AG+NVL  ++EP AAAIAYG 
Sbjct  124  LKELAEDFTGEKLEHVVISKPAH-TDSRYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGF  182

Query  192  DKKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            D+         VL+FD+GG T DV+LL++++G+F+V A+ G   LGGE+F   + DH   
Sbjct  183  DEAVNNEKPEYVLVFDIGGATHDVTLLNVDKGLFQVVASKGKDTLGGENFTAAVFDHCAK  242

Query  249  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  308
             F RK + DI  NQ+A  RLR ACE AKR+LS+  Q+ IE+DSL +G DF   ++R RFE
Sbjct  243  AFLRKTKLDIKSNQKASSRLRIACEAAKRSLSTQTQSNIEVDSLMEGEDFALKLSRPRFE  302

Query  309  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  368
            ++  ++  +T+  ++ +L +  L K  +  ++LVGGSTRIP VQ ++  +F GK     +
Sbjct  303  ELISNFVNETITEIDVILEENDLEKDDIDHIILVGGSTRIPLVQNVVKKYFEGKNVRTQL  362

Query  369  NPDEAVAFGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
            +PDEAVAFGAT++A+ L      S+ ++ + ++++ PL+L L  A G +  LI R T +P
Sbjct  363  SPDEAVAFGATIEASCLVELVGVSKPIEPVNMVNMVPLNLSLALANGSVAELIHRETILP  422

Query  428  TKKSQTFSTYADNQPGVLIQVFE  450
               ++ F+T  DNQ  V +Q++E
Sbjct  423  ATVTEIFTTSCDNQETVYLQIYE  445

>PYAR_19930
Length=625

 Score = 338 bits (867),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 236/318 (74%), Gaps = 10/318 (3%)

Query  138  EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGE  197
            E  IG+  K    + P     + RQ+TKDAGAIAG++V RIINEPTAAA+AYGLD   G+
Sbjct  214  ERLIGEAAKIQAASNPT----NTRQSTKDAGAIAGLDVKRIINEPTAAALAYGLDTNAGQ  269

Query  198  R----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRK  253
                 NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ LVD  V+EFKRK
Sbjct  270  SGAGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNLVDFLVTEFKRK  329

Query  254  HRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  312
            ++  D T + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST+TRA+ E +  
Sbjct  330  NKGLDPTGSARAMRRLRTACESAKRMLSTTTSAAVEVDSLFEGVDFSSTLTRAKLESLNE  389

Query  313  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDE  372
            D F++  E V+KVL DAK+    + EVVLVGGSTRIPKVQ LLS  F GKE  KSINPDE
Sbjct  390  DLFKRCEETVQKVLADAKMKPDDITEVVLVGGSTRIPKVQSLLSALFGGKELSKSINPDE  449

Query  373  AVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQ  432
            AVA+GA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P +K++
Sbjct  450  AVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVRKTR  508

Query  433  TFSTYADNQPGVLIQVFE  450
             ++T  D Q  V + ++E
Sbjct  509  VYTTEEDYQTSVDVCIYE  526

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 2/65 (3%)

Query  9    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D ERLIG+AAK Q A 
Sbjct  168  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDQERLIGEAAKIQAAS  227

Query  67   NAHNT  71
            N  NT
Sbjct  228  NPTNT  232

>PHYRA_47873
Length=396

 Score = 327 bits (839),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)

Query  261  NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTME  320
            NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTME
Sbjct  1    NQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTME  60

Query  321  PVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATV  380
            PVEKVLRDAKLSKSQV+EVVLVGGSTRIPKVQQLLS+FFNGKEP KSINPDEAVA+GATV
Sbjct  61   PVEKVLRDAKLSKSQVNEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATV  120

Query  381  QAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADN  440
            QAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK+QTFSTYADN
Sbjct  121  QAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADN  180

Query  441  QPGVLIQVFE  450
            QPGVLIQVFE
Sbjct  181  QPGVLIQVFE  190

>PYVX_17692
Length=551

 Score = 327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 179/441 (41%), Positives = 277/441 (63%), Gaps = 16/441 (4%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GIDLG+T+ CVGVW N +V IIANDQG RTTP++V F   E ++GD A +++  +A +TV
Sbjct  5    GIDLGSTHGCVGVWHNGKVNIIANDQGFRTTPAFVCFEGDEVIVGDTAVHKLPAHADSTV  64

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KR++G+  +D   +  ++ WPF +++G G     T Q  G +    P +  +++L  
Sbjct  65   FHLKRVLGKSQADVASRPFVQDWPFDVAAGEGGAAVATTQKNGAAHQVAPVDFLALLLRN  124

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            +R++A+ F G+ V++ V++VP + +++ R   +DA A A +NVL  I EPT         
Sbjct  125  LRDLAQDFTGETVEHVVLSVPPHADEAHRALIRDAAAAAEVNVLAYIPEPTPEP------  178

Query  193  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKR  252
                 + VL+FD+GG T DV+LL+ ++G+F+V AT GD  LGGEDF + + +H    F+R
Sbjct  179  -----QYVLVFDIGGATHDVTLLTADKGLFDVTATQGDDALGGEDFTSAVFEHCAKAFQR  233

Query  253  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  312
            K + D+  NQ+A  RLR ACE AKR+LS+  Q  IE+DSL +G DF+  ++R RFE++  
Sbjct  234  KTKLDVRGNQKASSRLRLACETAKRSLSTQTQVTIEVDSLLEGEDFSLKLSRPRFEELIN  293

Query  313  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDE  372
            DY +K ++ VE +L   +L K  +  VVL+GGSTRIP VQ  +  FF+GK     ++PDE
Sbjct  294  DYVKKALDEVEALLEAQELDKEDIDHVVLIGGSTRIPLVQSSVKSFFDGKRTHLHLSPDE  353

Query  373  AVAFGATVQAA---ILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  429
             VA GAT++AA    L G    +  +    ++ TPL+L +  A G ++ L+ R+T +P  
Sbjct  354  VVAHGATIEAAGRGDLVG--VPDPKKPANQVNATPLTLSVALANGSVSELVHRDTVLPAS  411

Query  430  KSQTFSTYADNQPGVLIQVFE  450
             ++TF+T AD+Q  V +Q++E
Sbjct  412  ATETFTTSADDQTAVFLQIYE  432

>SDRG_17122
Length=361

 Score = 313 bits (803),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 179/370 (48%), Positives = 247/370 (67%), Gaps = 20/370 (5%)

Query  77   RLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREV  136
            R+IGR++ D + ++       ++  G+ + P I V  KG++K   PEE+ + +++K+++ 
Sbjct  2    RIIGRRY-DEVRKTA------QVVRGSMNNPIIRVIEKGDAKELHPEEVLAELVVKLKDD  54

Query  137  AEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAY----GLD  192
              A+    +++A++TVP  FN  QRQA +DA AIAG+   RI +  T AA+ +    G+ 
Sbjct  55   VAAYTNARIEHAIVTVPTGFNLLQRQAVRDACAIAGLTNYRIKDVSTTAAVGHTSIKGMP  114

Query  193  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKR  252
            ++ G    ++ DLGGG   V LL IE GIFEV+A AG T LGGEDFD+ L DHFV+EF R
Sbjct  115  RREGHD--MVVDLGGGHLSVPLLMIENGIFEVEAVAGITCLGGEDFDDHLYDHFVAEFSR  172

Query  253  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  312
            KHRKD+T   RA+RRLRTACE+ KR LS S  A +E++ LF  IDF S+ITRARFE +C 
Sbjct  173  KHRKDMTTCNRAVRRLRTACEKVKRDLSVSNTATLELEMLFGDIDFCSSITRARFEALCS  232

Query  313  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG----KEPCKSI  368
            + F K  + +EKVLRDAK++KSQV +VVL GGS R+PK+QQLLS FF G    K+ C SI
Sbjct  233  ELFSKVTKLIEKVLRDAKINKSQVRDVVLAGGSMRMPKMQQLLSTFFGGANVDKKLCHSI  292

Query  369  -NPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  427
             N +EA A GATV AA + G   +      L+LD    S+G+ET GGV+T+LI+RNTT+P
Sbjct  293  LNNNEAAAHGATVMAAAVYGE--TWPDSRFLVLDAVSDSVGIETDGGVLTSLISRNTTIP  350

Query  428  TKKSQTFSTY  437
             KKS+ F  +
Sbjct  351  AKKSKKFEIF  360

>PYAR_24704
Length=525

 Score = 319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 171/428 (40%), Positives = 254/428 (59%), Gaps = 11/428 (3%)

Query  28   NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPI  87
            N +V IIANDQG RTTP+YV F   E ++GD A N+V  +A NT+F  KR++G+   D  
Sbjct  1    NGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKVHSHAANTIFHLKRVLGKNHEDVA  60

Query  88   VQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKN  147
                +  W F ++ GA           G      P E  S++L  ++ +AE F G+ V +
Sbjct  61   ASDFVSEWSFDVAKGADGAVVAKTSRNGADHEVTPVEFLSILLKNLKNLAEDFTGETVDS  120

Query  148  AVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD---KKGGERNVLIFD  204
             VI++ A+  ++Q++    A A AG+NVL  ++EP AAAIAYGLD   K       ++ D
Sbjct  121  VVISLSAHGGENQKELISAAAAKAGVNVLSYLSEPLAAAIAYGLDENTKNSHAEYAVVVD  180

Query  205  LGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQRA  264
            +GG T DV+L+SI++G+FE+  T G+  LGGEDF   + +H V  F+RK + ++ +N +A
Sbjct  181  IGGATHDVTLVSIDKGLFEIVGTHGNDSLGGEDFTKAVFEHCVKAFQRKTKLNVKDNAKA  240

Query  265  LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEK  324
              RLR ACE AKRTLS+ +Q  IE+D+L +G DF   ++R RFE++  DY + +++ VEK
Sbjct  241  SSRLRVACEAAKRTLSTQSQVNIEVDTLMEGEDFALKLSRPRFEELIVDYVKTSLKEVEK  300

Query  325  VLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAI  384
            VL DA + KS V  V+L+GGS+RIP VQ  +  FF+GK+    ++PDE VA GAT++AA 
Sbjct  301  VLEDADVDKSDVDHVILIGGSSRIPLVQTSVKKFFDGKKTHMHMSPDEVVAHGATLEAAA  360

Query  385  LS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQP  442
            +S   N    + +   +             G V  T++      PT  ++ F+T ADNQ 
Sbjct  361  ISELANFDPAESEQNNVAVTPLTLSVALANGSVSETVL------PTSATEVFTTSADNQD  414

Query  443  GVLIQVFE  450
             + IQV+E
Sbjct  415  AIFIQVYE  422

>PITG_16528
Length=561

 Score = 311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 196/450 (44%), Positives = 277/450 (62%), Gaps = 15/450 (3%)

Query  12   VGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTER--LIGDAAKN-QV  64
            +GIDLGTT SCVG+W  DR  V+I  N  D+G RTTPS V F    +   +G+ A   + 
Sbjct  23   LGIDLGTTNSCVGMWYVDRNHVKIFKNHLDRG-RTTPSVVRFDPKSQSVAVGNVAVGLET  81

Query  65   AMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKT-FQPE  123
            +    NT+   KRL+G+KF    V     +  ++++  A     + V  +G+ K   QPE
Sbjct  82   SEPVENTIRSVKRLMGQKFDSKAVDVARIYASYEVAPTAQGNVAVQV-VRGQKKVQVQPE  140

Query  124  EISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINE  181
            E+S+ VL +++  A+A+     K  N VITVPAYF+D+QR+AT  + ++AG   +R++NE
Sbjct  141  EVSACVLRELKASADAYFDGHTKLDNVVITVPAYFSDTQRKATIASASMAGFKAVRLLNE  200

Query  182  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            PTAAA+AYGL    G + V +FD GGGT DVSLLSIE+G FEV    GDT+LGGED +N 
Sbjct  201  PTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIEDGKFEVLGIGGDTNLGGEDINNT  259

Query  242  LVDHFVSEFKRKHRKDITE-NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            L+DH +    R+H     +  Q  + RL+   E+AK  LS    A I +  + D   F  
Sbjct  260  LLDHVLDVLYRRHNVTRAQVGQADMVRLKREVEKAKIELSEQEDAEISVHDIADVSTFTY  319

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            T+TR +FE +C   ++K +  V  VLRDA++  S + EV+LVGGSTRIP ++  +S+ FN
Sbjct  320  TLTRRKFEQLCDAIWKKCLRIVSSVLRDAEVEPSDIDEVILVGGSTRIPVLRTKISEAFN  379

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKE C S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M  ++
Sbjct  380  GKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSMEVIL  438

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             RN  +PT  ++ F TY D Q G+ ++V+E
Sbjct  439  LRNARIPTTVTKYFQTYEDEQRGLTVEVYE  468

>CCI47582
Length=582

 Score = 310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/456 (37%), Positives = 264/456 (58%), Gaps = 16/456 (4%)

Query  11   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  70
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHADN  62

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFK--GESKTFQPEEISSM  128
             VF  +RL+G+K+ +      +  W FK+     D+ Q     K  GE       E  ++
Sbjct  63   IVFHLRRLLGKKYEEIAENPHVNEWFFKVEKDGKDEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            +L  ++ +A+ + G  +  AV+T   +  D Q+Q    A   A ++++  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVLTTSIHCTDRQQQLLTQAAKEAQLDIMSYLPDPIAAAIA  182

Query  189  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  238
            YG D       KK  +     +L+ D+GG T  ++LLS+++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPNNYKKANQCQADLILVVDIGGATTAITLLSVDKGLFEIVADGGHEGRGGEDL  242

Query  239  DNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  298
               +VDH    F RK + DI +N++A+ RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAQSFLRKTKVDIHKNRKAMIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  299  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  358
            +  ++R RFE++   + R   E ++KVL +A   K  V  ++LVGGS RIP +Q+ +  +
Sbjct  303  SMKLSRPRFEELIQKHVRFIFEEIDKVLVNADTEKENVDHIILVGGSCRIPLIQEKIQSY  362

Query  359  FNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGV---  415
            F        ++PDE VA GAT++AA L          D L   V   ++ L  + G+   
Sbjct  363  FKDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLDQHVNVNAVPLSLSVGLVHG  422

Query  416  -MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             + TLI R+  +P K ++TF+T+ DNQ  VLI+++E
Sbjct  423  NVHTLIHRDAILPAKMTETFTTWEDNQTEVLIEIYE  458

>PYIW_19165
Length=1124

 Score = 319 bits (818),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 239/375 (64%), Gaps = 3/375 (1%)

Query  13   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  585  GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLTSHAENTI  644

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F  KR++G+   + + +  I+ W FK++              G++    P E  S+++  
Sbjct  645  FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSDDGAVHAATSRNGDAHHVTPVEFVSLLIKN  704

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            ++++AE F G+ V + V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  705  LKDLAEDFTGETVDDVVLSIPAHATEKQKELLQAAADKAGVNVLTFISEPIAAAIAYGLD  764

Query  193  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSE  249
               K     +VL+FD+GG T DV+L++ ++G+FE+ AT+G   LGGEDF   L +H    
Sbjct  765  DSAKGSHPESVLVFDIGGATHDVTLINADQGLFEIVATSGKDDLGGEDFTKALFEHCAKT  824

Query  250  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  309
            F+RK   D+ +N++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  825  FQRKTTLDVKKNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  884

Query  310  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSIN  369
            +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP +Q  +   F+GK     ++
Sbjct  885  LIYDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVMKHFDGKTTHLHLS  944

Query  370  PDEAVAFGATVQAAI  384
            PDE VA GAT++A++
Sbjct  945  PDEVVAHGATIEASL  959

>PYU1_G002895
Length=561

 Score = 306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 198/454 (44%), Positives = 283/454 (62%), Gaps = 18/454 (4%)

Query  9    GYSVGIDLGTTYSCVGVWQNDR--VEII--ANDQGNRTTPSYVAF---TDTERLIGDAAK  61
            G  +GIDLGTT SC+G+W  +R  V+I+  A D+  RTTPS V F   ++    +G AA 
Sbjct  21   GLCIGIDLGTTNSCIGMWHVERNHVKILKSAKDR-KRTTPSVVRFDPASEHAYEVGHAAI  79

Query  62   NQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQ  121
             Q      NTV   KRL+G+K++   V+       + ++S       + V    +    Q
Sbjct  80   AQETQPVGNTVRSIKRLMGQKYASKAVEVAKSFGTYTVASTKQGNAAVQVVRNEKPALLQ  139

Query  122  PEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            PEE+S+ +L  ++  AEA+  GK + N VITVPAYF+DSQR+AT  + ++AG  V+R++N
Sbjct  140  PEEVSACILSDLKASAEAYFDGKRIDNVVITVPAYFSDSQRKATITSASMAGFKVIRLMN  199

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAA+AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N
Sbjct  200  EPTAAAMAYGL-FVAGTKIVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNN  258

Query  241  RLVDHFVSEFKRKH----RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  296
             ++DH +SE   KH    R  +T N   + +L+T  ERAK  LS+   A I +  +    
Sbjct  259  VIIDH-LSELLHKHHDVARSRLTMND--MIQLKTQAERAKIELSNEDTAKIRLRDVAGIP  315

Query  297  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  356
             F  T+TR +FE +C   ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +S
Sbjct  316  AFEYTLTRHKFEQLCESIWKKCLRIVSSVLKEAEVEVADVDEVVMVGGSTRIPILRSKIS  375

Query  357  DFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  416
            DFFNGKE C S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M
Sbjct  376  DFFNGKELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETADGRM  434

Query  417  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
              +I +N  +P   ++ F T+ DNQ G+ I+V+E
Sbjct  435  EVIIPKNARIPVSLTKYFQTFEDNQRGLTIEVYE  468

>PHYSO_493381
Length=562

 Score = 306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 195/453 (43%), Positives = 277/453 (61%), Gaps = 18/453 (4%)

Query  11   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERL--IGDAA-KNQ  63
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  T +   +G+AA + +
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVRFEPTTQRADVGNAAVQLE  80

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKT-FQP  122
                  NTV   KRL+G+KF          +  +K+ S A     + V   G+ K   QP
Sbjct  81   TQEPVGNTVRSVKRLMGQKFESKAADVARIYATYKVVSTAQGNAAVQVARGGQKKVHVQP  140

Query  123  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            EE+S+ VL +++  AEA+    VK  N VITVPAYF+DSQR+AT  + ++AG   +R++N
Sbjct  141  EEVSACVLAELKASAEAYFDGSVKLDNVVITVPAYFSDSQRKATITSASMAGFKAVRLLN  200

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +N
Sbjct  201  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDINN  259

Query  241  RLVDHFVSEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  297
             LVDH +    + H  D+   Q     + RL+   E+AK  LS+   A IE+  +     
Sbjct  260  ILVDHLLEVLYKHH--DVARAQVGEGDMVRLKREVEKAKIELSAEDYAEIELQGIAGVKT  317

Query  298  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  357
            F  T+ R +FE +C   ++K +  V  VL++A++    + EV+LVGGSTRIP ++  +S+
Sbjct  318  FTYTLMRRKFEQLCDPIWKKCLRIVTSVLKEAEVEAVDIDEVILVGGSTRIPILRTKISE  377

Query  358  FFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  417
             F GKE C S+N DE V  GA +QAAILSG       +D+L++D  PL +GLETA G M 
Sbjct  378  AFGGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDALPLPIGLETADGSME  436

Query  418  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             ++ RN  +PT  ++ F T+ D+Q G+ ++V+E
Sbjct  437  VILPRNARIPTTVTKYFQTFEDDQLGLTVEVYE  469

>PHYCA_6458
Length=560

 Score = 305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 194/454 (43%), Positives = 277/454 (61%), Gaps = 21/454 (5%)

Query  11   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLI--GDAAKN-Q  63
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + +  G+ A   +
Sbjct  21   CLGIDLGTTNSCVGMWHVDRHHVKILKNRLDRG-RTTPSVVRFNPQSQSVDVGNVAIGLE  79

Query  64   VAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQF-KGESKT-FQ  121
             +    NT+   KRL+G+KF+     +D+             +  +  Q  +G+ K   Q
Sbjct  80   TSEPVGNTIRSVKRLMGQKFASK--ATDVARIYASYEVAPTPQGNVAAQVVRGQKKVQVQ  137

Query  122  PEEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGMNVLRII  179
            PEE+S+ +L +++  AE +   +VK  N VITVPAYF+DSQR+AT  A ++AG   +R++
Sbjct  138  PEEVSACILTELKASAEGYFDGQVKLDNVVITVPAYFSDSQRKATITAASMAGFKAVRLL  197

Query  180  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  239
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  198  NEPTAAAMAYGL-FLSGTKMVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDIN  256

Query  240  NRLVDHFVSEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  296
            N LVDH +    + H+  +T  Q     + RL+ A E+AK  LS      I +  +    
Sbjct  257  NVLVDHLLEVLYKHHK--VTRAQVGEADMVRLKRAVEKAKIELSEEEDVEITVHDIAGVE  314

Query  297  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  356
             F  T+TR +FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP ++  +S
Sbjct  315  KFAFTLTRRKFEQLCDPIWKKCLRIVSSVLKEAQVEAADIDEVILVGGSTRIPILRTKIS  374

Query  357  DFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  416
            D FNGKE C S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M
Sbjct  375  DAFNGKELCLSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETADGTM  433

Query  417  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
              ++ RN  +PT  ++ F TY D Q G+ ++V+E
Sbjct  434  EVILPRNARIPTTVTKYFQTYEDGQRGLTVEVYE  467

>PHYRA_79054
Length=563

 Score = 304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 190/454 (42%), Positives = 277/454 (61%), Gaps = 20/454 (4%)

Query  11   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F D      D     VA+
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRSDRG-RTTPSVVRF-DPSSQAADVGNAAVAL  79

Query  67   NAH----NTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKT-FQ  121
                   NT+   KRL+G+KF          +  +++   A     + V   G+     Q
Sbjct  80   ETCEPLGNTIRSVKRLMGQKFDSKAADVARIYAGYRVLPTAQGNVAVQVLRGGKRDIQVQ  139

Query  122  PEEISSMVLIKMREVAEAFI--GKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRII  179
            PEE+S+ VLI+++  AEA+   G+ ++N VITVPAYF+DSQR+AT  + ++AG   +R++
Sbjct  140  PEEVSACVLIELKASAEAYFEDGRRLENVVITVPAYFSDSQRKATITSASMAGFKAVRLL  199

Query  180  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  239
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  200  NEPTAAAMAYGL-FLSGRKVVTVFDFGGGTLDVSLLSIDDGKFEVLGIGGDTNLGGEDIN  258

Query  240  NRLVDHFVSEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  296
            N L DH +    + H  D+T  Q     + RL+   E+AK  LS+   A + +  +    
Sbjct  259  NTLCDHLLEVLYKHH--DVTRAQVGDVDMVRLKREVEKAKIELSTEEYADVTVHGIAGVK  316

Query  297  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  356
             F  ++ R++FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP ++  +S
Sbjct  317  TFTYSLLRSKFEQLCDPIWKKCLRIVSSVLKEAEMEAADIDEVILVGGSTRIPILRTKIS  376

Query  357  DFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  416
            + FNGKE C S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M
Sbjct  377  EAFNGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSM  435

Query  417  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
              ++ RN  +PT  ++ F T+ D+Q G+ ++V+E
Sbjct  436  EVILPRNARIPTTVTKNFQTFEDDQRGLTVEVYE  469

>PPTG_05819
Length=561

 Score = 302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 190/452 (42%), Positives = 277/452 (61%), Gaps = 17/452 (4%)

Query  11   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + + D     V +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKILKNSLDRG-RTTPSVVRFDPKSQSV-DVGNVAVGL  79

Query  67   NAH----NTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKT-FQ  121
                   NT+   KRL+G++F +  V     +  ++++  A     + V  +G  K   Q
Sbjct  80   ETSEPVGNTIRSVKRLMGQRFENKAVDVARIYASYEVAPTAQGNVAVQV-VRGHKKVQVQ  138

Query  122  PEEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGMNVLRII  179
            PEE+S+ VL +++  AEA+   + K  N VITVPAYF+D+QR+AT  + ++AG   +R++
Sbjct  139  PEEVSACVLRELKASAEAYFDGQTKLDNVVITVPAYFSDAQRRATITSASMAGFKAVRLL  198

Query  180  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  239
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  199  NEPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDIN  257

Query  240  NRLVDHFVSEFKRKHRKDITE-NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  298
            N L+DH +    ++H     +  Q  + R++   E+AK  LS    A I +  +     F
Sbjct  258  NTLLDHLLDVLYKRHNVTRAQVEQGDMVRVKREVEKAKIELSEQESADITVYEIAGVSTF  317

Query  299  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  358
              T+TR +FE +C   ++K +  V  VL+ A++  + + EV+LVGGSTRIP ++  +S+ 
Sbjct  318  KYTLTRRKFEQLCDPIWKKCLRIVASVLKHAEVDAADIDEVILVGGSTRIPVLRTKISEA  377

Query  359  FNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  418
            FNGKE CKS+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M  
Sbjct  378  FNGKELCKSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGTMEV  436

Query  419  LIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ++ RN  +PT  ++ F TY D+Q G+ ++V+E
Sbjct  437  ILPRNARIPTTVTKYFQTYEDDQRGLTVEVYE  468

>CCA20229
Length=583

 Score = 301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/456 (37%), Positives = 261/456 (57%), Gaps = 16/456 (4%)

Query  11   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  70
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHAEN  62

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFK--GESKTFQPEEISSM  128
             VF   RL+G+   +    + +  W FK+   + ++ Q     K  GE       E  ++
Sbjct  63   IVFHLGRLLGKSHEEVAENAHVNEWFFKVEKDSKNEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            +L  ++ +A+ + G  +  AVI+   +    Q+Q    A   A +NV+  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVISTSIHCTTEQKQVLAQAAKDAELNVMSYLPDPIAAAIA  182

Query  189  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  238
            YG D       KK  +     +L+ D+GG T  V+LL++++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPKNYKKANQSTAQLILVVDIGGATTAVTLLNVDKGLFEIVADGGSEFRGGEDL  242

Query  239  DNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  298
               +VDH    F RK +  I  N++A  RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAKSFLRKTKVAIQNNRKATIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  299  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  358
            +  ++R RFE++  D+ R   E ++ VL  A + K  V  V+LVGGS RIP +Q+ +  +
Sbjct  303  SMKLSRPRFEELIQDHVRFIFEEIDAVLEKADVDKENVDHVILVGGSCRIPLIQEKIQTY  362

Query  359  FNGKEPCKSINPDEAVAFGATVQAA----ILSGNdsseklqdlllldvtplslglETAGG  414
            F        ++PDE VA GAT++AA    +L      + L+    ++  PLSL +  A G
Sbjct  363  FGDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLEQHANVNAVPLSLSVGLAHG  422

Query  415  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             + TLI R+  +P K  +TF+T+ DNQ   LI+++E
Sbjct  423  NVHTLIHRDVVLPAKMMETFTTWEDNQTEALIEIYE  458

>PYAR_14579
Length=567

 Score = 298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 191/454 (42%), Positives = 279/454 (61%), Gaps = 18/454 (4%)

Query  12   VGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTERLIGDAAKNQVA  65
            +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  +  E L+G+AA  +  
Sbjct  23   IGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVHFLPSSHEVLVGNAAIAREY  81

Query  66   MNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESK-TFQPEE  124
                NTV   KRL+G++F    VQ   K     + + A     + VQ  G+     QPEE
Sbjct  82   EPPGNTVRAIKRLMGQRFDSRAVQLASKFATHSIVATAQGNAAVQVQRGGDGVIAVQPEE  141

Query  125  ISSMVLIKMREVAEAFI----GKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            I++ VL +++  AEA+      K + N VITVPAYFNDSQR+AT  +  +AG   +R++N
Sbjct  142  IAAEVLRELKASAEAYWEQTHSKRIDNVVITVPAYFNDSQRKATILSAQMAGFKAVRLLN  201

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAA+AYGL    GE++V++ D GGGT DVSLL+I +G F+V    GDT+LGGED ++
Sbjct  202  EPTAAAMAYGL-FVSGEKHVVVVDFGGGTLDVSLLAIHDGKFQVLGIGGDTNLGGEDIND  260

Query  241  RLVDHFVSEFKRKHRKDITENQRA-LRRLRTACERAKRTLSSSAQAYIEIDSL---FDGI  296
             ++ H +   +R+     +   R+ L +++   ERAK  LS+     +E+ +L       
Sbjct  261  LVMAHVLENLQRQRSVPRSALSRSDLIQIKREVERAKVALSTDESVELELPNLGPLAKQK  320

Query  297  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  356
             F   +TR +FE +CG  + + ++ VE VLR+A +   ++ EV++VGGSTRIP V+  +S
Sbjct  321  PFTLVLTRTKFESLCGSIWTRCLDIVEDVLREAGVETHEIDEVIMVGGSTRIPIVRSKVS  380

Query  357  DFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  416
             FF+ KE C S+N DE V  GA +QAAILSG       +D+L++DV PL +GLE A G M
Sbjct  381  AFFHDKELCVSVNADEVVCEGAAIQAAILSG-IDKRVFRDVLMMDVIPLPIGLEKADGRM  439

Query  417  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
              L+A+N+ +P   ++ F T+ D Q G+ +QV+E
Sbjct  440  EVLLAKNSRIPVSVTKYFETFEDGQRGLTVQVYE  473

>PYIW_17320
Length=563

 Score = 294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 184/447 (41%), Positives = 274/447 (61%), Gaps = 10/447 (2%)

Query  12   VGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAF---TDTERLIGDAAKNQVA  65
            +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS V F   ++    +G AA  Q  
Sbjct  24   IGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPSVVRFDPQSEHAYEVGHAAIAQET  83

Query  66   MNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEI  125
                NT+   KRL+G+K++   V+       + +++       + V    ++   QPEE+
Sbjct  84   QPVGNTIRSVKRLMGQKYTSKAVEVAKSFGTYTITATKQGGAAVQVVRANKTAVVQPEEV  143

Query  126  SSMVLIKMREVAEAFIG-KEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTA  184
            ++ +L  ++  AEA+   K + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPTA
Sbjct  144  AACILADLKASAEAYFDDKRIDNVVITVPAYFNDSQRKATLTSASMAGFKAVRLLNEPTA  203

Query  185  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  244
            AA+AYGL    G + V++FD GGGT DVSL+SI +G FEV    GDT+LGGED +N + D
Sbjct  204  AAMAYGL-FVAGTKMVVVFDFGGGTLDVSLMSISDGRFEVLGIGGDTNLGGEDLNNAITD  262

Query  245  HFVSEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  303
            H +    + H     T   + + +L+T  E+AK  LSS     IE+  +     F  T+T
Sbjct  263  HLIELLHKHHDVSRATLTMQDMIQLKTQAEQAKIALSSDDSTEIELRDVAGIAKFKYTLT  322

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            R +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +SDFF+GKE
Sbjct  323  RHKFEQLGEAIWKKCLRIVHSVLKEAEVEVADVDEVVMVGGSTRIPLLRTKVSDFFDGKE  382

Query  364  PCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  423
             C S+N DE V  GA +QAAILSG       +D+L++DV PL +GLET  G M T+I +N
Sbjct  383  LCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGRMETIIPKN  441

Query  424  TTVPTKKSQTFSTYADNQPGVLIQVFE  450
            + +P   ++ F T+ DNQ G+ ++V+E
Sbjct  442  SRIPVSLTKYFQTFEDNQRGLTVEVYE  468

>PHYRA_47865
Length=381

 Score = 286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 168/170 (99%), Gaps = 0/170 (0%)

Query  281  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  340
            SSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTMEPVEKVLRDAKLSKSQV+EVV
Sbjct  2    SSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTMEPVEKVLRDAKLSKSQVNEVV  61

Query  341  LVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdllll  400
            LVGGSTRIPKVQQLLS+FFNGKEP KSINPDEAVA+GATVQAAIL GNDSS+KLQDLLLL
Sbjct  62   LVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLL  121

Query  401  dvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            DVTPLSLGLETAGGVMTTLIARNTTVPTKK+QTFSTYADNQPGVLIQVFE
Sbjct  122  DVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFE  171

>PYIR_13638
Length=543

 Score = 290 bits (743),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 178/446 (40%), Positives = 270/446 (61%), Gaps = 28/446 (6%)

Query  12   VGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAFTDTERLIGDAAKNQVAMNA  68
            +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS     +T  +             
Sbjct  24   IGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPS----VETAPV-------------  66

Query  69   HNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSM  128
             NT+   KRL+G+K++    +       +K+++       + V    +  T +PEE+S+ 
Sbjct  67   GNTIRSIKRLMGQKYTSKAAEVAKSFGTYKIAATKQGSAAVQVVRAQKLVTVEPEEVSAC  126

Query  129  VLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            +L  ++  AE +   K + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPTAAA+
Sbjct  127  ILSDLKASAEVYFDNKRIDNVVITVPAYFNDSQRKATITSASMAGFKAIRLMNEPTAAAM  186

Query  188  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
            AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N + DH +
Sbjct  187  AYGL-FVAGTKMVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNNVITDHLI  245

Query  248  SEFKRKHRKDITENQRALR---RLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  304
                + H  D+   + ++    +L+T  E+AK  LSS   A IE+  +     F  T+TR
Sbjct  246  ELLHKHH--DVPRAKLSMADMIQLKTQAEQAKIALSSDDSAEIELHDVAGVPKFKYTLTR  303

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
             +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +S+FF+GKE 
Sbjct  304  HKFEQLGESIWKKCLRIVSSVLKEAEVEIADVDEVVMVGGSTRIPILRTKISEFFDGKEL  363

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
            C S+N DE V  GA +QAAILSG       +D+L++DV PL +GLET  G M  +I +N+
Sbjct  364  CMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGTMEVIIPKNS  422

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
             +P   ++ F T+ DNQ G+ ++V+E
Sbjct  423  RIPVSLTKYFQTFEDNQRGLTVEVYE  448

>PHALS_02692
Length=557

 Score = 290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 186/453 (41%), Positives = 274/453 (60%), Gaps = 19/453 (4%)

Query  11   SVGIDLGTTYSCVGVWQNDR--VEIIANDQGN-RTTPSYVAFTDTERLI--GDAAKN-QV  64
             +GIDLGTT SCVG+W  DR  V+I  N     RTTPS V F  T + +  G AA + + 
Sbjct  18   CLGIDLGTTNSCVGMWYVDRNHVKIFKNRLNRGRTTPSVVHFDPTSQSVDVGQAAIDLET  77

Query  65   AMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQF-KGESKT-FQP  122
            +    NT+   KRL+G+K+          +  ++++  A  +  + VQ  +G  K   QP
Sbjct  78   SEPVGNTIRSIKRLMGQKYESKATDVARIYASYEVAPTA--QKNVAVQLVRGHKKVQVQP  135

Query  123  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180
            EE+S+ +L +++  AEA+   + +  N VITVPAYF+D+QR+AT  +  +AG   +R++N
Sbjct  136  EEVSAYILTELKTSAEAYFDGQTRLNNVVITVPAYFSDAQRKATITSALMAGFKAVRLLN  195

Query  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240
            EPTAAA+AYGL    G + V +FD GGGT DVSLL I++G FEV    GDT+LGGED +N
Sbjct  196  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLRIQDGKFEVLGIGGDTNLGGEDINN  254

Query  241  RLVDHFVSEFKRKH---RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  297
             ++DH +    ++H   R  +T     L RL+   E+ K  LS    A + +  L     
Sbjct  255  LVLDHVLEVLNKRHNVIRSQVTGAD--LVRLKQEVEKLKIQLSVEESADVIVRDLAGVPR  312

Query  298  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  357
               T+TR +FE +C   ++K +  +  VL++A++  + + EV+LVGGSTRIP ++  +S 
Sbjct  313  VTVTLTRRKFEQLCDPIWKKCLRIMSSVLKEAQVDAADMDEVILVGGSTRIPCLRSKISK  372

Query  358  FFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  417
             F+GKE C S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  373  AFHGKELCMSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETADGTME  431

Query  418  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             ++ RN  +PT  ++ F+TY DNQ G+ I+V+E
Sbjct  432  VILPRNARIPTTVTKYFTTYEDNQRGITIEVYE  464

>PYAR_24687
Length=618

 Score = 291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 172/449 (38%), Positives = 263/449 (59%), Gaps = 9/449 (2%)

Query  7    STGYSVGIDLGTTYSCVGVWQND--RVEIIANDQGNRTTPSYVAFTDT--ERLIGDAAKN  62
            S  + + ID GT+ +   V +N   +VEII ND+G+  TP+YV +     E ++G  AK 
Sbjct  35   SAHHMIAIDFGTSNTRAAVVRNTTGQVEIIPNDKGHSATPTYVTWDSVTGEVIVGRDAKQ  94

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
            Q  +   NT FD K+L+GR F    VQS I   P+ +     +KP I V+ KGE++ F  
Sbjct  95   QALLQPKNTAFDFKQLLGRSFDSKEVQSAIAQLPYTIID-RDNKPFIQVEMKGETREFSV  153

Query  123  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEP  182
            EE+++MVL +M++ AEA++G+E++NAV+TVPA F D+QR+A K A A+AG+   R++NEP
Sbjct  154  EEVTAMVLTRMKQFAEAYLGEEIENAVVTVPASFEDAQREAMKAACAMAGLTTRRVLNEP  213

Query  183  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            TAA + +G+  K   ER VL+    GG  D +LL I+EGI EV  T   +H  G++   R
Sbjct  214  TAATMGFGIKPKTQHERKVLVVHFDGGALDATLLEIDEGIVEVLVT--KSHRIGDEVTQR  271

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  301
            ++DH +S++K     DI+ + R L+RLR   ER +  LS   +A + I+S         +
Sbjct  272  VMDHCISQWKYDKHVDISTDPRMLQRLRLEAERVQHALSEQTEAVVTIESSSGSAVLTQS  331

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
             +RA  E M  D     +E VE  L +  ++K +V  +V  GG++RIP ++QL+ + F  
Sbjct  332  FSRATLETMTRDLAEPLVEIVEIALMNGGVAKQEVDGIVFAGGASRIPMLRQLMVERFGW  391

Query  362  KEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  421
             E    ++ +E V  GA   A I+ G  + +   +L +L     SLG+ETAGGVM  +++
Sbjct  392  IELQCDVDEEEVVVHGAAAIADIIHGQ-AVDATAELNILPWIVNSLGVETAGGVMLPVLS  450

Query  422  RNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            R+   PT+ +QT ST   NQ  + I+VFE
Sbjct  451  RHRLTPTRATQTVSTLHANQLDITIRVFE  479

>SPRG_01255
Length=566

 Score = 287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 183/448 (41%), Positives = 267/448 (60%), Gaps = 14/448 (3%)

Query  11   SVGIDLGTTYSCVGVWQ--NDRVEII---ANDQGNRTTPSYVAFTDT-ERLIGDAAKNQV  64
             +GIDLGTT SCVG W+   + V+I+   A D   +T PS V+F  T    +G AA    
Sbjct  24   CIGIDLGTTNSCVGYWKLHANHVKIVNHSAGDTKAKTLPSVVSFPPTGAPAVGFAAVAAE  83

Query  65   AMNAHN-TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
            A +A   TV  AKRL+G+  +D     D K+  + L  G  +   +++       +  P 
Sbjct  84   ASDADVVTVRSAKRLLGQSLAD--ASPDQKYLSYTLCDG--ESGHVSIALPARKTSVTPS  139

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            E+++++L K++  AEA + + + N V+TVPAYF + QRQAT +A A+AG + +R++NEPT
Sbjct  140  EVAALLLSKLKAAAEAKLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPT  199

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAA+AYGL   G +R V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N L 
Sbjct  200  AAAMAYGLFVAGTKR-VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNILF  258

Query  244  DHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  302
            DH +    +KH    +      + +L+ A E AK  LS+  +  + + ++        T+
Sbjct  259  DHVLQAIAKKHGPVSLPLATHDMVQLQRAVEAAKVALSTDDETVLRLTNVGHVALHEMTL  318

Query  303  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  362
            TR + + +C   ++K +    +VL+   +  S V EVVLVGGSTRIP ++  L  FFN K
Sbjct  319  TRRKLDALCDPLYKKCLRITREVLKSIDVDPSDVDEVVLVGGSTRIPAIRARLRAFFNDK  378

Query  363  EPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  422
            E C S+N DE VA GA +QAAILSG    +  QD+L+LDV P+S+G+E A G M  LI +
Sbjct  379  ELCTSVNADEVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIQK  437

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            N+ +P   ++ F T  D+Q G  I+VFE
Sbjct  438  NSRIPVSVTKYFDTAIDDQAGFTIEVFE  465

>CCI45261
Length=558

 Score = 286 bits (731),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 177/453 (39%), Positives = 281/453 (62%), Gaps = 21/453 (5%)

Query  11   SVGIDLGTTYSCVGVWQND--RVEIIANDQGNR---TTPSYVAFTDTERLIGDAAKNQVA  65
            ++GID GTT SCVG+W  D  RV+I+ +D   +     PS V +  T+  +    +  V 
Sbjct  24   AIGIDFGTTNSCVGIWLKDQSRVKILKHDFDTKRYYLLPSVVRYDPTDVSLVSVGQEAVR  83

Query  66   MNA----HNTVFDAKRLIGRKFSD---PIVQSDIKHWPFKLSSGAGDKPQITVQFKGESK  118
            + A     NT+   KRL+G+++++     +QS   H    +S+  G+     +  K +  
Sbjct  84   LEATPPCKNTIRCVKRLMGQRYTNDRISYLQSSSTHQI--VSTKRGNVGICIITEKNDES  141

Query  119  TFQPEEISSMVLIKMREVAEAFIG-KEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLR  177
              +PE++++ +L+K++  AEA+   K ++N V+TVPA+FND QR+AT  A ++AG   +R
Sbjct  142  IVEPEQVAACILLKLKAKAEAYFDHKIIENVVLTVPAHFNDGQRKATIRAASMAGFRKIR  201

Query  178  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGED  237
            ++NEPTAAA+AYGL    G + VL+FD GGGT DVSL+ I+EG F+V A  GDT+LGGED
Sbjct  202  LMNEPTAAAMAYGL-FIAGHKQVLVFDFGGGTLDVSLMRIDEGKFKVVAIGGDTNLGGED  260

Query  238  FDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  297
             +  +  H +  F+++    +T +Q+    ++ + E AK  LS S +A +E+      + 
Sbjct  261  INQIIYHHILCSFEKRGILKLTIDQQTA--MKQSIEEAKIQLSDSMEATVELKVATRLLQ  318

Query  298  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  357
            +N  + R  FE +C   +++ +  +EKVL+DA L    V EVV+VGGSTRIPK++  +S+
Sbjct  319  YN--LRRDVFESICDSVWKRCISTIEKVLKDASLEPCDVDEVVMVGGSTRIPKLRSSISE  376

Query  358  FFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  417
            FF+ KE C S+N D  V  GA +QAA+LSG    + LQD+L+LDV PLS+GLET  G M 
Sbjct  377  FFDKKELCDSVNADRVVCEGAAIQAAVLSG-MDRKTLQDVLMLDVIPLSMGLETVDGRME  435

Query  418  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             ++++N+ +P + ++ F T+ D+Q G+ + V+E
Sbjct  436  IILSKNSQIPAEVTKYFQTFEDDQRGISVDVYE  468

>H310_03911
Length=570

 Score = 284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 181/448 (40%), Positives = 268/448 (60%), Gaps = 16/448 (4%)

Query  12   VGIDLGTTYSCVGVWQNDR-----VEIIANDQGNRTTPSYVAFT-DTERLIG-DAAKNQV  64
            +GIDLGTT SCVG W+        V  +  D  ++T PS V+F       +G DA +++ 
Sbjct  22   IGIDLGTTNSCVGYWKEGANFAKIVNHVGKDGKHKTVPSVVSFPPQGNPFVGFDAVEHEQ  81

Query  65   AMNAHN-TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
             +     T+  AKRL+G+  ++  V  + K+  + L     D   + +    +     P 
Sbjct  82   KLEPDTVTIRSAKRLMGKTLAE--VGDEQKYLSYSLCD---DGDHVAIDLPSKKTVVAPS  136

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            E+S+++L  +++  E  +G +V N V+TVPA+FN+SQRQAT  A A+AG   +R++NEPT
Sbjct  137  EVSAILLKYIKDTTEEKLGHQVVNCVLTVPAHFNESQRQATLKAAAMAGFQGIRLLNEPT  196

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    G+THLGGED ++ L 
Sbjct  197  AAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGKFAVDGVGGNTHLGGEDINHVLY  255

Query  244  DHFVSEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  302
            D+ +   + ++    +T ++ A+ +L+ A E AK TLSS  +  I +D +         +
Sbjct  256  DYMLESIQNQNGGTPLTLDRTAIIQLQQAAEHAKVTLSSQKEVSIYLDDIGGVKSHKLKL  315

Query  303  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  362
            TR++FE +C     + ++    VL    L+ + + EVVLVGGSTRIP ++  LS  FNGK
Sbjct  316  TRSKFESLCDPLLTRCIDITLNVLASIDLTPNDIDEVVLVGGSTRIPALRNKLSALFNGK  375

Query  363  EPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  422
            E C S+N DE VA GA +QAAILSG  +   LQD+L+LDV PLS+G+E A G M  LI +
Sbjct  376  EMCTSMNADEVVASGAAIQAAILSG-VNKRVLQDVLMLDVIPLSIGIEKADGTMEVLIPK  434

Query  423  NTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            N+ +P   ++ F T  D+Q G+ ++VFE
Sbjct  435  NSRIPIAVTKHFETLDDDQRGITVEVFE  462

>PHYRA_51904
Length=129

 Score = 267 bits (682),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 128/128 (100%), Gaps = 0/128 (0%)

Query  7    STGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  66
            ++GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61

Query  67   NAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEIS  126
            NAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFKL+SGAGDKPQITVQFKGESKTFQPEEIS
Sbjct  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121

Query  127  SMVLIKMR  134
            SMVLIKMR
Sbjct  122  SMVLIKMR  129

>PYVX_13615
Length=585

 Score = 281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 189/475 (40%), Positives = 281/475 (59%), Gaps = 41/475 (9%)

Query  12   VGIDLGTTYSC---VGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTERLIG-DAAK  61
            VGIDLGTT SC   VG+W+ +R  V+I+ N  D+G RTTPS V F     + L+G +A  
Sbjct  22   VGIDLGTTNSCATRVGIWKTERNHVKILKNRRDRG-RTTPSVVRFGPESDQVLVGNEAIA  80

Query  62   NQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKG-ESKTF  120
            +++     NTV   KRL+G+ F    V+   K   FKL         I++   G ++ T 
Sbjct  81   HELEDPVGNTVRAVKRLMGQPFESKAVEVATKFAAFKLEPTKQGNTAISIDRSGSKTDTV  140

Query  121  QPEEISSMVLIKMREVAEAFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRII  179
             PE++S+ VL +++  AEA+   E + + VITVPAYFNDSQR+AT +A   AG + +R++
Sbjct  141  LPEDVSAAVLSELKASAEAYYQDESIDHVVITVPAYFNDSQRRATLEAATSAGFSAVRLL  200

Query  180  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  239
            NEPTAAA+AYGL    G + V++FD GGGT DVSL+ I++G FEV    GDT+LGGED +
Sbjct  201  NEPTAAAMAYGL-FLAGTKLVVVFDFGGGTLDVSLMQIQDGKFEVLGIGGDTNLGGEDIN  259

Query  240  NRLVDHFVSEFKRK---HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEI-DSLFDG  295
            + L+DH +  F +    HR+ +      + +L+   E+AK  LS+   A +E+  +    
Sbjct  260  HLLLDHVLEMFDKHFGVHREQLRPED--MVKLKREVEKAKIELSTEESAVVELRGAAGSS  317

Query  296  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  355
                 T+ R +FE +C   +++ +  V  VL++A+   +++ EV+LVGGSTRIP V+  L
Sbjct  318  KTMTVTLHRRKFELLCESIWKRCLRIVSNVLKEAEADVTEIDEVILVGGSTRIPVVRSRL  377

Query  356  SDFFNGK--------------------EPCKSINPDEAVAFGATVQAAILSGNdsseklq  395
            S+FFN K                    E C S+N DE V  GA +QAAILSG    +  +
Sbjct  378  SEFFNDKWMVCLTVRIRSTNGVSGVEQELCMSVNADEVVCEGAAIQAAILSG-MDHKVFR  436

Query  396  dlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            D+L++DV PL +GLETA G M  L+ +N+ +P   ++ F T+ D Q G+ ++V+E
Sbjct  437  DVLMMDVIPLPIGLETADGAMEVLLPKNSRIPVSLTKYFETFEDGQRGLTVEVYE  491

>H257_01680
Length=571

 Score = 279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 178/451 (39%), Positives = 264/451 (59%), Gaps = 19/451 (4%)

Query  12   VGIDLGTTYSCVGVWQN--DRVEII---ANDQGNRTTPSYVAF-TDTERLIG-DAAKNQV  64
            +GIDLGTT SCVG W+   +  +II   A D  ++T PS V+F +     +G DA +++ 
Sbjct  22   IGIDLGTTNSCVGYWKEGANHAKIINHTATDGKHKTVPSVVSFPSQGNPFVGFDAVEHEQ  81

Query  65   AMNAHN-TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPE  123
                   T+  AKRL+G+  ++  +  + K+  + L    G    + +    +     P 
Sbjct  82   KYEPDTVTIRSAKRLMGKTLAE--MADEQKYLSYTLCDADG---HVAIDLPSKESIATPS  136

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            E+S+++L  +++ AE  +G +V N V+TVPAYFN+SQRQ+T  A  +AG   +R++NEPT
Sbjct  137  EVSAILLKYIKDTAEDKLGHQVFNCVLTVPAYFNESQRQSTLKAATMAGFQGIRLLNEPT  196

Query  184  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            AAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    GDTHLGGED ++ LV
Sbjct  197  AAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGTFAVDGVGGDTHLGGEDINHLLV  255

Query  244  DHFVSEFKRKHRK----DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  299
            D  +    ++        +   + A+ +L+ A E AK TLS+     I +  +       
Sbjct  256  DFMLDSISQEQNGGKPLPLPLTRTAIIQLQQAAEHAKVTLSTQKDVSIYLKDVGGIKAHK  315

Query  300  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  359
              ++RA+ E +C     + ++    VL    L+   + EVVLVGGSTRIP ++  LSD F
Sbjct  316  MKLSRAKLESLCAPLLTRCVDITRDVLASIGLTPQDIDEVVLVGGSTRIPALRTKLSDLF  375

Query  360  NGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL  419
            +GK  C S+N DE VA GA +QAAILSG       QD+L++DV PLS+G+E A G M  L
Sbjct  376  DGKVLCTSVNADEVVASGAAIQAAILSG-VDKRVFQDVLMMDVIPLSIGIEMADGRMEVL  434

Query  420  IARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            I +N+ +P   +++F TY D+Q G+ ++VFE
Sbjct  435  IPKNSRIPISVTKSFDTYEDHQKGITVEVFE  465

>HYAP_01857
Length=492

 Score = 271 bits (693),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 173/415 (42%), Positives = 247/415 (60%), Gaps = 13/415 (3%)

Query  44   PSYVAFTDTERLI--GDAA-KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLS  100
            PS V F    + +  GDAA + +      NT+   KRL+G+KF    V     +  + + 
Sbjct  2    PSVVHFDPQSQHVDVGDAAVEFETEPPVGNTIRSIKRLLGQKFVSKAVDVARIYASYSVV  61

Query  101  SGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKE--VKNAVITVPAYFND  158
              A     + V   G+    QPEE+ + VL +++  AEA+   +  + N VITVPAYF+D
Sbjct  62   PTAQGNVVLQVVRGGKRVQVQPEEVVASVLAELKASAEAYFDGQLSIDNVVITVPAYFSD  121

Query  159  SQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIE  218
            SQR+AT  + ++AG   +R++NEPTAAA+AYGL    G++ V +FD GGGT DVSLL IE
Sbjct  122  SQRKATLTSASMAGFKAVRLLNEPTAAAMAYGL-FLSGKKLVTVFDFGGGTLDVSLLRIE  180

Query  219  EGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQ---RALRRLRTACERA  275
            +G FEV    GDT+LGG+D DN LVDH +    R H  ++T  Q     + RL+   E A
Sbjct  181  DGKFEVLGIGGDTNLGGDDIDNVLVDHLIEMLDRHH--NLTRAQVGDENMVRLKREVENA  238

Query  276  KRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQ  335
            K  LS    A + +D + +      T+TR + E++CG   +K +  V  VL +AK+  S 
Sbjct  239  KIKLSEEEHAVVTVD-MANVPRITYTLTRRKLEELCGPIRKKCLRIVSSVLEEAKVESSN  297

Query  336  VHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklq  395
            V EV+LVGGSTRIP ++Q +S+ F GKE C S+N DE V  GA +QAAIL G       +
Sbjct  298  VDEVILVGGSTRIPILRQQISEAFGGKELCMSVNADEVVCEGAAIQAAILCG-VDQRVFR  356

Query  396  dlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            D+L++DV PL +GLETA G M  ++ +N  +PT  ++ F TY DNQ G+ ++V+E
Sbjct  357  DVLMMDVLPLPIGLETADGSMEVILPKNARIPTTMTKYFQTYEDNQRGLTVEVYE  411

>SDRG_16621
Length=531

 Score = 271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 172/439 (39%), Positives = 258/439 (59%), Gaps = 34/439 (8%)

Query  29   DRVEIIANDQGN---RTTPSYVAFTDTERLIGDAAKNQVAMNAHN------TVFDAKRLI  79
            + V+I+ +  G+   +T PS V+F  T    G  A   VA+ A        TV  AKRL+
Sbjct  3    NHVKIVNHSTGDAKAKTLPSVVSFPST----GAPAVGFVAVAAEASDADVVTVRSAKRLL  58

Query  80   GRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEA  139
            G+  +D +   D K+  +KL  G  +   +++       +  P E+++++L ++++ AEA
Sbjct  59   GQSLADAL--PDQKYLSYKLCEG--ESGHVSIALPARKTSVTPSEVAALLLSELKKAAEA  114

Query  140  FIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERN  199
             + + + N V+TVPAYF + QRQAT +A A+AG + +R++NEPTAAA+AYGL   G +R 
Sbjct  115  KLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPTAAAMAYGLFVAGTKR-  173

Query  200  VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKH-----  254
            V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N + DH +    +KH     
Sbjct  174  VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNIVFDHVLQSIAKKHGPLAL  233

Query  255  ---RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMC  311
                 D+ + QRA+       E AK  LS+  +  + + ++        T+TR + + +C
Sbjct  234  PLATPDMVQLQRAV-------EAAKIALSTDDETVLRLTNVGHVALHEMTLTRRKLDALC  286

Query  312  GDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPD  371
               F+K +    +VL+   +  S V+EVVLVGGSTRIP ++  L  FFN KE C S+N D
Sbjct  287  DPLFKKCLRITREVLKAIDVDPSDVNEVVLVGGSTRIPAIRARLRAFFNDKELCTSVNAD  346

Query  372  EAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKS  431
            E VA GA +QAAILSG    +  QD+L+LDV P+S+G+E A G M  LI +N+ +P   +
Sbjct  347  EVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIPKNSRIPVSVT  405

Query  432  QTFSTYADNQPGVLIQVFE  450
            + F T  D+Q G  I+VFE
Sbjct  406  KYFDTAVDDQAGFTIEVFE  424

>PYAP_19903
Length=527

 Score = 270 bits (689),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 177/437 (41%), Positives = 262/437 (60%), Gaps = 15/437 (3%)

Query  25   VWQNDR--VEIIAN-DQGNRTTPSYVAFT--DTERLIGDAAKNQVAMNAHNTVFDAKRLI  79
            +W  +R  V+I+ N D   RTTPS V F     E ++G+AA  +      NTV   KRL+
Sbjct  1    MWHVERNHVKILKNRDDRGRTTPSVVHFKPDSQEVVVGNAAIAREYDPPGNTVRTIKRLM  60

Query  80   GRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKT-FQPEEISSMVLIKMREVAE  138
            G++F    V+   +     +         ++V+  G+     QPEE+SS VL++++  AE
Sbjct  61   GQRFDSDAVRVAKRFATHSIVETKQGNAAVSVKRSGQDAVDVQPEEVSSHVLMELKASAE  120

Query  139  AFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGE  197
            A+   E V N VITVPAYFNDSQR+AT  +  +AG   +R++NEPTAAA+AYGL    G+
Sbjct  121  AYWDDERVDNVVITVPAYFNDSQRKATILSAQMAGFKAIRLLNEPTAAAMAYGL-FLSGQ  179

Query  198  RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKH---  254
            ++V++FD GGGT DVSLLSI +G FEV    GDT+LGGED ++ +V H V    ++H   
Sbjct  180  KHVVVFDFGGGTLDVSLLSINDGRFEVLGIGGDTNLGGEDINDLVVGHVVDMLHQQHGLT  239

Query  255  RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID-FNSTITRARFEDMCGD  313
            R D++ +   L +++   E+AK  LSS     IE+  +      +   +TR  FE +C  
Sbjct  240  RNDLSRSD--LIQIKRETEKAKVELSSEESIAIELKGIGKKKQAYKIKLTRPAFEKICAS  297

Query  314  YFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEA  373
             + + +  V  VL +A +  S + EV++VGGSTRIP V+  +S+FF+ KE C S+N DE 
Sbjct  298  IWSRCLVIVTDVLEEAGVHTSDIDEVIMVGGSTRIPIVRAKVSEFFDNKELCLSVNADEV  357

Query  374  VAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQT  433
            V  GA +QAAILSG       +D+L++DV PL +GLE A G M  L+ +N+ +P   ++ 
Sbjct  358  VCEGAAIQAAILSG-LDKRIFRDVLMMDVLPLPIGLEKADGEMEILLPKNSRIPVTMTKY  416

Query  434  FSTYADNQPGVLIQVFE  450
            F T+ D+Q G+ +QV+E
Sbjct  417  FETFEDDQRGLTVQVYE  433

>PHYSO_525236
Length=246

 Score = 258 bits (660),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 163/228 (71%), Gaps = 5/228 (2%)

Query  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
            MA  TT  G S+GID+GT YS V +W  DR EI+ N  GNR T SYVAFTD++ L+GDAA
Sbjct  1    MANKTTG-GPSIGIDIGTAYSRVAIWHKDRAEILPNRFGNRLTSSYVAFTDSKVLVGDAA  59

Query  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGD----KPQITVQFKGE  116
             +Q   NA NTVF   RL+GRKFSDP VQ  IKHWPFK+  G  D     P + VQF+G+
Sbjct  60   ADQRLQNAENTVFGITRLLGRKFSDPEVQERIKHWPFKVIRGPHDTPPPPPHVMVQFRGQ  119

Query  117  SKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVL  176
            +K F P +I S++L +MR + E + GKE   AV+TVPA+FN SQRQA KDAGAIA + V+
Sbjct  120  TKIFHPVQILSLLLSEMRGIVETYTGKEATTAVVTVPAHFNYSQRQAVKDAGAIAEIQVM  179

Query  177  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  224
            R+I+  TAA+I+YG++KKG ER VL+ DLG  T DVS++ IE+G FEV
Sbjct  180  RMISRSTAASISYGINKKGSERRVLVVDLGASTLDVSVVEIEDGNFEV  227

>CCA22305
Length=561

 Score = 268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 175/466 (38%), Positives = 278/466 (60%), Gaps = 38/466 (8%)

Query  8    TGYSVGIDLGTTYSCVGVWQND--RVEIIAN---DQGNRTTPSYVAFTDTERLIGDAAKN  62
            T  ++GID GTT SCVGVW  D  RV+I  +    + +   PS V +   +  +    K 
Sbjct  21   TTIAIGIDFGTTNSCVGVWLKDQNRVKIFKHGIETKWSHLLPSVVRYDPVDISLVLVGKE  80

Query  63   QVAMNAH----NTVFDAKRLIGRKFSD------------PIVQSDIKHWPFKLSSGAGDK  106
             + + +     NT+   KRL+G+K+ +             IV +   +   ++    GD 
Sbjct  81   AIELESKPPCKNTIRCVKRLMGQKYVNDRIAYLQSSSIYEIVSTQRGNAAIQIDGDHGDD  140

Query  107  PQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIG-KEVKNAVITVPAYFNDSQRQATK  165
             + +V+         PEE+++ +LIK++  AEA+   K ++N V+TVPA+FND QR+AT 
Sbjct  141  KRTSVE---------PEEVAAHILIKLKARAEAYFDHKAIENVVLTVPAHFNDGQRKATI  191

Query  166  DAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVK  225
             A ++AG   +R++NEPTAAA+AYGL    G++ VL+FD GGGT DVSL+ I EG F V 
Sbjct  192  RAASMAGFKKIRLLNEPTAAAMAYGL-FIAGKKQVLVFDFGGGTLDVSLMQIHEGRFRVV  250

Query  226  ATAGDTHLGGEDFDNRLVDHFVSEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQ  284
            A  GDT+LGGED +  ++DH +  F+ K     +T +Q+A   ++ + E+AK  LS++ +
Sbjct  251  AIGGDTNLGGEDINQMIIDHILQSFEEKEGILQLTIDQKA--AMKQSIEQAKIQLSNAME  308

Query  285  AYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  344
            A I+ +       +   ++R  FE +C   + + +  ++ VL+DA +    V EVV+VGG
Sbjct  309  AVIKFEHKTTWRQY--ALSRDVFESICDSVWTRCISTIQGVLQDASVDPCDVDEVVMVGG  366

Query  345  STRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtp  404
            STRIPK++  +S+ F+ K  C+S+N D+ V  GA +QAA+LSG    + LQD+L+LDV P
Sbjct  367  STRIPKLRSKISEVFDNKALCESVNADQVVCEGAAIQAAVLSG-MDRKVLQDVLMLDVIP  425

Query  405  lslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            LS+GLETA G M  ++ +N+ +P + ++ F T+ D+Q G+ + V+E
Sbjct  426  LSMGLETADGRMEVILPKNSQIPAQVTKYFQTFEDDQRGISVDVYE  471

>PHYSO_249932
Length=232

 Score = 236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 154/212 (73%), Gaps = 13/212 (6%)

Query  152  VPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  211
            +P +FN SQRQA K+AGA+AG+NV+R I   TAA+I YG +K G  R +L+FD+GG   D
Sbjct  2    MPLHFNQSQRQAIKNAGALAGLNVVRSIAGSTAASIGYGFEKTG-LRAILVFDMGGSALD  60

Query  212  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTA  271
            +SL++I++ I+EV AT G  HLGG              FKR H KD+  N RA+ RLR+A
Sbjct  61   LSLVTIDDDIYEVLATLGVPHLGG------------VPFKRTHGKDLRTNSRAMVRLRSA  108

Query  272  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL  331
            CE+AKR +S+S +A IE++SL++GID NSTI+R RF D+C D F K +  V KVLRDAK 
Sbjct  109  CEQAKRAVSTSTEAQIELESLYEGIDLNSTISRPRFNDLCADLFDKALGAVSKVLRDAKK  168

Query  332  SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            SK++V E+VLVGGS RIP++QQLL DFFNGK+
Sbjct  169  SKTRVDEIVLVGGSPRIPRMQQLLEDFFNGKK  200

>SPRG_06720
Length=425

 Score = 242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/391 (37%), Positives = 211/391 (54%), Gaps = 23/391 (6%)

Query  10   YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  68
            +SVGIDLGTTYS V V Q D V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  31   HSVGIDLGTTYSVVAVNQKDNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  90

Query  69   HNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGES-KTFQPEEISS  127
             +T+F+AKR IGR F   +   +  H+ F L      +    +   G + +   P ++ +
Sbjct  91   RHTIFNAKRFIGRAFDATVETEEAPHYEFGLGRDEAHRVCFPLSVTGHATRCVSPVDVGA  150

Query  128  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
             ++ +++  A  ++G  ++ +AVI VPA F+  QR AT  A   AG+ V  ++ EPTAAA
Sbjct  151  HIVSQLKTSAMRYLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  210

Query  187  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  211  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  270

Query  247  VSEFKRKHRKDITENQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  289
            V+ F+             L R             +R   E+ KR L    S++A   IE 
Sbjct  271  VARFEELLATPALPPLSTLARTSDESAFPCTVSGMRGVAEKLKRDLSALPSAAASCVIEA  330

Query  290  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  347
             +        +T+  TR  +E +      +T+ P+  +L    ++ + + EVVLVGGS+R
Sbjct  331  STAQHAAGSLATVEMTRQEWEALVAPMLSRTLTPIHDMLDGNGMAPTDIDEVVLVGGSSR  390

Query  348  IPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            IP +Q  L+  F G+EP   I+PD AVA GA
Sbjct  391  IPWIQHALAALF-GREPNAHIDPDVAVAVGA  420

>PHALS_09281
Length=465

 Score = 242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 149/404 (37%), Positives = 220/404 (54%), Gaps = 32/404 (8%)

Query  3    QTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAK  61
            Q  T   + VGIDLGTTYS V ++Q + V  IA+++G+   PS VA+  D   LIG  A+
Sbjct  61   QGFTGRDHVVGIDLGTTYSVVAIFQKNNVTAIADNEGHVLVPSTVAYLPDGGVLIGREAR  120

Query  62   NQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFK-----LSSGAGDKPQITVQFKGE  116
                ++  +T+F+AKR IG+ + D +++S+    P++     L     D     +     
Sbjct  121  THRTIDPQHTIFNAKRFIGQSYDD-VIKSENGTMPYEFNIKPLQRNEYDGICFALNLPNH  179

Query  117  SKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNV  175
             +   P EI + ++  +  +A  ++G  +V  AV+ VP  FN+ QR ATK A   AG+ V
Sbjct  180  PECVTPVEIGTAIVRHLHFMAHRYVGHNQVTKAVVAVPVDFNEKQRNATKAAFRAAGLEV  239

Query  176  LRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGG  235
             R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGG
Sbjct  240  SRVLEEPTAAAIAYGLHQDQNINFMLVFDFGGGTLDVSLLFARNGAITVVDTLGDNHLGG  299

Query  236  EDFDNRLVDHFVSEFKRKHRKDI------TENQRALRR----------LRTACERAKRTL  279
            ED D RL    +  F+ + +K I      TE +R L+           +R A E  KR L
Sbjct  300  EDLDARLSAWLLMRFESQLKKKISTHNTKTEGKRVLKDRPEPPCTMAGVRQAAELLKRQL  359

Query  280  S-----SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKS  334
            +     ++A  + E D   + I     +TR +FE++C     +TM PV  +L    +   
Sbjct  360  TNLSVVTAACVWNEGD---ESIQIEVDVTRLQFEELCKPLLERTMIPVRDILAANNIGTE  416

Query  335  QVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            ++  VVLVGGS+RIP V+Q L++ F+G+ P  +I+PD AVA+GA
Sbjct  417  EIDAVVLVGGSSRIPWVRQRLTEMFHGRAPLSNIDPDLAVAYGA  460

>SDRG_01068
Length=621

 Score = 244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 145/377 (38%), Positives = 210/377 (56%), Gaps = 9/377 (2%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQ-GNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  70
            + ID+GT+   VGVW+NDRVE++A D  G    P+YVAFTD  RL+G  AK   A +A N
Sbjct  5    IAIDIGTSNLRVGVWRNDRVELLALDSDGATALPAYVAFTDAGRLVGRRAKAYAATDAAN  64

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVL  130
             VF   R +GR   D  V++D    PF++ + + DKPQ+ V   G+  TF  EE    VL
Sbjct  65   VVFRMTRFLGRSMRDRGVRADCDKVPFQVVASSDDKPQVRVTLNGQPSTFDLEE----VL  120

Query  131  IKMREVAEAFIGKE--VKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
              + E  +A + ++  V    +TVPA F  +QR A  DA AIAG+NV +++N PTAA + 
Sbjct  121  ATLLEHTKAMVDEQLTVGYVTLTVPAAFTTTQRHAVLDAAAIAGLNVRKLLNAPTAALVT  180

Query  189  YG--LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            Y     +   ER VL    G G+  V++   E  +    AT+G+ HLGG D D RLV H 
Sbjct  181  YMNMHPRMREERTVLTVTAGAGSLGVAITVDESALSTAVATSGNAHLGGLDIDERLVRHC  240

Query  247  VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  306
            ++ F+R    D+  + R L+RLRTACE AK  LS++    +E+  L    D    ++R +
Sbjct  241  IAAFERTIGCDVRLSPRGLQRLRTACEEAKIALSTATTTTVEVPRLSGENDLVVVVSRDQ  300

Query  307  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  366
               +  +   +    V K L+ AKL K+ + ++VL GG  R+P ++  L D F+G+    
Sbjct  301  LNQLAREMMAQLTALVVKALQTAKLDKNNIDDIVLAGGLVRMPLLKTTLVDLFHGQRVRL  360

Query  367  SINPDEAVAFGATVQAA  383
              NPDEA+  GAT+  A
Sbjct  361  VGNPDEAIVTGATLYTA  377

>SDRG_16559
Length=461

 Score = 239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 148/391 (38%), Positives = 215/391 (55%), Gaps = 24/391 (6%)

Query  10   YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  68
            +SVGIDLGTTYS V V Q   V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  68   HSVGIDLGTTYSVVAVNQKGNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  127

Query  69   HNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGES-KTFQPEEISS  127
             +T+F+AKR IGR F D  V+++  H+ F L     ++    +   G + +   P ++ +
Sbjct  128  RHTIFNAKRFIGRAF-DAAVETEASHYEFGLDRDEANRVCFPLSVTGHATRCASPIDVGA  186

Query  128  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
             ++ +++  A   +G  ++ +AVI VPA F+  QR AT  A   AG+ V  ++ EPTAAA
Sbjct  187  HIVSQLKASAMRHLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  246

Query  187  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  247  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  306

Query  247  VSEFKRKHRKDITENQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  289
            V+ F+            +L R             +R   E+ KR L    S++A   +E 
Sbjct  307  VARFEALLATPALPALSSLARTSDASAFPCTVSGMRGVAEKLKRDLSATPSAAASCVVEA  366

Query  290  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  347
             +        +T+  TR  +E +      +T+ P+ ++L    ++ S V EVVLVGGS+R
Sbjct  367  ATPQHAAGDLATLEMTRVEWEALVAPLLSRTLSPIHEMLSGNGMAPSDVDEVVLVGGSSR  426

Query  348  IPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            IP +Q+ L   F G+EP   I+PD AVA GA
Sbjct  427  IPWIQEALGALF-GREPNAHIDPDVAVAVGA  456

>PHYCA_120845
Length=444

 Score = 234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/396 (37%), Positives = 209/396 (53%), Gaps = 25/396 (6%)

Query  6    TSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQV  64
            T   + VGIDLGTTYS V + + + V  IA+ +G+   PS VAF  D   L+G  A+   
Sbjct  46   TGRDHVVGIDLGTTYSVVAISRKNNVTAIADSEGHVLVPSTVAFLPDGGVLVGREARVHR  105

Query  65   AMNAHNTVFDAKRLIGRKF--SDPIVQSDIKHWPF---KLSSGAGDKPQITVQFKGESKT  119
              +  +T+F+AKR IG+ +  +    +  +  + F   ++     D    ++  +G+   
Sbjct  106  TTDPQHTIFNAKRFIGQSYVMTSETNEKGVTPYEFVVKQMHRDEHDGICFSLSLQGQPDC  165

Query  120  FQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRI  178
              P +I + V+  +R +A  F+G  ++  AVI VP  FN  QR+AT  A   AG+ V R+
Sbjct  166  VTPVQIGTSVVKHLRLMAHQFVGHDQITKAVIAVPVDFNQKQREATVAAFRGAGLEVSRV  225

Query  179  INEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  238
            + EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED 
Sbjct  226  LEEPTAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDL  285

Query  239  DNRLVDHFVSEFKRKHRKDITENQRA----------------LRRLRTACERAKRTLSSS  282
            D +L    V EF+ +    IT                     L  +R A E  KR L+ +
Sbjct  286  DAQLTAWLVGEFEAQLGTAITSRGTGDEVKTFDNDGKDPPCTLSGVRHAAELVKRQLTDA  345

Query  283  AQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  342
            + A     S  +G      ITR +FE++CG    +TM PV +VL    +   ++  VVLV
Sbjct  346  STATAACISGNEGAKVE--ITRTQFEELCGSLLERTMVPVREVLEANNMESDEIDAVVLV  403

Query  343  GGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            GGS+RIP V++ L+D F G+ P   I+PD AVA+GA
Sbjct  404  GGSSRIPWVRRRLTDMFQGRAPLSDIDPDLAVAYGA  439

>PHYRA_53570
Length=395

 Score = 232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 149/395 (38%), Positives = 210/395 (53%), Gaps = 29/395 (7%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNAHN  70
            VGIDLGTTYS V + Q + V  IA+D+G    PS VAF    E L+G  A+     +  +
Sbjct  1    VGIDLGTTYSVVAISQKNNVTAIADDEGYILVPSTVAFLPHGEMLVGREARAHRTTDPQH  60

Query  71   TVFDAKRLIGRKFSDPIVQSD-----IKHWPFKLSSGAGDKPQ---ITVQFKGESKTFQP  122
            T+F+AKR IGRK+ D +V+S+     I  + F +    G+       ++    +     P
Sbjct  61   TIFNAKRFIGRKY-DEVVRSEADSNGITPYEFVVKPAQGNVHGGVCFSLDLPEQPDCVTP  119

Query  123  EEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINE  181
             +I S V+  +R +A  F+G  ++  AVI VP  F+  QR AT  A   AG+ V R++ E
Sbjct  120  VQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVEFDAQQRDATVAAFREAGLEVSRVLEE  179

Query  182  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            PTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D  
Sbjct  180  PTAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDAL  239

Query  242  LVDHFVSEFKRK------------HRKDITENQRA----LRRLRTACERAKRTLS--SSA  283
            L D    +F+ +            + K+  E+  A    L  +R A E  KR L+  S+A
Sbjct  240  LADWLAKQFEAQLGTPITSRGTEANVKNFDEDGMAPPCTLAGVRHAAELLKRQLTDFSTA  299

Query  284  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  343
             A          +      TR +FE +CG    +TM PV ++L    +   ++  VVLVG
Sbjct  300  SAACVWRKGTKVVRAEVKTTRTQFEALCGSLLERTMVPVREILEANNMETEEIDAVVLVG  359

Query  344  GSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            GS+R+P V+Q L++ F G+ P  +I+PD AVA+GA
Sbjct  360  GSSRVPWVRQHLTEMFQGRAPLSNIDPDLAVAYGA  394

>PPTG_09003
Length=449

 Score = 233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 149/400 (37%), Positives = 204/400 (51%), Gaps = 27/400 (7%)

Query  6    TSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV  64
            T   + VGIDLGTTYS V + Q + V  I + +G    PS VAF      L+G  A+   
Sbjct  45   TGRDHVVGIDLGTTYSVVAISQKNNVTAIKDKEGYVLVPSTVAFLPHGGVLVGREARAHR  104

Query  65   AMNAHNTVFDAKRLIGRKFSDPIV----QSDIKHWPF---KLSSGAGDKPQITVQFKGES  117
             ++  +TVF+AKR IG+ + D +     ++ +  + F    L     D    T+   G+ 
Sbjct  105  TLDPQHTVFNAKRFIGQSYGDVLASEADENGVTPYEFGVKMLQDNKHDGVCFTLDLSGQP  164

Query  118  KTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVL  176
                P EI + V+  +R +A  F+G  ++  AVI VP  FN  QR AT  A   AG+ V 
Sbjct  165  GCVTPVEIGTAVVRHLRSMAHNFVGHDQITKAVIAVPVDFNARQRDATVAAFRAAGLEVS  224

Query  177  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  236
            R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGE
Sbjct  225  RVLEEPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGE  284

Query  237  DFDNRLVDHFVSEFKRKHRKDIT----------------ENQRALRRLRTACERAKRTLS  280
            D D RL    + +F+ +    IT                E    +  +R A E  KR L+
Sbjct  285  DLDARLSAWLLKQFEAQLGAAITSRGSESEGKVSENGSNEPPCTMAGVRQAAELVKRQLT  344

Query  281  --SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHE  338
              S   A          +    T+TRA+FE++C     +TM PV  VL    +   ++  
Sbjct  345  DVSVTTAACISSGNKKPVRVEVTVTRAQFEELCDSLLERTMIPVRDVLESNNMDTDEIDA  404

Query  339  VVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            VVLVGGS+RIP V+Q L+D F G+ P   I+PD AVA+GA
Sbjct  405  VVLVGGSSRIPWVRQRLTDMFQGRPPLSDIDPDLAVAYGA  444

>H257_04453
Length=423

 Score = 231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 145/389 (37%), Positives = 214/389 (55%), Gaps = 22/389 (6%)

Query  10   YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  68
            + VGIDLGTTYS V V ++  V ++ +  GN   PS VAF      L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDANGNLLLPSIVAFKPHGGVLVGRDARHHRRVDP  91

Query  69   HNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQIT--VQFKGESKTFQPEEIS  126
             +T+ +AKR IGRKF D  +++D   + F L         +   +   G      P +I 
Sbjct  92   KHTISNAKRFIGRKF-DATIEADASLYDFPLLGNTTGDHHVCFGLSVPGHPSCVSPVDIG  150

Query  127  SMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAA  185
              V+  ++E A A++G  ++  AVI +PA F+ +QR+AT  A   AG+ V  ++ EPTAA
Sbjct  151  YFVVKTLKETAMAYLGHDQIYGAVIAIPAGFDANQRKATVAAFERAGLKVRNVLVEPTAA  210

Query  186  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  245
            A+AYGL  K    NVL+FD GGGT DVSLL +++G F+V  TAGD HLGGED D++L  H
Sbjct  211  ALAYGLHTKPNVHNVLVFDFGGGTLDVSLLYLQKGSFQVMDTAGDNHLGGEDLDDQLSGH  270

Query  246  FVSEFKR----KHRKDITENQR------ALRRLRTACERAKRTLS------SSAQAYIEI  289
               +F++        D+  +            +R   E+ KR LS      +S      +
Sbjct  271  LKHQFEQLVGGHSLPDLQTSDEPNVFPCTAAGIRGVAEQLKRQLSFDVEGEASCVVQEAV  330

Query  290  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  349
             S+  G      +TR+ +E +C    ++TM PV++VL    ++   + EVVLVGGS+RIP
Sbjct  331  GSVAVGDVLRLRMTRSEWEALCLPTLQRTMAPVKEVLEGNMMTTDDIDEVVLVGGSSRIP  390

Query  350  KVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
             +Q  L+  F G+EP   I+PD AVA GA
Sbjct  391  WIQAQLAQMF-GREPNSHIDPDVAVAVGA  418

>PITG_17383
Length=438

 Score = 229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 149/402 (37%), Positives = 204/402 (51%), Gaps = 29/402 (7%)

Query  6    TSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQV  64
            T   + VGIDLGTTYS V + Q + V  IA+  G+   PS VAF  +   L+G  A+   
Sbjct  32   TGRDHVVGIDLGTTYSVVAISQKNNVTAIADKNGHVLVPSTVAFLPSGAVLVGREARAHR  91

Query  65   AMNAHNTVFDAKRLIGRKFSDPIVQSDIKHW--PFKLS-----SGAGDKPQITVQFKGES  117
              +  +T+F+AKR IG+ + D +     ++   P++ S         D    T+  +   
Sbjct  92   TTDPQHTIFNAKRFIGQSYEDVLTSEADENGGTPYEFSVKMLRDNEHDGVCFTLDLQDHP  151

Query  118  KTFQPEEISSMVLIKMREVAEAFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGMNVL  176
            K   P  I + V+  +R +A  F+G E +  AVI VP  FN+ QR AT  A   AG+ V 
Sbjct  152  KCVTPVNIGTAVVQHLRSMAHQFVGHEQITKAVIAVPVDFNNRQRDATVAAFRAAGLAVS  211

Query  177  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  236
            R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGE
Sbjct  212  RVLEEPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGE  271

Query  237  DFDNRLVDHFVSEFKRKHRKDIT------------------ENQRALRRLRTACERAKRT  278
            D D RL    + EF+      IT                  E    +  +R A E  KR 
Sbjct  272  DLDARLSAWLLKEFEAHLGTAITSRGAETETKATSVDNDSKEPPCTVAGVRQAAELLKRQ  331

Query  279  LS--SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  336
            L+  S A A    +     +      TR +FE +CG    +T+ PV +VL    +   ++
Sbjct  332  LTDASVATAACIWNDGKKTVRVEVRATRVQFEKLCGSLLERTIIPVREVLEANNMDTDEI  391

Query  337  HEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
              VVLVGGS+RIP V+Q L+D F G+ P   I+PD AVA+GA
Sbjct  392  DAVVLVGGSSRIPWVRQRLTDMFEGRPPLSDIDPDLAVAYGA  433

>PYIR_21692
Length=468

 Score = 229 bits (583),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 144/397 (36%), Positives = 213/397 (54%), Gaps = 30/397 (8%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  70
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  67   VGIDLGTTYSVVAISQKNNVSVIPDAFGHVIIPSIVAFLPGGDVLVGRQARAHRTKDPEH  126

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFK----GESKTFQPEEIS  126
            T+F+AKR IGR + D     D + + + ++  +  +P+  V F+    G  K   P  + 
Sbjct  127  TIFNAKRFIGRIYDDVKQSKDDESYEYTVARASLSEPESGVCFQLSLPGHPKCVTPVSVG  186

Query  127  SMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAA  185
            S ++  +R +A +F+G  ++  AVI VP  F+  QR AT+ A A AG+ V RI+ EPTAA
Sbjct  187  SAIVRHLRAMAHSFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRILEEPTAA  246

Query  186  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  245
            AIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D+++ + 
Sbjct  247  AIAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDIDSQVAEL  306

Query  246  FVSEFKRK-------HRKDITENQRALRR-----------LRTACERAKRTLSSSAQAYI  287
                   +          D+ E    L             +R A E  KRTLSS      
Sbjct  307  LTEAIAARIGTTLTSMASDMEETDSELHEDPGQLPCTPAGIRRAAELLKRTLSSEGSGSA  366

Query  288  EIDSLFDGIDFNST------ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  341
                   G    S       +TRA+FED+CG+  ++T+ PV++++    ++  ++  VVL
Sbjct  367  SCIVQRSGTLLQSAEKVTIDMTRAQFEDICGEILKRTLTPVQEIISANHMTPEEIDAVVL  426

Query  342  VGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            VGGS+RIP V++ L++ F+G+ P   I+PD AVA+GA
Sbjct  427  VGGSSRIPWVREHLAELFDGRAPLSDIDPDIAVAYGA  463

>H310_12260
Length=424

 Score = 226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 145/391 (37%), Positives = 212/391 (54%), Gaps = 25/391 (6%)

Query  10   YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  68
            + VGIDLGTTYS V V ++  V ++ +  G+   PS VAF  +   L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDVHGHFLLPSVVAFKPNGGVLVGRDARHYRRVDP  91

Query  69   HNTVFDAKRLIGRKFSDPIV-QSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
             +T+ +AKR IGR+F + I  ++ +  +P   ++         +   G      P +I  
Sbjct  92   KHTISNAKRFIGRQFDESIAAEAALYDFPLLANTTGDSHVCFGLNLPGHPSCISPVDIGY  151

Query  128  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
             V+  ++E A AF+G  ++  AVI +PA F+ SQR+AT  A   AG+ V  ++ EPTAAA
Sbjct  152  YVVKALKETAMAFLGHDQIYGAVIAIPAGFDASQRKATVAAFERAGLKVRNVLVEPTAAA  211

Query  187  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  246
            +AYGL  K     VL+FD GGGT DVSLL ++ G F+V  TAGD HLGGED D+ L  H 
Sbjct  212  LAYGLHTKPNVHYVLVFDFGGGTLDVSLLYLQNGSFQVMDTAGDNHLGGEDLDDLLSAHL  271

Query  247  VSEFKR-------------KHRKDITENQRALRRLRTACERAKRTLS------SSAQAYI  287
              EF++                 D+     A   +R   E+ KR LS      +S     
Sbjct  272  KHEFEQVVGGHSLPDVQTSGDMPDVFPCTAA--GVRGVAEQLKRRLSFANDGEASCVVQQ  329

Query  288  EIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  347
             +     G      +TRA +E++C    ++TMEPV++VL    ++   V EVVLVGGS+R
Sbjct  330  AVGEYVVGDTLRLRMTRAEWEELCLPTLQRTMEPVKEVLVGNMMTAGDVDEVVLVGGSSR  389

Query  348  IPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            IP +Q  L++ F G+ P   I+PD AVA GA
Sbjct  390  IPWIQGQLTEMF-GRAPNGHIDPDVAVAVGA  419

>SPRG_00182
Length=615

 Score = 231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/373 (36%), Positives = 206/373 (55%), Gaps = 10/373 (3%)

Query  14   IDLGTTYSCVGVWQNDRVEIIAND-QGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  72
            +D+GT+   VGV +N+RVE++A D  G    P+YVAFTD+ RL G  AK   A    N +
Sbjct  7    LDIGTSSLRVGVKRNNRVELLALDGDGATAMPAYVAFTDSGRLFGRRAKAYAASAPENVI  66

Query  73   FDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  132
            F   R +G    D  V++D    PF++ + + DKPQ+ V   G+  TF  EE+ +M+L  
Sbjct  67   FRMLRFLGGSMRDLNVRADCDKVPFRVVASSDDKPQVRVTVNGQPSTFDLEEVMAMLL--  124

Query  133  MREVAEAFIGKE--VKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
              E  +A + ++  V++  +TVPA F  +QR+A  DA AIAG+ V +++N PTAA +AY 
Sbjct  125  --EHTKAMVDEQLAVRHVTLTVPASFTTTQRRAVLDAAAIAGLTVRKLLNAPTAALVAYM  182

Query  191  L---DKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFV  247
                 +   +R V+    G G+  V++      +    AT G+ HLGG + D RLV H +
Sbjct  183  ATHPSRMHQDRTVVTVTAGAGSLGVAITIDSNDVSTAVATTGNAHLGGIEIDERLVRHCI  242

Query  248  SEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  307
            + F+R   +D+  + R L+RLRTACE AK  LS++    IE+  L    D    ++R + 
Sbjct  243  AAFERTIGRDVHLSPRGLQRLRTACEDAKIALSTATTTTIEVPRLSGENDLVVCVSRDQL  302

Query  308  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS  367
              +  D   +    V + LR AK+ K+ V  +VL GG  R+P +Q  L D F+G+     
Sbjct  303  NALARDVMTQLTALVVEALRMAKMEKANVDAIVLAGGLGRMPLLQTTLVDLFHGQRVRLI  362

Query  368  INPDEAVAFGATV  380
             NP EA+  GAT+
Sbjct  363  GNPSEAIVTGATL  375

>PYIW_19956
Length=459

 Score = 226 bits (576),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 144/401 (36%), Positives = 209/401 (52%), Gaps = 25/401 (6%)

Query  3    QTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  62
            Q  T   + VGIDLGTTYS V + Q + V +I +  G+   PS VAF   E L+G  A+ 
Sbjct  54   QGFTGRDHVVGIDLGTTYSVVAIAQKNNVSVIPDAFGHVIIPSIVAFLPGEVLVGRQARA  113

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
                +  +T+F+AKR IGR + D +   D   + + ++          +   G  K   P
Sbjct  114  HRTRDPKHTIFNAKRFIGRTYKDVVQSKDDASYEYTVARTPEGGVCFQLSVAGHPKCVTP  173

Query  123  EEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINE  181
              I S ++  +R +A  F+G  ++  AVI VP  F+  QR AT+ A A AG+ V R+++E
Sbjct  174  VAIGSAIVSHLRAMAHRFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRVLDE  233

Query  182  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            PTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D++
Sbjct  234  PTAAAIAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDIDSQ  293

Query  242  LVDHF------------------VSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA  283
            +                      + E   +H +D  +       +R A E  KRTLSS +
Sbjct  294  VAAFLTEAIAARIGTTLTSMASDMEESDSEHNEDPEQLPCTPAGIRRAAELLKRTLSSHS  353

Query  284  QAYIEIDSLFDGIDFNS------TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVH  337
             +         G    S       +TRA+FE+MC +   +T+ PV++++    ++  ++ 
Sbjct  354  ASSASCVVQHSGTLLQSGEKVTIDVTRAQFEEMCAEILGRTLVPVQEIISANHMTPEEID  413

Query  338  EVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
             VVLVGGS+RIP V+  L+  FNG+ P   I+PD AVA+GA
Sbjct  414  AVVLVGGSSRIPWVRSNLATMFNGRAPLSDIDPDVAVAYGA  454

>PYAP_18643
Length=804

 Score = 233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 213/391 (54%), Gaps = 16/391 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNVDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +I    +K          + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAYKCVELPNGDVGVVLNYNDEPVTFTCEQVVAMILN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAGMN LR++NE TA A+AYG
Sbjct  124  KMQAIAAAANEGVRPAYAVMSCPGFYTDVQRRALLNATKIAGMNCLRLLNEHTAIALAYG  183

Query  191  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K       +   ++V+  D+G  ++ VS+++  +G  +VKA   D  LGG DFD  L 
Sbjct  184  IYKSARNLFHESEPQHVMFIDMGHASYTVSIVAFVQGKLQVKAATFDRFLGGRDFDYALA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
                 +F+ KH+ +   + +A  +L  ACE+AK+ LS       Y+ I+ L D  D++  
Sbjct  244  VDVAKQFEEKHKINALNDAKARIKLLAACEKAKKNLSPHGVNATYVNIECLADEKDYSGQ  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +T   FE++      +  +P+++ L+DA + KSQ+  V +VGG+TR+  V++ LSD    
Sbjct  304  VTLEHFEELIAPLLNRLEDPIQRALKDAGIDKSQLASVEIVGGATRVSSVKRRLSDILGL  363

Query  362  KEPCK------SINPDEAVAFGATVQAAILS  386
             +  +      ++N DE+VA G  +Q AILS
Sbjct  364  DKEAQNYGLSTTLNADESVARGCALQCAILS  394

>PYVX_13288
Length=810

 Score = 233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/393 (35%), Positives = 214/393 (54%), Gaps = 20/393 (5%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAISVARMHYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +I    +     A     I +Q+  E  TF  E+I +MVL 
Sbjct  64   ATDIKRLIGRKFKHPEVQREIAQLAYPCVELANGDVGIVLQYNDEPVTFSCEQIVAMVLN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYAVLSCPGFYTDVQRRAVLNASKIAGVNCLRLLNEHTAVALAYG  183

Query  191  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            + K    RN         V+  D+G  ++ VS+++  +G  +VKA A D  LGG DFD  
Sbjct  184  IYKSA--RNLFHESEPQYVMFIDIGHASYTVSIIAFVQGKLQVKAAAYDRFLGGRDFDMA  241

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  299
            +     ++F  K++ D   N ++  +L +ACE++K+ LS       ++ I+ L D  D++
Sbjct  242  IAKDAAAQFSAKYKTDPLANPKSRIKLLSACEKSKKNLSPYGVTATHLNIECLADDRDYS  301

Query  300  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  359
            + IT  +FE+M      +   P+E  L+DA + KSQ+  V ++GG TR+  V++ LS+  
Sbjct  302  AQITLEQFEEMIAPLLARLDAPIESALKDAGIDKSQLANVEIIGGGTRVASVKRHLSEVL  361

Query  360  NGKEPCK------SINPDEAVAFGATVQAAILS  386
               +  +      ++N DE+VA G  +Q AILS
Sbjct  362  GLDKEAQNYGLSTTLNADESVARGCALQCAILS  394

>PYU1_G006843
Length=481

 Score = 224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 141/397 (36%), Positives = 209/397 (53%), Gaps = 30/397 (8%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNAHN  70
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  80   VGIDLGTTYSVVAISQKNNVTVIPDVLGHVLIPSMVAFVPGGKVLVGRDARAHRTKDPAH  139

Query  71   TVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQ---ITVQFKGESKTFQPEEISS  127
            T+F+AKR IGR + D +   D   + F +S    D        V   G  K   P  I +
Sbjct  140  TIFNAKRFIGRTYEDVVQSKDAASYEFAVSKAPNDVHHGVCFPVNVPGHRKCVSPIAIGA  199

Query  128  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
             ++  +R +A AF+G  ++  AVI VP  F+  QR AT+ A   AG++V RI+ EPTAAA
Sbjct  200  TIVGHLRAMAHAFVGHNQITKAVIAVPVDFDGVQRAATQKAFFAAGLHVSRILEEPTAAA  259

Query  187  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD--  244
            IAYGL +      +L+FD GGGT DVSLL    G   V  T GD +LGGED D ++ +  
Sbjct  260  IAYGLHQDPSVNFILVFDFGGGTLDVSLLFTRAGSINVVDTIGDNNLGGEDLDAKVAEVL  319

Query  245  -HFVSE----------------FKRKHRKDITENQRALRRLRTACERAKRTLS--SSAQA  285
             H ++E                +  +   D  +    L  +R A E  KRTLS  +SA A
Sbjct  320  THKIAERIGTTLTSATSDMEETYSDRTNDDPDQLPCTLAGIRRAAELLKRTLSYETSATA  379

Query  286  YIEIDSLFDGIDFNSTI----TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  341
               +    + +    T+    TR   E++C +   +T+ PV++++    ++  ++  VVL
Sbjct  380  SCVVQMSGELLQARETVSIEMTRTELEEICSELLARTLVPVKEIIEANHMTSEEIDAVVL  439

Query  342  VGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            VGGS+RIP V++ L+  F+G+ P   I+ D AVA+GA
Sbjct  440  VGGSSRIPWVREHLAKMFDGRAPLSDIDRDVAVAYGA  476

>PHYCA_504114
Length=887

 Score = 232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 138/398 (35%), Positives = 225/398 (57%), Gaps = 25/398 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  70
            G+DLG  +  +  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  28   GVDLGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVGVRRPQ  85

Query  71   TVF-DAKRLIGRKFSDPIVQS--DIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            T +   +RL+G + SDP V S  D +H+P++L   A     I+++  G+S+TF  EE+ +
Sbjct  86   TAYAQIRRLLGTRLSDPQVSSLLDEEHFPYELVQNATRGGTISLKH-GKSQTFHAEELVA  144

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MV    R++ + F    VK+ V+TVP++F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  145  MVFAHARQITDTFAEAAVKDWVLTVPSFFSQAQRQALLDAAEISGVRVLSLINENTAAAL  204

Query  188  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  230
               +    D +   + +L +++G  +  VS+      +             F+  + A D
Sbjct  205  QLAVHASYDPEDKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWD  264

Query  231  THLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  290
              LGG  FD RL +H  +EF  K  +DI +  R + ++R   ++ K  LS++ +  + + 
Sbjct  265  ESLGGAKFDLRLAEHLATEFSEKIGEDIRKIPRPMAKIRAQAKKTKTVLSANEEIPVVMQ  324

Query  291  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  350
            SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG  R+PK
Sbjct  325  SLYNDIDFFTSMTRSKLEELSSDLFDRTLKPVETALEKAGLTAADIDEIEIIGGGVRMPK  384

Query  351  VQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            +QQ LS+FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  385  IQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

>PYIW_17145
Length=443

 Score = 222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 178/266 (67%), Gaps = 15/266 (6%)

Query  191  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEF  250
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ + V EF
Sbjct  1    MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEF  59

Query  251  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  304
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  60   KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  117

Query  305  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  364
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PKVQ  + DFF GK+P
Sbjct  118  ATFEKLVNHLIERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTTVEDFF-GKKP  176

Query  365  CKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  424
             K +NPDE VA GA +Q  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  177  SKGVNPDEVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLITRNT  231

Query  425  TVPTKKSQTFSTYADNQPGVLIQVFE  450
            T+PTKKSQ FST AD+Q  V I+V +
Sbjct  232  TIPTKKSQVFSTAADSQTQVGIKVLQ  257

>PYU1_G008851
Length=795

 Score = 229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/393 (35%), Positives = 213/393 (54%), Gaps = 20/393 (5%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSVARAHFKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E+I +MVL 
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQIVAMVLN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G +   AV++VP Y+ D QR+A  +A  IAG+N LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDGVQPGYAVVSVPGYYTDVQRRALLNASKIAGLNTLRLINEHTAIALAYG  183

Query  191  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSIVAFVQGKLQVKSAAYDRFLGGRDFDYA  241

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  299
            L      +F+ K++ D     ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKKFQEKYKTDPLAEAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  300  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  359
            S IT   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ LS+  
Sbjct  302  SQITLELFEELIEPLLQRLEGPIERALNDAGVEKSQLTSVEIVGGGTRVSSVKRRLSEIL  361

Query  360  NGKEPCK------SINPDEAVAFGATVQAAILS  386
               +  +      ++N DE+VA G  +Q AI S
Sbjct  362  GLDKDAQNYGLSTTLNADESVARGCALQCAISS  394

>HYAP_07918
Length=897

 Score = 229 bits (585),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 142/398 (36%), Positives = 219/398 (55%), Gaps = 25/398 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  70
            G+DLG+ +  V  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  29   GVDLGSEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVGVRKPQ  86

Query  71   TVF-DAKRLIGRKFSDPIVQSDI--KHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            T +   +RL+G K SDP V S +  +H+P++L S A     I ++   ++ TF  EE+ +
Sbjct  87   TAYAQIRRLLGTKLSDPQVVSLLTDEHFPYQLVSNATRGGAIALKHANDA-TFHAEELVA  145

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MVL   R++   F    VK+ V+TVP +F+ +QRQA  DA  IAG+ VL +IN+ TAAA+
Sbjct  146  MVLTHARQITNTFAEVPVKDYVLTVPTFFSQAQRQALLDAAEIAGVRVLSLINDNTAAAL  205

Query  188  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  230
               +    D     + VL ++LG     VS+ ++   +             FE  + A D
Sbjct  206  QLAVHTSYDPTEAPKRVLFYNLGSTALQVSIAAMSSQVVPDGFKKNKTVSTFETLSNAWD  265

Query  231  THLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  290
              LGG  FD RL +H  +EF ++  +DI    RA+ ++R    + K  LS++ Q  + + 
Sbjct  266  ESLGGSKFDLRLAEHLATEFSQQIGQDIRTVPRAMAKIRAQAMKTKTVLSANEQIPVVMQ  325

Query  291  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  350
            SL + +DF +++TR + E++  D F +T++PVE+ L  A L+ + + E+ L+GG  R+PK
Sbjct  326  SLHNDVDFFTSMTRTKLEELSSDLFERTLKPVEQALEKAGLTVADIDEIELIGGGVRMPK  385

Query  351  VQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            +Q  LS FF GK+    +N DEA+A GA  +AA LS +
Sbjct  386  IQHQLSQFFAGKDLGVHLNGDEAMALGAAFRAANLSNS  423

>PPTG_19375
Length=809

 Score = 228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 135/391 (35%), Positives = 212/391 (54%), Gaps = 16/391 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +I    +K    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAG+N LR+INE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  191  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K       +   ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
                ++F  K++ +  EN ++  +L ++CE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSSCEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN-  360
            +T   FE +     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ L+D    
Sbjct  304  VTLEEFETLIEPLLKRLDGPIERALADAGIDKSQLTNVEIVGGGTRVTSVKRHLADVLGL  363

Query  361  GKEP-----CKSINPDEAVAFGATVQAAILS  386
             KE        ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

>PHYCA_111740
Length=810

 Score = 228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 214/391 (55%), Gaps = 16/391 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +IK   +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIKQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAG+N LR+INE T+ A+AYG
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTSIALAYG  183

Query  191  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K       +   ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
                ++F  K++ +  EN ++  +L +ACE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN-  360
            +T   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  VTLEEFEELIAPLLQRLDGPIERALADAGIEKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  361  GKEP-----CKSINPDEAVAFGATVQAAILS  386
             KE        ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

>PITG_15771
Length=883

 Score = 227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 138/398 (35%), Positives = 220/398 (55%), Gaps = 25/398 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  70
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVGVRRPQ  85

Query  71   TVF-DAKRLIGRKFSDPIVQS--DIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            T +   +RL+G   SDP V S  D +H+P++L   A     I+++  G+ +T+  EE+ +
Sbjct  86   TAYAQIRRLLGTTLSDPQVSSLLDEEHFPYELIQNATRGGTISLKH-GKEQTYHAEELVA  144

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MV    R++ + F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  145  MVFTHARQITDTFAEAPVKDWVLTVPTFFSQAQRQAMLDAAEISGVRVLSLINENTAAAL  204

Query  188  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  230
               +    D +   + +L F++G  +  VS+      +             F+  + A D
Sbjct  205  QLAVHASYDPEDKPKKILFFNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWD  264

Query  231  THLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  290
              LGG  FD RL +H   EF  K  +DI +  R + ++R   ++ K  LS++ +  + + 
Sbjct  265  ESLGGAKFDLRLAEHLAKEFSDKIGEDIRKVARPMAKIRALAKKTKTVLSANEEIPVVMQ  324

Query  291  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  350
            SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + EV ++GG  R+PK
Sbjct  325  SLYNDIDFFTSMTRSKLEELSSDLFERTLKPVEVALEKAGLTAADIDEVEIIGGGVRMPK  384

Query  351  VQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            +QQ LS+FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  385  IQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

>CCA15913
Length=857

 Score = 226 bits (576),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 135/393 (34%), Positives = 211/393 (54%), Gaps = 20/393 (5%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  43   IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  102

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ++I    FK    A     I +++     TF  E+I +M+L 
Sbjct  103  ATDIKRLIGRKFKHPEVQAEIAQLSFKCDEMANGDVGIVLKYNDADVTFSCEQIIAMILN  162

Query  132  KMREVA-EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A  A  G      V++ P Y+ D QR+A  ++  IAG+N LR+INE TA A+AYG
Sbjct  163  KMQIIATSANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  222

Query  191  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            + K    RN         V+  D+G  ++ V+++S   G  +V++ A D  LGG DFD  
Sbjct  223  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVSFVLGKLQVRSVAFDRFLGGRDFDYA  280

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  299
            L       F+ KH+ D  +  ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  281  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  340

Query  300  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  359
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+  V++ L+D  
Sbjct  341  SQITLEHFEELIAPLLDRLEAPITQALNDAGIEKSQLSNVEVVGGGTRVASVKRRLADIL  400

Query  360  NGKEPCK------SINPDEAVAFGATVQAAILS  386
            +  +  +      ++N DE+VA G  +Q AILS
Sbjct  401  SLDKSAQNYGLSTTLNADESVARGCALQCAILS  433

>PYAP_19741
Length=885

 Score = 226 bits (576),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 134/394 (34%), Positives = 211/394 (54%), Gaps = 21/394 (5%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTC  87

Query  72   VFDAKRLIGRKFSDPIVQSDIK--HWPFKLSSGAGDKPQITVQFKGES-KTFQPEEISSM  128
                +R +G    DP + S ++  ++P++L     +  + TV  K E+ + F  EE+ +M
Sbjct  88   YAQVRRFLGTTPEDPAIASLLQEEYFPYELLQ---NDTRGTVALKHENDQVFHAEELVAM  144

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            V    R++ +AF    VK+ V+TVP +F  +QRQA  DA  I+G+  L +INE TAAA+ 
Sbjct  145  VFTHARQITDAFAEVPVKDWVLTVPDFFTQAQRQAMLDAAEISGVRALSLINENTAAALQ  204

Query  189  YGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHLG  234
              +     E R VL +++G  +  VS++     +             FEV + A D  LG
Sbjct  205  LAVHSTFPEPRRVLFYNMGSTSLQVSIVEFSSQVVPDGFKKNKTVSGFEVLSKAWDPLLG  264

Query  235  GEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  294
            G  FD RL +H  +EF  K  +D+ +  R + ++R   ++ K  LS++ Q  + + SL+ 
Sbjct  265  GAKFDLRLAEHLAAEFSEKLGEDVRQIPRPMAKIRAQAKKTKIVLSANEQIPVVMQSLYK  324

Query  295  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  354
             IDF +++TR +FE+MC D F + M+PVE+ L  A L+ + +HE+ ++GG  R+PK+QQ 
Sbjct  325  DIDFFTSMTRGKFEEMCKDLFAQAMKPVEQALEKAGLTPADIHEIEIIGGGVRMPKIQQQ  384

Query  355  LSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            L +FF+GK+    +N DEA+A GA   AA LS +
Sbjct  385  LKEFFSGKDLGVHLNGDEAMALGAAFHAANLSNS  418

>PHYRA_82545
Length=806

 Score = 225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/391 (34%), Positives = 212/391 (54%), Gaps = 16/391 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ ++    +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQELAQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAG+N LR+INE TA A+A+G
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAFG  183

Query  191  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSVVAFVQGRLTVKSAAFDRFLGGRDFDMVIA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
                ++F  K++ +  EN ++  +L +ACE+AK+ LS       ++ I+ L D  D+N+ 
Sbjct  244  KDVATKFADKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNAQ  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN-  360
            +T   FE +      +  +PVE+ L+DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  VTLEEFETLIAPLLERLDDPVERALKDAGIDKSQLTNVEIVGGGTRVTSVKRHLAEVLGL  363

Query  361  GKEP-----CKSINPDEAVAFGATVQAAILS  386
             KE        ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNFGLSSTLNADESVARGCALNCAILS  394

>SPRG_00183
Length=609

 Score = 221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 133/380 (35%), Positives = 205/380 (54%), Gaps = 8/380 (2%)

Query  6    TSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  65
            +S  + + ID+G +   VGVW+N R  ++A D  N   P+ VAFTDT  L G+ AK    
Sbjct  2    SSNTHCIAIDIGASTIRVGVWRNGRATVLALDGAN-GLPAVVAFTDTTTLFGNQAKAIAQ  60

Query  66   MNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEI  125
             +  N VF+   L+GR+ +DP VQ+ +   PF++ + +   P I VQ +  + T+ P+EI
Sbjct  61   NDPTNVVFNVLHLLGRRMNDPTVQAMVTSAPFRIIASSDKTPLIHVQHRRSACTYYPQEI  120

Query  126  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAA  185
              M+L   +++AE  +G  + +AV+TVPA +  SQRQA  DA  +AG+ V R+++  TA 
Sbjct  121  VGMLLEHAKKLAEDHLGACLDHAVVTVPATYTTSQRQAVLDAATMAGLTVDRLLSATTAV  180

Query  186  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  245
             IA+       +R +L+ D G  +   S+++ E   F   A+A DT LGG   D RL  H
Sbjct  181  GIAHTQATGASKRKLLVVDAGASSVTASVVTAEHDTFTAHASASDTQLGGFAMDARLAAH  240

Query  246  FVSEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLF-DGIDFNSTIT  303
             +S +    R  D+     A +RL +ACE A+  LS+S +  + I     DG+    T++
Sbjct  241  CMSTWTPSTRGHDLI---LAKQRLLSACEAARCALSTSDETDVCIPHRSQDGMRL--TLS  295

Query  304  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            R +   +      K +  V KVL+ A+  K  V ++VLVGG   +P +Q  LS+ F GK+
Sbjct  296  REKLNALVHHLMDKVVAHVLKVLQQAQCCKEDVDDIVLVGGVALMPCLQTTLSNLFGGKQ  355

Query  364  PCKSINPDEAVAFGATVQAA  383
                  P EAV  GA +  A
Sbjct  356  VAWFPTPSEAVVAGAALYIA  375

>PHALS_04095
Length=803

 Score = 224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 210/391 (54%), Gaps = 16/391 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +I    +     A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDLKRLIGRKFKHPEVQKEIAQLAYTCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAG+N LR+INE TA A+AYG
Sbjct  124  KMQNIASAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  191  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K       +   ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
                ++F  K++ D   N ++  +L +ACE+AK+ LS        + I+ L D  D+N+ 
Sbjct  244  KDVAAKFAEKYKTDPLGNPKSRIKLLSACEKAKKNLSPYGVTATNLNIECLADDRDYNAQ  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN-  360
            +T   FE++      +  +PVE+ L DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  LTLEEFEELIAPLLLRLNDPVERALADAGIDKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  361  GKEP-----CKSINPDEAVAFGATVQAAILS  386
             KE        ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNFGLSTTLNADESVARGCALNCAILS  394

>PHALS_08498
Length=895

 Score = 225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 136/396 (34%), Positives = 207/396 (52%), Gaps = 21/396 (5%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  Y  V  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  27   GVDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAATVGVRRPQTA  86

Query  72   VFDAKRLIGRKFSDP--IVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMV  129
                +RL+G K SDP  I   D +H P++L   A     + +Q  G+ + F  EE+ +MV
Sbjct  87   YMQIRRLLGTKLSDPQVIALRDEEHLPYELIQNATRGGTVMLQH-GKKQFFHAEELVAMV  145

Query  130  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAY  189
                R++ + F    VK+ V+TVP YF+ +QRQA  DA  I+G+ VL +INE TAAA+  
Sbjct  146  FTHARQITDTFAEASVKDWVLTVPTYFSQAQRQAMLDAADISGVRVLSLINENTAAALQL  205

Query  190  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEE-------------GIFEVKATAGDTH  232
             +    D +   + +L +++G  +  VS+                   IF+  + A D  
Sbjct  206  AVHSSFDPEEKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISIFQTISNAWDES  265

Query  233  LGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  292
            LGG  FD RL +H   EF  K  +DI +  R + ++R   ++ K  LS++ +  + + SL
Sbjct  266  LGGAKFDLRLAEHLAQEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEIPVVMQSL  325

Query  293  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  352
             + IDF +++TR + E +  D F +T++PVE  L  A L+ + + E+ L+GG  R+PK+Q
Sbjct  326  HNDIDFFTSMTRTKLEALSSDLFERTLKPVEVALEKAGLTAADIDEIELIGGGVRMPKIQ  385

Query  353  QLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            Q LS+FF GK+    +N DEA+A GA  +AA LS +
Sbjct  386  QQLSEFFVGKDLGVHLNGDEAMALGAAFRAANLSNS  421

>CCI46709
Length=819

 Score = 224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 134/393 (34%), Positives = 210/393 (53%), Gaps = 20/393 (5%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ++I    F+    A     I +++     TF  E+I +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQAEIAQLSFRCEEMANGDVGIVLKYNDADVTFSCEQIIAMILN  123

Query  132  KMREVA-EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A  A  G      V++ P Y+ D QR+A  ++  IAG+N LR+INE TA A+AYG
Sbjct  124  KMQIIATTANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  183

Query  191  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            + K    RN         V+  D+G  ++ V++++   G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVAFVLGKLQVKSVAFDRFLGGRDFDYA  241

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  299
            L       F+ KH+ D  +  ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  242  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  301

Query  300  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  359
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+  V++ L+D  
Sbjct  302  SQITLDHFEELIAPLLDRLEAPINQALNDAGIIKSQLSNVEIVGGGTRVASVKRRLADIL  361

Query  360  NGKEPCK------SINPDEAVAFGATVQAAILS  386
            +     +      ++N DE+VA G  +Q AILS
Sbjct  362  SLDNSAQNYGLSTTLNADESVARGCALQCAILS  394

>PHYRA_73661
Length=884

 Score = 224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 136/398 (34%), Positives = 218/398 (55%), Gaps = 25/398 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  70
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  27   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVGVRRPQ  84

Query  71   TVFDA-KRLIGRKFSDPIVQS--DIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            T +   +RL+G   SDP V +  D +H+P+ L   A     I+++  G+ + FQ EE+ +
Sbjct  85   TAYSQIRRLLGTTLSDPQVSALLDEEHFPYDLVQNASRGGTISLKH-GKDQAFQAEELVA  143

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MV    R++   F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  144  MVFAHARQITNTFAEAPVKDWVLTVPTFFSQAQRQALLDAAEISGVRVLSLINENTAAAL  203

Query  188  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  230
               +    D +   + +L ++LG  +  VS+      +             FE  + A D
Sbjct  204  QLAVHASYDPEDKPKKILFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTISTFETISNAWD  263

Query  231  THLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  290
              LGG  FD RL ++  +EF  K  +DI +  R + ++R   ++ K  LS++ +  + + 
Sbjct  264  ESLGGAKFDLRLAEYLATEFSEKIGEDIRKVARPMAKIRAQAKKTKTVLSANEEIPVVMQ  323

Query  291  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  350
            SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ L+GG  R+P+
Sbjct  324  SLYNDIDFFTSMTRSKLEELSADLFERTIKPVEVALEKAGLTVADIDEIELIGGGVRMPR  383

Query  351  VQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            +QQ LS+FF GK+    +N DEA+A GA  +AA LS +
Sbjct  384  IQQQLSEFFEGKDLSVHLNGDEAMALGAAFRAANLSNS  421

>H310_06229
Length=800

 Score = 223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 132/392 (34%), Positives = 212/392 (54%), Gaps = 18/392 (5%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKFS P VQ +IK++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIKNYGFKCVELPSGQVGIVLNYNDNPVTYTCEQVVAMMLN  123

Query  132  KMREVAEAFIGKEVKNA--VITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAY  189
            K++ +A A   + V+ A  V++ P YF D QR+A  +A  IAG+N LR++NE TA A+ Y
Sbjct  124  KLQNIA-AVANENVRPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGY  182

Query  190  GLDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  242
            G+ K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L
Sbjct  183  GIYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFAL  242

Query  243  VDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNS  300
                  +F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S
Sbjct  243  AKDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSALNIECLVDEIDYAS  302

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--  358
             ++   FE +      +   P++  L DA L+  ++  V +VGG  R+  V++ L+D   
Sbjct  303  KVSLEEFETLIAPLLERLEAPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLADILG  362

Query  359  FNGKEP----CKSINPDEAVAFGATVQAAILS  386
             + ++P      ++N DEAVA G  +Q AILS
Sbjct  363  LDKEKPNMGLSTTLNADEAVARGCALQCAILS  394

>PHYKE_6664
Length=804

 Score = 222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 131/391 (34%), Positives = 210/391 (54%), Gaps = 16/391 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +I    ++    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYECVELASGDVGIVLSYNDEPVTFSCEQVVAMILN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAG+N LR+INE TA A+A+G
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALMNATKIAGLNCLRLINEHTAIALAFG  183

Query  191  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K           ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
                 +F  K++ D   + ++  +L +ACE+AK+ LS       +I I+ L D  D+N+ 
Sbjct  244  QDVAKKFAEKYKTDPLAHPKSRLKLLSACEKAKKNLSPYGVTATHINIECLADDRDYNAQ  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN-  360
            ++   FE +     ++   P+E+ L+DA + KSQ+  V +VGG TR+  V++ L+D    
Sbjct  304  VSLEEFEVLIAPLLKRLDGPIERALKDAGIDKSQLTSVEIVGGGTRVTSVKRQLADVLGL  363

Query  361  GKEP-----CKSINPDEAVAFGATVQAAILS  386
             KE        ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

>PYAR_16202
Length=893

 Score = 223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/394 (34%), Positives = 206/394 (52%), Gaps = 21/394 (5%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  33   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGEERLYGADAATVGVRRPQTC  92

Query  72   VFDAKRLIGRKFSDPIVQSDIK--HWPFKLSSGAGDKPQITVQFKGES-KTFQPEEISSM  128
                +R +G    DP + + I+  ++P++L     +  + TV  K +  + F  EE+ +M
Sbjct  93   YAQIRRFLGTTKEDPAISALIQDEYFPYEL---LHNDTRGTVALKHDKGQVFSAEELVAM  149

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            V    R + +AF    VK+ V+TVP +F  +QRQA  DA  I+G+  L ++NE TAAA+ 
Sbjct  150  VFTHARHITDAFAEVPVKDWVVTVPDFFTQAQRQAMLDAAEISGVRALSLLNENTAAALQ  209

Query  189  YGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHLG  234
              +     E R VL ++LG  +  VS+      +             FEV + A D  LG
Sbjct  210  LAVHSTFAEPRRVLFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTVSGFEVLSKAWDASLG  269

Query  235  GEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  294
            G  FD RL +H  +EF  K  +D+ +  R + ++R   ++ K  LS++ Q  + + SL+ 
Sbjct  270  GAKFDLRLAEHLAAEFSEKLGEDVRQLPRPMAKIRAQAKKTKIVLSANEQIPVVMQSLYK  329

Query  295  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  354
             +DF +++TR++ E++C D F + M+PVE+ L  A L K  +HE+ ++GG  R+PK+QQ 
Sbjct  330  DVDFFTSMTRSKLEEICKDLFAQAMKPVEQALEKAGLKKDDIHEIEIIGGGVRMPKIQQQ  389

Query  355  LSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            L DFF GK+    +N DEA+A GA   AA LS +
Sbjct  390  LKDFFEGKDLGVHLNGDEAMALGAAFHAANLSNS  423

>CCA27145
Length=463

 Score = 214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 137/407 (34%), Positives = 207/407 (51%), Gaps = 35/407 (9%)

Query  6    TSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV  64
            T   + +GIDLGTTYS V + Q++ V II +   +   PS V F  +   L+G  A+   
Sbjct  53   TGREHVIGIDLGTTYSVVAISQHNNVTIIPDRHHHTLIPSIVTFLPEGALLVGRQARAYR  112

Query  65   AMNAHNTVFDAKRLIGRKFSDPIVQSDIKHW---PFKLSSGAGDK----PQITVQFKGES  117
              +  +T+++AKR IGR +++ I  ++   +   PF+  S +  +    P  ++   G  
Sbjct  113  TKDPRHTIYNAKRFIGRSYNESIQAAEPYGFSIEPFRNESASEPESLPGPCFSLSVSGHP  172

Query  118  KTFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVL  176
                P EI S+++  +  +A  F+   ++   VI VP  F  +QR+AT  A   AG+ V 
Sbjct  173  ACVTPIEIGSLIIRHLHLMAHEFVKHNQLDRVVIAVPVDFKPAQRRATVQAYEKAGLKVA  232

Query  177  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  236
            R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G   V  T GD +LGGE
Sbjct  233  RVLEEPTAAAIAYGLHQAPNVNFILVFDFGGGTLDVSLLFVRSGSISVVDTLGDNNLGGE  292

Query  237  DFDNRLVDHFVSEFK------------------RKHRKDITENQRALRRLRTACERAKRT  278
            D DN + +H  S+ +                   +  +D  +    +  +R A E  KR 
Sbjct  293  DLDNLVSNHLTSQLEALLGMKLAEASSEVMETDSEKNEDPDQLPCTIAGIRRAAEILKRK  352

Query  279  LSSSAQAYIEIDSLFDGIDF-------NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL  331
            LS S  A         G            +++R  FE +C     + + PV ++LRD  +
Sbjct  353  LSFSDSAIASCIVQEPGGKLIPQDNRVEISMSRIEFEALCEPILERALIPVRQILRDNHM  412

Query  332  SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            +   + EVVLVGGS+RIP +   L + F GK+P  +I+PD AVAFGA
Sbjct  413  NPKSIDEVVLVGGSSRIPWIHTQLEELF-GKQPRITIDPDVAVAFGA  458

>H257_16484
Length=795

 Score = 219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/391 (33%), Positives = 210/391 (54%), Gaps = 16/391 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKFS P VQ +I+++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIQNYGFKCVELPSGQVGIVLNYNDNPVTYSCEQVVAMMLN  123

Query  132  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            K++ +A  A  G      V++ P YF D QR+A  +A  IAG+N LR++NE TA A+ YG
Sbjct  124  KLQNIAAVANDGVNPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGYG  183

Query  191  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L 
Sbjct  184  IYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFALA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
                 +F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S 
Sbjct  244  KDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSVLNIECLVDEIDYASK  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--F  359
            ++   FE +     ++   P++  L DA L+  ++  V +VGG  R+  V++ L++    
Sbjct  304  VSLDEFETLIAPLLQRLEGPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLAEILGL  363

Query  360  NGKEP----CKSINPDEAVAFGATVQAAILS  386
            + ++P      ++N DEAVA G  +Q AILS
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAILS  394

>PHYSO_255506
Length=1228

 Score = 221 bits (564),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 135/398 (34%), Positives = 219/398 (55%), Gaps = 25/398 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  70
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  364  GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAAT--VGVRRPQ  421

Query  71   TVF-DAKRLIGRKFSDPIVQS--DIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            T +   +RL+G   SDP V +  D +H+P++L   A     +++Q   + + F  EE+ +
Sbjct  422  TAYAQIRRLLGTTLSDPQVAALLDEEHFPYQLLQNATRGGTVSLQH-AKDRVFHAEELVA  480

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MV    R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TA+A+
Sbjct  481  MVFAHARQITDTFAEAPVKDWVLTVPAFFSQAQRQAMLDAAEISGVRVLSLINENTASAL  540

Query  188  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  230
               +    D +   + +L +++G  +  VS+      +             F+  + A D
Sbjct  541  QLAVHASYDPEDKPKRILFYNMGSTSLQVSVAEFSSQVVPDGFKKNKTISTFQTLSNAWD  600

Query  231  THLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  290
              LGG  FD RL +H   EF  K  +DI +  R + ++R   ++ K  LS++ +  + + 
Sbjct  601  ESLGGAKFDLRLAEHLAKEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEIPVVMQ  660

Query  291  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  350
            SL++ IDF ++ITR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG  R+PK
Sbjct  661  SLYNDIDFFTSITRSKLEELSADLFDRTLKPVEVALEKAGLTVADIDEIEIIGGGVRMPK  720

Query  351  VQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            +QQ LS+FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  721  IQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  758

>PHYKE_9011
Length=902

 Score = 219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/398 (33%), Positives = 220/398 (55%), Gaps = 25/398 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  70
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAA--TVGVRRPQ  85

Query  71   TVFDA-KRLIGRKFSDPIVQS--DIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            T +   +RL+G K  +P V++  + +H+P+ L         ++++ + +   +Q EE+ +
Sbjct  86   TAYQQIRRLLGTKLENPQVKALLEEEHFPYNLLQNVTRGGTVSLKHR-DGHIYQAEELVA  144

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MV    R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  145  MVFTHARQITDTFAEAAVKDWVVTVPAFFSQAQRQALLDAAEISGVRVLSLINENTAAAL  204

Query  188  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  230
               +    D +   R +L +++G  +  VS+      +             F+  + A D
Sbjct  205  QLAVHASYDPEDKPRRILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWD  264

Query  231  THLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  290
              LGG  FD RL +H  +EF  K  +D+ +  R + ++R   ++ K  LS++ +  + + 
Sbjct  265  ESLGGARFDLRLAEHLATEFSEKIGEDVRKVPRPMAKIRAQAKKTKMVLSANEEIPVVMQ  324

Query  291  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  350
            SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ LVGG  R+PK
Sbjct  325  SLYNDIDFFTSMTRSKLEELSADLFERTLKPVEVALEKAGLTVADIDEIELVGGGVRMPK  384

Query  351  VQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            +QQ L++FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  385  IQQQLAEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

>SDRG_01067
Length=611

 Score = 213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 136/383 (36%), Positives = 206/383 (54%), Gaps = 12/383 (3%)

Query  6    TSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  65
            +S  + V ID+GT+   VGVW+N RV ++A D G  + P+ VAFTDT  L G  AK    
Sbjct  2    SSNTHCVAIDIGTSRVRVGVWRNGRVHVLALD-GAESLPAVVAFTDTLTLFGHQAKAYAQ  60

Query  66   MNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEI  125
             +  N V +A +L+GR+ +DPIVQ+ +   PF++ + +   P I VQ +  + T+ P+EI
Sbjct  61   DHPTNVVSNALQLLGRRMNDPIVQAAVAGAPFRIRASSDKTPLICVQHQRSACTYYPQEI  120

Query  126  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAA  185
             +M+L  +R  AE  +G  + +AV+TVPA +  SQRQA  DA  +AG  V R+++  TAA
Sbjct  121  IAMLLEHVRTSAECHLGSCLDHAVVTVPATYTTSQRQAIVDAATMAGWTVDRLLSATTAA  180

Query  186  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  245
            AIA        +R +L+ D G      S+++ E   F   A+A D H+ G   D RL  +
Sbjct  181  AIAQVHATGADKRRLLVVDAGASAVTASVVTAEYDTFTAHASASDMHVSGSAMDARLAAY  240

Query  246  FVSEFKRKHRKDITENQRAL-----RRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
             +S +    R  I  N  A      +RL +ACE A+  LS++ +  + I  L+   D   
Sbjct  241  CMSSW----RPSIIGNDFAFSASTKQRLLSACEAARCALSTTNETQLCIPRLYRDEDVAL  296

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            +++R + + +      K +  V KVL+ AK  K  V ++VLVGG   +P +Q  LS+ F 
Sbjct  297  SLSREKLDALVDHLMDKVVVLVRKVLQQAKCVKDDVEDIVLVGGVASMPYLQSTLSNVFC  356

Query  361  GKEPCKSINPDEAVAFGATVQAA  383
            GK       P  AV  GA +  A
Sbjct  357  GKTVACLATP--AVVAGAALYVA  377

>PYAP_21865
Length=481

 Score = 210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/411 (34%), Positives = 204/411 (50%), Gaps = 47/411 (11%)

Query  10   YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  69
            ++VGIDLGTTYS V + QN+ V +I ++ G+  TPS VA+    R    A + +   +  
Sbjct  71   HTVGIDLGTTYSVVAISQNNSVTVIPDEHGHLITPSIVAYLPNGRREARAYRTK---DPR  127

Query  70   NTVFDAKRLIGRKFSDPIVQSDIKH-WPFKLS-SGAGDKPQITVQFK----GESKTFQPE  123
            +T+F+AKR IGR F D  V  D    WP++ +    G+    TV F+    G      P 
Sbjct  128  HTIFNAKRFIGRSFRD--VSDDASTTWPYEFTIKRYGEHDNATVCFELETVGHPNCISPV  185

Query  124  EISSMVLIKMREVAEAFIGK-------------------EVKNAVITVPAYFNDSQRQAT  164
            ++ + ++  ++ +A  F+G                    ++  AVI VP  F+  QR AT
Sbjct  186  DVGTRIVQHLKTLAWRFVGHNQMGMIDNLLSGLTHNYCGQINRAVIAVPVDFDSKQRSAT  245

Query  165  KDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  224
              A   AG+ V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V
Sbjct  246  VAAFNAAGLKVSRVLEEPTAAAIAYGLHQDASVNFILVFDFGGGTLDVSLLFARSGSISV  305

Query  225  KATAGDTHLGGEDFDNRLVDHFVSEFKRK-------------HRK-DITENQRALRRLRT  270
              T GD +LGGED D  +  H +   + K             H + D   +  AL   + 
Sbjct  306  IDTMGDNNLGGEDLDAAIAHHLIQNLEVKLGAVSSGGSGVDAHEQLDHDGDSEALPCTKA  365

Query  271  ACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI---TRARFEDMCGDYFRKTMEPVEKVLR  327
               RA   L  S  + +E  +     D N  I   +R   E +C    ++T+ PV ++L 
Sbjct  366  GIRRAAEMLKRSLSSSLEASASCLTTDNNRVIMAMSRYELESICEAILKRTLVPVREILE  425

Query  328  DAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
               ++   +  VVLVGGSTR+P V++ L+  F G+ P   I+PD AVA+GA
Sbjct  426  ANSMTIQDIDAVVLVGGSTRLPWVRRELTAMFGGRPPLTDIDPDVAVAYGA  476

>PYIR_16738
Length=555

 Score = 210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 126/160 (79%), Gaps = 2/160 (1%)

Query  9    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  67
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  31   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  90

Query  68   AHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
               T+FD KRLIGR ++D  VQ+D K  P+K+    G KP I V  KGE K F PEEIS+
Sbjct  91   PEQTLFDVKRLIGRSYNDKSVQADKKLLPYKIVDKDG-KPAIEVPIKGEKKLFSPEEISA  149

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDA  167
            M+L KM+++AE ++GK++ +AV+TVPAYFND+QRQATKDA
Sbjct  150  MILTKMKQIAEGYLGKDIHDAVVTVPAYFNDAQRQATKDA  189

 Score = 192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 1/161 (1%)

Query  290  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  349
            DSL DG DF+ T++RARFE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIP
Sbjct  194  DSLLDGEDFSETLSRARFEKLNEDLFKKTLGPVEKVLKDAGVKKSEVDEIVLVGGSTRIP  253

Query  350  KVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslgl  409
            KVQQL+ D+FNGKEP + +NPDEAVA+GA VQ  ILSG    E L D++L+DV PLS G+
Sbjct  254  KVQQLIKDYFNGKEPSRGVNPDEAVAYGAAVQGGILSG-AEQEGLGDMVLIDVVPLSQGI  312

Query  410  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            ET GGVMT LI +NT +PTKKSQ FST+ DNQP V I+V+E
Sbjct  313  ETVGGVMTKLINKNTAIPTKKSQVFSTHVDNQPAVSIKVYE  353

>PHYSO_549561
Length=361

 Score = 204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 155/210 (74%), Gaps = 2/210 (1%)

Query  242  LVDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300
            +V+H ++EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+S
Sbjct  1    MVEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSS  60

Query  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360
            T+TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F 
Sbjct  61   TVTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFG  120

Query  361  GKEPCKSINPDEAVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  420
            GKE  KSINPDEAVA+GA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI
Sbjct  121  GKELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLI  179

Query  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             RNT +P +K++ ++T  D Q  V + ++E
Sbjct  180  KRNTAIPVRKTRVYTTEEDYQTSVDVCIYE  209

>SDRG_03266
Length=792

 Score = 213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/391 (34%), Positives = 202/391 (52%), Gaps = 16/391 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFSCEQVVGMFLN  123

Query  132  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A  A  G      VI+ P YF D QR+A   A  IAGMN LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSASKIAGMNCLRLMNEHTAVALSYG  183

Query  191  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFIDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
                 +F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--F  359
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+  V++ L+D    
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  360  NGKEP----CKSINPDEAVAFGATVQAAILS  386
            + ++P      ++N DEAVA G  +Q AILS
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAILS  394

>SPRG_08060
Length=793

 Score = 213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/391 (34%), Positives = 202/391 (52%), Gaps = 16/391 (4%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFTCEQVVGMFLN  123

Query  132  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A  A  G      VI+ P YF D QR+A   A  IAGMN LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSAAKIAGMNCLRLMNEHTAVALSYG  183

Query  191  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFVDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
                 +F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--F  359
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+  V++ L+D    
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  360  NGKEP----CKSINPDEAVAFGATVQAAILS  386
            + ++P      ++N DEAVA G  +Q AILS
Sbjct  364  DKEKPNMGLSTTLNADEAVARGCALQCAILS  394

>PPTG_04054
Length=324

 Score = 201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 162/255 (64%), Gaps = 25/255 (10%)

Query  83   FSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIG  142
            FSD +++ D  ++ F       DK  I              EISSMV+++M E+AEAF+G
Sbjct  2    FSDKVMKKDATYFLFTTKESDDDKVLI--------------EISSMVVLRMSEMAEAFLG  47

Query  143  KEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGER----  198
            + +  AV+T PAYFN+ QRQ+TKD  +IAG+++ RI NE + AA+AYGLD   G      
Sbjct  48   QRISQAVVTAPAYFNNQQRQSTKDVVSIAGLDLQRINNETSVAALAYGLDTNAGTDGKAC  107

Query  199  NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRK-D  257
            NV IF LGGGT DVS+LSI     EVK+T GD+   GED DN +V H ++EF+RK R  D
Sbjct  108  NVQIFVLGGGTVDVSILSIRVRHLEVKSTGGDS---GEDSDNNMVQHLLTEFERKIRNLD  164

Query  258  ITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST-ITRARFEDMCGDYFR  316
             + + RA   + TACE AKR L ++  A +E+ SLF+G++F+ST +TRA+FE +  + F+
Sbjct  165  PSGSARA--SVVTACESAKRMLLTTTSASVEVTSLFEGVEFSSTVVTRAKFESLNEELFK  222

Query  317  KTMEPVEKVLRDAKL  331
            +    V KVL DAK+
Sbjct  223  RCEVTVFKVLEDAKM  237

>PYAR_15468
Length=769

 Score = 211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 119/362 (33%), Positives = 202/362 (56%), Gaps = 11/362 (3%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G T   +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNTDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +I    F           + +++  E+ TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAFPCVELPNGDVGVVLRYNDEAVTFTCEQVVAMILN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVRPAYAVLSCPGFYTDVQRRALLNAAKIAGVNCLRLLNEHTAVALAYG  183

Query  191  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K       +   ++V+  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  L 
Sbjct  184  IYKSARNLFAESEPQHVMFIDMGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYALA  243

Query  244  DHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  301
            +   ++F+ K++ +  ++ +A  +L + CE+AK+ LS       ++ ++SL +  D++  
Sbjct  244  EDVAAQFEAKYKVNPLKDAKARIKLLSGCEKAKKNLSPHGVTATFLNVESLAEDRDYSGQ  303

Query  302  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  361
            +T  RFE++      +   P+++ L DA + K+Q+  V +VGG+TR+     +LS  F  
Sbjct  304  VTLERFEELIAPLLNRLEGPIQRALADAGIDKAQLASVEIVGGATRVSSC-AILSPVFKV  362

Query  362  KE  363
            KE
Sbjct  363  KE  364

>PYIW_14231
Length=1243

 Score = 212 bits (539),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 153/492 (31%), Positives = 250/492 (51%), Gaps = 72/492 (15%)

Query  5    TTSTGYSVGIDLG-----TTYSCVGVWQNDRVEIIANDQGNRTT---PSYVAFTDTERLI  56
            T    + +GID+G     TT S  GV  +  V +  ++Q +  T   P+YV+ TD++ ++
Sbjct  7    TPKDSWCIGIDIGAHFFSTTVSKDGVAVD--VPLEEHEQDDTKTHLLPAYVSVTDSDFIV  64

Query  57   GDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGE  116
            G  A+ +      NT+FD  R++GRK SD +   D+  WPFK+  G  DK  + ++    
Sbjct  65   GSEARKRAKSGDSNTIFDFVRIVGRKISD-LNAGDLSKWPFKVVPGDNDKAVVEIRTSTN  123

Query  117  SKT-------FQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGA  169
              T       F PEE+ ++++  ++E  E  +G  V +AV+ VP  FN +Q +A ++A  
Sbjct  124  GSTASVSFRMFHPEELLAVLVRCIKEKVEMMLGAVVDSAVVCVPGGFNHTQCRAVRNAFT  183

Query  170  IAGMNVLRIINEPTAAAIAYGLDKKGGERN-----VLIFDLGGGTFDVSLLSIEEGIFEV  224
            IAG+   +++   TA AI++GLD +    N     VL+ D+G  T D++L+S+    FEV
Sbjct  184  IAGLRTEKLLGAATATAISFGLDIRTDIANAAMQLVLVVDIGASTTDIALVSVLANKFEV  243

Query  225  KATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDIT---ENQ--------RALRRLRTACE  273
            KA   D  LGG+DF +R+  H      RK  +++T   EN         + + ++R ACE
Sbjct  244  KAVDSDLGLGGDDFTDRIAAHC----HRKKTQEVTPSGENAVANTQGYVKGVHQIRHACE  299

Query  274  RAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVEKVL  326
             AK+ LSSS  A +       GIDF +       T+TR  FE +C D ++  +E V +V+
Sbjct  300  LAKKLLSSSLTAVV-------GIDFPTSDTFGYYTVTRTGFEALCMDPWQHALERVHRVI  352

Query  327  RDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKS-------INPDE-AVAFGA  378
            +++  SK  +  V+LVGGS +IP++Q L  + F  +E   +       ++P   A AF +
Sbjct  353  QESSASKDDITTVLLVGGSFQIPRLQTLFKESFPSQEVVVAGAQSPPILSPARGAAAFSS  412

Query  379  TVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYA  438
             V+  +            L +          ++  G    +I RNT++P  KS  F  YA
Sbjct  413  AVRRGVPGAELLEVTPLSLGI----------QSVAGTRIMMIPRNTSIPVHKS--FLYYA  460

Query  439  DNQPGVLIQVFE  450
            + Q  V++ V E
Sbjct  461  NCQHAVIVYVIE  472

>PHYSO_285382
Length=379

 Score = 199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 180/353 (51%), Gaps = 28/353 (8%)

Query  53   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKH---WPFKLS-----SGAG  104
            E ++G  A+     +  +T+F+AKR IGR F D + +S++      P++ +       A 
Sbjct  23   EVIVGRKARAHRTTDPTHTIFNAKRFIGRSFDD-VGESEVDSNGVSPYEFTVKPVLDNAH  81

Query  105  DKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQA  163
            D     + F G+     P +I S V+  +R +A  F+G  ++  AVI VP  FN  QR A
Sbjct  82   DGVCFALGFPGQQDCVTPVQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVDFNARQRDA  141

Query  164  TKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  223
            T  A  +AG+ V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   
Sbjct  142  TVAAFRVAGLEVSRVLEEPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAIS  201

Query  224  VKATAGDTHLGGEDFDNRLVDHFVSEF----------------KRKHRKDITENQRALRR  267
            V  T GD HLGGED D  L    V EF                ++    D T+    L  
Sbjct  202  VLDTLGDNHLGGEDVDALLTAWLVREFEAQIGSRITSRGVEGEEKSLDDDATDPPCTLAG  261

Query  268  LRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKV  325
            +R A E  KR L+ +  A         G      +  +RA+FE++CG    +TM PV  V
Sbjct  262  VRRAAELLKRRLTDATTASATCVWSEGGSKARVEVKASRAQFEELCGPLLERTMIPVRDV  321

Query  326  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
            L    +   ++  VVLVGGS+RIP V+Q L+  F  + P  +I+PD AVA+GA
Sbjct  322  LEANNMETEEIDAVVLVGGSSRIPWVRQRLTTMFQDRAPLSTIDPDLAVAYGA  374

>PYIR_25979
Length=438

 Score = 201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 126/400 (32%), Positives = 208/400 (52%), Gaps = 53/400 (13%)

Query  10   YSVGIDLGTTYSCVGVWQNDRVEIIANDQ-------GNRTTPSYVAFTDTERLIGDAAKN  62
            +SVGIDLGT      + ++  V  ++ D+        N   PS+V+ TD+  L+G  A+ 
Sbjct  34   WSVGIDLGTQVCSAALIRDGIVIDVSFDEEQQQDSSPNLLLPSFVSATDSGFLVGADARR  93

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGES-----  117
            +      +TVFD  RL+GRK  D   Q  +  WPFK+  G  DK  I +           
Sbjct  94   RARSGDPSTVFDFVRLVGRKIEDLSSQDILCKWPFKVVPGENDKAMIEISAIDTKDSAST  153

Query  118  ------KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIA  171
                  +TF PEE+ + +++K+++ AEA +  +V++ V+ VP  FN SQR+A ++A  IA
Sbjct  154  STSDVIRTFHPEELVAALIMKIKQKAEALVSAKVESTVVCVPGGFNHSQRRAVRNACVIA  213

Query  172  GMNVLRIINEPTAAAIAYGLDKKGG-------ERNVLIFDLGGGTFDVSLLSIEEGIFEV  224
            G+ V +I++  TAA  ++G+ ++          + VL  D+G  + D+SL+S+    FEV
Sbjct  214  GLRVEKILSAATAAVTSFGMKEQNAGTAAGIPTQVVLAVDVGASSTDISLVSVLANKFEV  273

Query  225  KATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITEN--------------QRALRRLRT  270
            KA   +  LGG+DF  R+V H   +  R+      E                +   ++R 
Sbjct  274  KAVDSNLDLGGDDFTERIVTHCRRKKSREEAAAAPEPGDTVKTASSQTHGYSKGASQIRQ  333

Query  271  ACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVE  323
            ACE AK+ LSSS  A +       GIDF +       T+TR  FE +C D ++  +E V 
Sbjct  334  ACELAKKLLSSSENAVV-------GIDFPASDTFGYYTVTRFCFEALCEDLWQSLVEKVH  386

Query  324  KVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  363
            +V+ ++ + K  ++ V+L+GGS++IP++Q L  + F  ++
Sbjct  387  RVIHESSVVKEDINAVLLMGGSSQIPRLQTLFKESFPSQQ  426

>PYIR_24220
Length=908

 Score = 209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/397 (34%), Positives = 221/397 (56%), Gaps = 25/397 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  70
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G DAA   VA+    
Sbjct  31   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVAVRRPQ  88

Query  71   TVFDA-KRLIGRKFSDPIVQSDIK--HWPFKLSSGAGDKPQITVQFKGESKTFQPEEISS  127
            T +   +R +G     P V S ++  ++P+ L   A  +  I+++   + K F  EE+ +
Sbjct  89   TAYSQIRRFLGATPDHPQVVSLLQEEYFPYTLLQNAT-RGTISLEHDNK-KVFHAEELVA  146

Query  128  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAI  187
            MV    R++ +AF    VK+ VITVP++F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  147  MVFSHARQITDAFAEAPVKDWVITVPSFFSQAQRQAMLDAAEISGVRVLSLINENTAAAL  206

Query  188  AYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHL  233
             + +     E R +L +++G  +  VS+   +  +             F+V A A D +L
Sbjct  207  QHAVHSTFTEPRKILFYNMGSTSLQVSITEFKSEVVPDGFKKNKTVSGFQVLANAWDENL  266

Query  234  GGEDFDNRLVDHFVSEFKRK--HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDS  291
            GG  FD +L +H   EF +K  + +DI    R L ++R   ++ K  LS++ +  + + S
Sbjct  267  GGAKFDLQLAEHLAKEFNKKLGNGEDIRTIPRPLAKIRAQAKKTKIVLSANEEIPVVMQS  326

Query  292  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  351
            L+  +DF +++TR++FE++  D F +++EPV++ L  A LS S + E+ +VGG  R+PK+
Sbjct  327  LYKDMDFFTSMTRSKFEEINADLFARSLEPVKQALAKAGLSASDIDEIEIVGGGVRMPKI  386

Query  352  QQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            Q  L +FF+GK+    +N DEA+A G+  +AA LS +
Sbjct  387  QAQLKEFFSGKDLGVHLNGDEAMALGSAFRAANLSNS  423

>H310_01493
Length=909

 Score = 208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/397 (33%), Positives = 207/397 (52%), Gaps = 27/397 (7%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  +  +  V    + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  72   VFDAKRLIGRKFSDPIVQSDIK--HWPFKLSSGAGDKPQITVQFKGESK-TFQPEEISSM  128
                +RL+G   + P+V+S +K  ++P+ L+    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            V    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSLIDENTAAALQ  205

Query  189  YGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  231
            + L     + G    VL++++G  +  VSL+     I             FEV   A D 
Sbjct  206  HALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVIDFEVLGKAWDD  265

Query  232  HLGGEDFDNRLVDHFVSEFKRKHRK--DITENQRALRRLRTACERAKRTLSSSAQAYIEI  289
             LGG  FD RL D F  EF  K +K  D+ +  RA+ +LR A  + K  LS++ +  + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVLSANEEIPVVV  325

Query  290  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  349
             SL   +DF S+  R  FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSSAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAIEIIGGGVRIP  385

Query  350  KVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILS  386
            K+Q +L  +F  ++    +N DEA+A GA +  A LS
Sbjct  386  KIQSVLKTYFE-RDLGLHLNGDEAMALGAALHGANLS  421

>PYVX_15061
Length=891

 Score = 208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/397 (33%), Positives = 203/397 (51%), Gaps = 24/397 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+DLG  +  V  V      EI+ N    R T + VAF   ERL G  A         + 
Sbjct  27   GVDLGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATIGVRRPQSA  86

Query  72   VFDAKRLIGRKFSDPIVQSDIK--HWPFKLSSGAGDKPQITVQFKGESKT-FQPEEISSM  128
                +R +G    DP V + ++    P++L     D  + ++  K   K  F  EE+ +M
Sbjct  87   YAQVRRFLGATLDDPQVVALLEDERLPYELEQ---DLARGSIALKHSDKQLFHAEELVAM  143

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            V    R++ +AF    VK+ V+TVP YF+ +QRQA  DA  +AG+ VL +INE TAAA+ 
Sbjct  144  VFSHARQITDAFAEAPVKDWVVTVPVYFSQAQRQALLDAAELAGVRVLSLINENTAAALQ  203

Query  189  YGLD----KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  231
              +      +   + +L ++LG  +  VS+  +   +             F++ ++A D 
Sbjct  204  LAVHASVAPEDKPKRILFYNLGSTSLQVSVAELSAQVVPDGFKKNKTVSTFQMLSSAWDD  263

Query  232  HLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDS  291
             LGG  FD RL DH   EF  K  +D+    R + ++R   ++ K  LS++ Q  + + S
Sbjct  264  SLGGAKFDLRLADHLAKEFSDKIGEDVRTLARPMAKIRAQAKKTKIVLSANEQIPVVMQS  323

Query  292  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  351
            L+  +DF +++TR   E++C D F + + PV   L  A LS   + E+ LVGG  R+PK+
Sbjct  324  LYKDVDFFTSMTRGDLENLCEDLFPRALAPVAAALEKAGLSVDDIDEIELVGGGVRMPKI  383

Query  352  QQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            QQ L D+F GK+    +N DEA+A GA  +AA LS +
Sbjct  384  QQQLKDYFGGKDLGVHLNGDEAMALGAAFRAANLSNS  420

>H310_01496
Length=904

 Score = 208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 132/397 (33%), Positives = 206/397 (52%), Gaps = 27/397 (7%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  +  +  V    + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  72   VFDAKRLIGRKFSDPIVQSDIK--HWPFKLSSGAGDKPQITVQFKGESK-TFQPEEISSM  128
                +RL+G   + P+V+S +K  ++P+ L+    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            V    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSLIDENTAAALQ  205

Query  189  YGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  231
            + L     + G    VL++++G  +  VSL+     I             FEV   A D 
Sbjct  206  HALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVIDFEVLGKAWDD  265

Query  232  HLGGEDFDNRLVDHFVSEFKRKHRK--DITENQRALRRLRTACERAKRTLSSSAQAYIEI  289
             LGG  FD RL D F  EF  K +K  D+ +  RA+ +LR A  + K  LS++ +  + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVLSANEEIPVVV  325

Query  290  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  349
             SL   +DF S   R  FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSNAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAIEIIGGGVRIP  385

Query  350  KVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILS  386
            K+Q +L  +F  ++    +N DEA+A GA +  A LS
Sbjct  386  KIQSVLKTYFE-RDLGLHLNGDEAMALGAALHGANLS  421

>CCA21519
Length=929

 Score = 207 bits (527),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 126/398 (32%), Positives = 207/398 (52%), Gaps = 24/398 (6%)

Query  13   GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  Y  V + +  +  EI+ N    R T + VAF   ERL G  A        H  
Sbjct  41   GLDFGGEYFKVALVKPGKPFEIVTNVHSKRKTETMVAFDGEERLYGADADTIGVRRPHTG  100

Query  72   VFDAKRLIGRKFSDPIVQSDI--KHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMV  129
                +R +G       + S I  +++P+ LS+    +  I ++ + E K +  EE+ +MV
Sbjct  101  YAQIRRFLGSSLDQYGIVSLILEEYYPYSLSTNEK-RGSIHIKHEDE-KHYHAEEVVAMV  158

Query  130  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAY  189
               +R++ + F   +VK+ VITVP Y+  +QRQA  DA  +AG+ VL +INE TAAA+  
Sbjct  159  FSHVRQITDVFAETDVKDYVITVPEYYTQAQRQAVLDAAELAGLRVLSLINENTAAALQL  218

Query  190  GLD---KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHL  233
             +    +    + V+ ++ G  +  V++  +   +             F+V + A + HL
Sbjct  219  CIHTTLEPDTPKRVIFYNQGSTSLQVTIAELFSYVVPVGSSSNKTIIGFKVLSKAWNQHL  278

Query  234  GGEDFDNRLVDHFVSEFKRK---HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  290
            G    D RL +HF  EF  K   +++D+    + + +LR   ++ K  LS++ +  + + 
Sbjct  279  GSSQIDLRLAEHFAREFNEKVLHNKQDVRSLPKVMAKLRAQAKKTKIVLSANEEIPVVMQ  338

Query  291  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  350
            SL +  D  +T+TR   E++C D F + + PV + L  A L++  +HEV L+GG  R+PK
Sbjct  339  SLLEDYDLRTTVTRTLLEELCKDLFDQALGPVHEALEKANLTRQDIHEVELIGGGVRVPK  398

Query  351  VQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            VQ+LL +FFN  E    +N DEA+A GA  +AA LS +
Sbjct  399  VQRLLKEFFNVPELGAHLNGDEAMALGAAFRAANLSNS  436

>PPTG_17083
Length=304

 Score = 194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 147/214 (69%), Gaps = 11/214 (5%)

Query  124  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPT  183
            EISSMV+++M+E+AEAF+G+ +  AV+T PAYFN+ QRQ+TKD  +I G+++ RI NE +
Sbjct  23   EISSMVVLRMKEMAEAFLGQRISQAVVTAPAYFNNQQRQSTKDVVSITGLDLQRINNETS  82

Query  184  AAAIAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  239
             AA+AYGLD   G      NV IF LGGGT DVS+LSI     EVK+T GD+    ED D
Sbjct  83   VAALAYGLDTNAGTDGKACNVQIFVLGGGTVDVSILSIRVRHLEVKSTGGDS---AEDSD  139

Query  240  NRLVDHFVSEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  298
            N +V H ++EF+RK R  D + + RA   + TACE AKR L ++  A +E+ SLF+G++F
Sbjct  140  NNMVQHLLTEFERKIRNLDPSGSARA--SVVTACESAKRMLLTTTSASVEVTSLFEGVEF  197

Query  299  NST-ITRARFEDMCGDYFRKTMEPVEKVLRDAKL  331
            +ST +TRA+FE +  + F +    V KVL DAK+
Sbjct  198  SSTVVTRAKFESLNEELFMRCEVTVFKVLEDAKM  231

>HYAP_01538
Length=130

 Score = 187 bits (474),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 91/95 (96%), Gaps = 2/95 (2%)

Query  1   MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60
           MAQT +  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1   MAQTVS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58

Query  61  KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHW  95
           KNQVAMNAHNTVFDAKRLIGRKFSD +VQ+D+KHW
Sbjct  59  KNQVAMNAHNTVFDAKRLIGRKFSDAVVQADVKHW  93

>PYU1_G003764
Length=910

 Score = 203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 130/396 (33%), Positives = 213/396 (54%), Gaps = 23/396 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  31   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVSVRRPQTA  90

Query  72   VFDAKRLIGRKFSDPIVQSDIK--HWPFKLSSGAGDKPQITVQFKGESK-TFQPEEISSM  128
                +R +G     P V S ++  ++P+ L     ++ + T+  + ++K  F  EE+ +M
Sbjct  91   YSQIRRFLGATPDSPEVVSLLQEEYFPYTL---LKNETRGTISLEHDNKQVFHAEELVAM  147

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            V    R++ +AF    VK+ VITVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+ 
Sbjct  148  VFSHARQITDAFAEAPVKDWVITVPTFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQ  207

Query  189  YGLDKKGGE-RNVLIFDLGGGTFDVSLLS-----IEEGI--------FEVKATAGDTHLG  234
            + +     E R +L +++G  +  VS+       I +G         F++ A A D  LG
Sbjct  208  HAVHSTFTEPRRILFYNMGSTSLQVSIAEFNSEVIPDGFKKNKTVSAFQMIANAWDETLG  267

Query  235  GEDFDNRLVDHFVSEFKRK--HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  292
            G  FD +L +H   EF +K    +D+    R L ++R   ++ K  LS++ +  + + SL
Sbjct  268  GAKFDLQLAEHLALEFNKKLGGDEDVRTLPRPLAKIRAQAKKTKIVLSANEEIPVVMQSL  327

Query  293  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  352
            +  IDF +T+TR++FE++  D F + + PV++VL  A L+ + + E+ ++GG  R+PK+Q
Sbjct  328  YKDIDFFTTMTRSKFEEINADLFARALNPVQQVLNKAGLTVNDIDEIEIIGGGVRMPKIQ  387

Query  353  QLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            Q L +FFNGK+    +N DEA+A G+  +AA LS +
Sbjct  388  QRLKEFFNGKDLGVHLNGDEAMALGSAFRAANLSNS  423

>HYAP_04460
Length=818

 Score = 202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 129/393 (33%), Positives = 207/393 (53%), Gaps = 18/393 (5%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSMARMHYKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +++   F     +     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFKHPEVQQELQQLAFTCVELSSGDVGIVLTYNDEPVTFSCEQVVAMILN  123

Query  132  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A   G      V++ P Y+ D QRQA  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQHIAAAANEGVTPAYCVLSCPGYYTDVQRQALLNASKIAGLNCLRLMNEHTAIALAYG  183

Query  191  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  243
            + K           ++V+  D+G  ++ V++++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDVGHASYTVAVVAFVQGRLTVKSVAFDRFLGGRDFDLAIA  243

Query  244  DHFVSEFKRKHR--KDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  299
                ++F  K++    +  N +A  +L +ACE+AK+ LS    +   + I+ L +  D+N
Sbjct  244  KDAAAKFADKYKVANPLENNPKARMKLLSACEKAKKNLSPYGVSATQLNIECLAEDRDYN  303

Query  300  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  359
            + +T   FE +      +   PVE+ L DA L  + +  V +VGG TR+  V++ L++  
Sbjct  304  AQVTLEEFEALIAPLLERLNGPVEQALADAGLKATDLTNVEIVGGGTRVTSVKRHLAEVL  363

Query  360  N-GKEP-----CKSINPDEAVAFGATVQAAILS  386
               KE        ++N DE+VA G  +  AILS
Sbjct  364  GLDKEQQNYGLSSTLNADESVARGCALNCAILS  396

>H257_00287
Length=893

 Score = 201 bits (512),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 131/397 (33%), Positives = 205/397 (52%), Gaps = 27/397 (7%)

Query  13   GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  +  + + +  +  EI+ N    R T + V+F   ERL G  A N       N 
Sbjct  29   GVDFGGEFFKIALVKPGKSFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQNA  88

Query  72   VFDAKRLIGRKFSDPIVQSDIK--HWPFKLSSGAGDKPQITVQFKGESK-TFQPEEISSM  128
                +RL+G   + P+V+S  K  ++P+ L+    ++ + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPLVESMTKSEYFPYTLTH---NETRGSVGLKHDDEHTFHAEELVAM  145

Query  129  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            V    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAEGPVRDWVVTVPSYFAEAQRQAVIDAAEIAGIRVLSLIDENTAAALH  205

Query  189  YGLD----KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  231
            + L     + G    V+ +++G  +  VS++     I             FEV   + D 
Sbjct  206  HALSIDVPEVGKPTRVMFYNMGSTSLQVSVVEYTSRIVPDGFKKNKTIVDFEVLGKSWDE  265

Query  232  HLGGEDFDNRLVDHFVSEFKRKHRK--DITENQRALRRLRTACERAKRTLSSSAQAYIEI  289
             LGG  FD RL D F  EF  K +K  DI    RA+ +LR A  + K  LS++    + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDIRLVPRAMAKLRAAARKTKIVLSANEVIPVVV  325

Query  290  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  349
             SL   +DF S   R+ FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSNAKRSEFEALCADLFGRVLGPVESVLQKTGLAKTDLSAIEIIGGGVRIP  385

Query  350  KVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILS  386
            K+Q LL  +F  ++    +N DEA+A GA    A LS
Sbjct  386  KIQSLLKGYFE-RDLGLHLNGDEAMALGAAFHGANLS  421

>PHYSO_339667
Length=160

 Score = 181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 111/152 (73%), Gaps = 0/152 (0%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            VGIDLGTT S  GVW+N+ VEII N  G  +TPSYVAFTDT  L G+AAK Q   NA NT
Sbjct  8    VGIDLGTTCSRDGVWRNEDVEIIPNGDGAYSTPSYVAFTDTALLTGNAAKRQPTRNAENT  67

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
            VF+  +LIGRKFSDP +Q  I++WPFK+  G  D  Q+ VQ+KGE+K FQP EI +++L 
Sbjct  68   VFNIHQLIGRKFSDPALQLSIRYWPFKVECGPKDTAQVVVQYKGETKRFQPIEIVAILLC  127

Query  132  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQA  163
            +MR++AE ++ +EV  AV+TVP  FN  QRQA
Sbjct  128  EMRKMAEIYLDQEVTKAVLTVPGSFNYFQRQA  159

>PYU1_G000896
Length=711

 Score = 195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 142/482 (29%), Positives = 241/482 (50%), Gaps = 54/482 (11%)

Query  10   YSVGIDLGTTYSCVGVWQNDRVEI----------IANDQGNRTTPSYVAFTDTERLIGDA  59
            + +GID GT + C      D + +          I +++     P++V+ TDT  LIG  
Sbjct  58   WVLGIDFGT-HLCSAAVSRDGIVVDVPVPGDAAAIDDNKSPLAVPAFVSVTDTGYLIGTE  116

Query  60   AKNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGES--  117
            A+        NTVFD  RL+GRK  D +  +D   WPF + +G  DK  + +     S  
Sbjct  117  ARTLARRGDLNTVFDLTRLVGRKVGD-LSDADQARWPFHVVAGDHDKVLVAILGTNNSVS  175

Query  118  --KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNV  175
              +   PEE+ +++ ++++E AEA +  +++ AV+ VP  FN +QR+A ++AG IAG++V
Sbjct  176  NPRKLYPEELLAVLFLQLKENAEALLHTKLQTAVLCVPEGFNHTQRRAVRNAGMIAGLSV  235

Query  176  LRIINEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIE-EGIFEVKATAGD  230
             R++   TAAA+++G+          R ++  D+G    +++L++++   +FEVKA A D
Sbjct  236  TRLVCAATAAAVSFGIGSSVPSSLSTRVIMTVDIGASATNMALVAVKNRTVFEVKAVASD  295

Query  231  THLGGEDFDNRLVDH------------FVSEFKRKHRKDITENQ-RALRRLRTACERAKR  277
             +LGG D    +V H             VS        D +E+Q   +R++R A E AK+
Sbjct  296  LNLGGHDLTEAIVAHCQRRRPTPSPRFCVSSASASTPADTSESQLHGMRQIRHASEVAKK  355

Query  278  TLSSSAQAYIEIDSLFDGIDFN-STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  336
             LS+S  A + ID   D   F    +TRA FE +C +++++  E + ++L+++  +K  +
Sbjct  356  LLSTSTNAVVGID-FPDPSAFGYYNVTRACFEALCEEHWQRIRELMNQLLQESLATKEGI  414

Query  337  HEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI--NPDEAVAFGATVQAAILSGNdssekl  394
              +VL+GGS  IP+VQ L+ + F    P   +   P++     ++ + A L G  S    
Sbjct  415  DAIVLLGGSAWIPRVQTLVQESF----PLHHVLYTPEDV----SSARGAALCGGKSRNTQ  466

Query  395  qdlllldvtplslgl------ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQV  448
              +       L          ++A G    +I  NT +P  KS  F  YA+ Q  V+  V
Sbjct  467  NGISTAPAVELPDVTLLPLGIQSANGTKIVMIPSNTKLPVHKS--FLYYANCQHAVVFHV  524

Query  449  FE  450
             E
Sbjct  525  IE  526

>PPTG_18280
Length=384

 Score = 187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/352 (32%), Positives = 184/352 (52%), Gaps = 21/352 (6%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  72   VFDAKRLIGRKFSDPIVQS--DIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMV  129
                +RL+G   SDP V S  D +H+P++L   A     I+++  G+ +TF  EE+ +MV
Sbjct  88   YAQIRRLLGTTLSDPQVSSLLDEEHFPYELVQNATRGGTISLK-HGKDQTFHAEELVAMV  146

Query  130  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAY  189
                R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TAAA+  
Sbjct  147  FAHARQITDTFAEAAVKDWVLTVPAFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQL  206

Query  190  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  232
             +    D +   + +L +++G  +  VS+      +             F+  + A D  
Sbjct  207  AVHASYDPEDKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWDES  266

Query  233  LGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  292
            LGG  FD RL +H   EF  K  +DI +  R + ++R   ++ K  LS++ +  + + SL
Sbjct  267  LGGSKFDLRLAEHLAKEFSEKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEIPVVMQSL  326

Query  293  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  344
            ++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG
Sbjct  327  YNDIDFFTSMTRSKLEELSSDLFDRTLKPVEVALEKAGLTAADIDEIEIIGG  378

>PHYSO_247517
Length=794

 Score = 195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 193/350 (55%), Gaps = 16/350 (5%)

Query  53   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQ  112
            +R IG+AA +   M+  NT  D KRLIGRKF  P VQ +I    +K    A     I + 
Sbjct  30   QRFIGEAAISMARMHYKNTATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGDVGIVLN  89

Query  113  FKGESKTFQPEEISSMVLIKMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIA  171
            +  E  TF  E++ +M+L KM+ +A A   G      V++ P ++ D QR+A  +A  IA
Sbjct  90   YNDEPVTFSCEQVVAMILNKMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIA  149

Query  172  GMNVLRIINEPTAAAIAYGLDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  224
            G+N LR+INE TA A+AYG+ K       +   ++V+  DLG  ++ VS+++  +G   V
Sbjct  150  GLNCLRLINEHTAIALAYGIYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTV  209

Query  225  KATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA-  283
            K+ A D  LGG DFD  +     ++F  K++ +  EN ++  +L +ACE+AK+ LS    
Sbjct  210  KSAAFDRFLGGRDFDMVIAKDAAAKFAAKYKTNPLENPKSRIKLLSACEKAKKNLSPYGV  269

Query  284  -QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  342
               ++ I+ L D  D+NS +T   FE++      +   P+E+ L DA + KSQ+  V +V
Sbjct  270  TATHLNIECLADDRDYNSQVTLEEFEELIAPLLTRLDGPIERALADAGVEKSQLANVEIV  329

Query  343  GGSTRIPKVQQLLSDFFN-GKEP-----CKSINPDEAVAFGATVQAAILS  386
            GG TR+  V++ L++     KE        ++N DE+VA G  +  AILS
Sbjct  330  GGGTRVTSVKRHLAEVLGLDKEQQNYGLSTTLNADESVARGCALNCAILS  379

>CCI11769
Length=372

 Score = 186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/361 (33%), Positives = 182/361 (50%), Gaps = 38/361 (11%)

Query  53   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKL---------SSGA  103
            E L+G  A+     + H+T+++AKR IGR +++ I  +  K + F +         +S +
Sbjct  10   EILVGRQARAYRTKDPHHTIYNAKRFIGRSYNESIQAA--KPYGFSIEPIRNESATTSES  67

Query  104  GDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQ  162
               P  ++   G      P +I S+++  +  +A  F+   ++   VI VP  F  +QR+
Sbjct  68   LPGPCFSLNVSGHPSCVSPIDIGSLIIRHLHSMAREFVKHNQLDRVVIAVPVDFKAAQRR  127

Query  163  ATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF  222
            AT  A   AG+ V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G  
Sbjct  128  ATVQAYEKAGLKVARVLEEPTAAAIAYGLHQTPNVNFILVFDFGGGTLDVSLLFVRSGSI  187

Query  223  EVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRR---------------  267
             V  T GD +LGGED DN + +H +S+ +      + E+   +                 
Sbjct  188  SVVDTLGDNNLGGEDLDNLVSNHLISQLEALIGMKLAESSSEVMETDSEKTEDPDQLPCT  247

Query  268  ---LRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRK  317
               +R A E  KR LS +  A         G    +       +++R  FE +C     +
Sbjct  248  IAGIRRAAEILKRKLSYTHTAIASCIVQEPGGKLIAQDNRVEISMSRDEFETLCESILER  307

Query  318  TMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFG  377
             + PV ++LRD  +  + + EVVLVGGS+RIP +   L + F GK+P  +I+PD AVAFG
Sbjct  308  VLLPVRQILRDNNMDPNSIDEVVLVGGSSRIPWIHTQLEELF-GKQPRITIDPDVAVAFG  366

Query  378  A  378
            A
Sbjct  367  A  367

>PYIR_18381
Length=747

 Score = 193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/393 (32%), Positives = 200/393 (51%), Gaps = 43/393 (11%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEISQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  132  KMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A         AV++VP Y+ D QR+A  +A  IA +N LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDNVSPAYAVVSVPGYYTDVQRRALLNAAKIANLNCLRLINEHTAIALAYG  183

Query  191  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYA  241

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  299
            L       F+ K++ D   + ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKNFQDKYKIDPLADAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  300  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  359
            S +T  +F+++           +E +L+             +VGG TR+  V++ LS+  
Sbjct  302  SQVTLEQFDEL-----------IEPLLQQ------------IVGGGTRVSSVKRRLSEIL  338

Query  360  NGKEPCK------SINPDEAVAFGATVQAAILS  386
               +  +      ++N DE+VA G  +Q AI S
Sbjct  339  GLDKDAQNFGLSTTLNADESVARGCALQCAISS  371

>SDRG_01828
Length=866

 Score = 194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 127/403 (32%), Positives = 206/403 (51%), Gaps = 25/403 (6%)

Query  6    TSTGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  64
            T +    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N  
Sbjct  17   TVSASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIE  76

Query  65   AMNAHNTVFDAKRLIGRKFSDPIVQS--DIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
                       +R +G     P+V S  + +++P+ L+     +  + +Q   E  TF  
Sbjct  77   VRRPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSEH-TFHA  134

Query  123  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEP  182
            EE+++MV    +++   F    VK+ VITVP YF + QRQA  DA  IAG+ VL +I+E 
Sbjct  135  EELAAMVFGHAKQITNDFAEAPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDEN  194

Query  183  TAAAIAYGLDKKGGERN----VLIFDLGGGTFDVSLLSIEEGI-------------FEVK  225
            TAAA+ + +D +  E N    ++++++G  +  VS++  +  +             F+V 
Sbjct  195  TAAALHHAVDYEAAEPNTPERIMLYNMGSTSLQVSIVEYKTRVVPDGFKKNKTIVEFDVL  254

Query  226  ATAGDTHLGGEDFDNRLVDHFVSEF--KRKHRKDITENQRALRRLRTACERAKRTLSSSA  283
            A A D  LGG  FD RL + F +EF  K K+  D+ +  RA+ +LR A  + K  LS++ 
Sbjct  255  AKAWDETLGGAQFDLRLAEKFANEFNAKLKNGDDVRKIPRAMAKLRAAARKTKIVLSANE  314

Query  284  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  343
               + + SL   +D+    +R   E++  D F + +EPV+  L  A L+   +  V ++G
Sbjct  315  AIPVIVPSLHADLDYKGHASRTELEEIAADLFARVLEPVKSALDQAGLTVGDLSAVEIIG  374

Query  344  GSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILS  386
            G  RIPK+Q LL +F   ++  K +N DEA+A GA   AA LS
Sbjct  375  GGVRIPKIQALLQEFVQ-RDLGKRLNGDEAMALGAAFNAANLS  416

>HYAP_10418
Length=315

 Score = 182 bits (462),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 110/291 (38%), Positives = 150/291 (52%), Gaps = 25/291 (9%)

Query  111  VQFKGESKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGA  169
            +   G      P EI S ++  +R++A  F+G  ++  AVI VP  F+  QR  T  +  
Sbjct  22   INLDGHPDCITPVEIGSKIVRHLRDMAHRFVGHDQITKAVIAVPVDFDAKQRDDTVASFR  81

Query  170  IAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAG  229
             AG+ V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T G
Sbjct  82   AAGLEVSRVLEEPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNGAITVLDTLG  141

Query  230  DTHLGGEDFDNRLVDHFVSEFKRK--------------HRKDITENQRALRRLRTACERA  275
            D HLGGED D  L    V +F+ +              H  D  E    L  +R A E  
Sbjct  142  DNHLGGEDLDALLAAWLVKQFEAQLGSPITSRGTDADGHGNDDKELPCTLTGVRRAAEFL  201

Query  276  KRTLSSSAQAYIEIDSLFDGIDFNST--------ITRARFEDMCGDYFRKTMEPVEKVLR  327
            KR L+ +  A      ++DG D  +         +TR +FE +CG    +TM PV KVL 
Sbjct  202  KRQLTDAPTA--SASCVWDGADSQAVAKTRATVDMTRVQFEVLCGSLLERTMIPVRKVLE  259

Query  328  DAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGA  378
               +   ++  VVLVGGS+RIP V++ L+  F G+ P   I+PD AVA+GA
Sbjct  260  ANNMESEEIDAVVLVGGSSRIPWVRERLTVMFQGRAPLSDIDPDLAVAYGA  310

>CCI45987
Length=939

 Score = 192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 124/401 (31%), Positives = 200/401 (50%), Gaps = 30/401 (7%)

Query  13   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            G+D G  Y  V  V      EI+ N    R T + VAF   ER+ G  A        H  
Sbjct  41   GLDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGEERIYGADADTIGVRRPHTG  100

Query  72   VFDAKRLIGRKFSDPIVQSDI--KHWPF--KLSSGAGDKPQITVQFKGE-SKTFQPEEIS  126
                +R +G     P V S +  +++P+  KL+   G     T+  + E  + +  EE+ 
Sbjct  101  YAQIRRFLGSSLDHPGVLSLVTQEYFPYTLKLNEKRG-----TIHLEHEIEQLYHAEEVV  155

Query  127  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAA  186
            +MV   +R++ + F   +VK+ VITVP Y+  +QRQA  DA  I+G+ VL +INE TAAA
Sbjct  156  AMVFSHVRQITDVFAESDVKDYVITVPDYYTQAQRQAVLDAAEISGLRVLSLINENTAAA  215

Query  187  IAYGLD---KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  230
            +   +    +    + V+ ++LG  +  VS+      +             F V + A D
Sbjct  216  LQLCIHTSMEPNERKRVMFYNLGSTSLQVSIAEFYSYVVPVGSSSNKTVIGFSVLSKAWD  275

Query  231  THLGGEDFDNRLVDHFVSEFKRK---HRKDITENQRALRRLRTACERAKRTLSSSAQAYI  287
             HLG    D RL ++    F  +   +++D+    + + +LR   ++ K  LS++ +  +
Sbjct  276  EHLGSSKIDLRLAEYLARVFNEQVLHNKQDVRTLPKVMAKLRAQAKKTKIVLSANEEIPV  335

Query  288  EIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  347
             + SL D  D  + +TR   E++  D   + + PVE+ LR A L++  + +V L+GG  R
Sbjct  336  VMQSLLDDYDLRTVVTRTLLEEISKDLLDQVLGPVEEALRKANLTRGDIQDVELIGGGVR  395

Query  348  IPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILSGN  388
            +PKVQ LL +FFN +E    +N DEA+A GA  +AA LS +
Sbjct  396  MPKVQSLLKEFFNVQELGAHLNGDEAMALGAAFRAANLSNS  436

>SPRG_06288
Length=869

 Score = 192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 127/403 (32%), Positives = 206/403 (51%), Gaps = 25/403 (6%)

Query  6    TSTGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  64
            T +    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N  
Sbjct  17   TVSASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIE  76

Query  65   AMNAHNTVFDAKRLIGRKFSDPIVQS--DIKHWPFKLSSGAGDKPQITVQFKGESKTFQP  122
                       +R +G     P+V S  + +++P+ L+     +  + +Q   E  TF  
Sbjct  77   VRRPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSE-HTFHA  134

Query  123  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEP  182
            EE+++MV    +++   F    VK+ VITVP YF + QRQA  DA  IAG+ VL +I+E 
Sbjct  135  EELAAMVFGHAKQITNDFAEGPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDEN  194

Query  183  TAAAIAYGLDKKGGERN----VLIFDLGGGTFDVSLLSIEEGI-------------FEVK  225
            TAAA+ +G+D +  E N    ++++++G  +  VS++  +  +             F+V 
Sbjct  195  TAAALHHGVDYEAPEPNTPERIMLYNMGSTSLQVSIVEYKTRVVPDGFKKNKTIVEFDVL  254

Query  226  ATAGDTHLGGEDFDNRLVDHFVSEFKRK--HRKDITENQRALRRLRTACERAKRTLSSSA  283
            A A D  LGG  FD RL + F +EF  K  +  D+ +  RA+ +LR A  + K  LS++ 
Sbjct  255  AKAWDETLGGAQFDLRLAEKFANEFNAKLTNGDDVRKIPRAMAKLRAAARKTKIVLSANE  314

Query  284  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  343
               + + SL   +D+    +RA  E++  D F + ++PV+  L  A L+   +  V ++G
Sbjct  315  AIPVIVPSLHADLDYKGHASRAELEEIAADLFARVLDPVKSALDQAGLTVGDLSAVEIIG  374

Query  344  GSTRIPKVQQLLSDFFNGKEPCKSINPDEAVAFGATVQAAILS  386
            G  RIPK+Q LL  F   ++  K +N DEA+A GA   AA LS
Sbjct  375  GGVRIPKIQALLQAFVQ-RDLGKRLNGDEAMALGAAFNAANLS  416

>HYAP_01856
Length=289

 Score = 179 bits (453),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 164/289 (57%), Gaps = 13/289 (4%)

Query  37   DQGNRTTPSYVAFTDTERLI--GDAA-KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIK  93
            D+G RT PS V F    + +  GDAA + +      NT+   KRL+G+KF    V     
Sbjct  6    DRG-RTMPSVVHFDPQSQHVDVGDAAVEFETEPPVGNTIRSIKRLLGQKFVSKAVDVARI  64

Query  94   HWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKE--VKNAVIT  151
            +  + +   A     + V   G+    QPEE+ + VL +++  AEA+   +  + N VIT
Sbjct  65   YASYSVVPTAQGNVVLQVVRGGKRVQVQPEEVVASVLAELKASAEAYFDGQLSIDNVVIT  124

Query  152  VPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  211
            VPAYF+DSQR+AT  + ++AG   +R++NEPTAAA+AYGL    G++ V +FD GGGT D
Sbjct  125  VPAYFSDSQRKATLTSASMAGFKAVRLLNEPTAAAMAYGL-FLSGKKLVTVFDFGGGTLD  183

Query  212  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQ---RALRRL  268
            VSLL IE+G FEV    GDT+LGG+D DN LVDH +    R H  ++T  Q     + RL
Sbjct  184  VSLLRIEDGKFEVLGIGGDTNLGGDDIDNVLVDHLIEMLDRHH--NLTRAQVGDENMVRL  241

Query  269  RTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRK  317
            +   E AK  LS    A + +D + +      T+TR + E++CG   +K
Sbjct  242  KREVENAKIKLSEEEHAVVTVD-MANVPRITYTLTRRKLEELCGPIRKK  289

>PPTG_14555
Length=703

 Score = 185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 154/470 (33%), Positives = 234/470 (50%), Gaps = 44/470 (9%)

Query  11   SVGIDLGTTYSCVGVWQNDRVEII-----ANDQGNRTTPSYVAFTDT---ERLIGDAAKN  62
            S+GID G T     V  +  V  +      N +   + PS+V+   T   E  +G  A N
Sbjct  43   SIGIDFGRTKCEAAVVSDTGVATLIPLEPQNKENCYSLPSFVSMGVTRTGEWEVGLQAIN  102

Query  63   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGE-SKTFQ  121
            +       TVFD   L+G+K    +   D+  W F L +G   K  +    KG       
Sbjct  103  RAKAGHPYTVFDLTMLLGQKVK-ALSPQDVDRWAFNLQAGVAGKAVVECPAKGNVPDLLY  161

Query  122  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINE  181
            PE++++M+L  ++  AE F  K V  AV+TVPA FN +QRQA  DA  IA +NV R++  
Sbjct  162  PEQVAAMLLSTIKNRAEIFTKKRVTGAVVTVPAAFNRTQRQAVWDACRIADLNVSRLVIS  221

Query  182  PTAAAIAYGLDKKGG---ERNVLIFDLGGGTFDVSLLSIEE------GI-FEVKATAGDT  231
             TA+A+A  +        E+ +++ D G G  DV+L  + E      GI  EV+ATAG+ 
Sbjct  222  STASAVADSIIDGAAAVFEKTIVVVDCGAGGLDVTLARVREADGSSSGIEVEVEATAGNL  281

Query  232  HLGGEDFDNRLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDS  291
             LGGE   +RL +HF +E K       T N    RRLR AC   +R LS+S QA I++  
Sbjct  282  ELGGEALTDRLFEHFHNEVKAGDTSSKT-NPAFSRRLRRACALVQRILSTSQQAAIDLPW  340

Query  292  LFDG--------IDFNSTITRARFEDMCGDYFRKTME-PVEKVLRDAKLSKSQVHEVVLV  342
               G          F S+I RA F+++CG      +   VE+VL  AK+ K  +  V++ 
Sbjct  341  RTRGPGAVNGTAAGFTSSIWRADFDNLCGSEVWDNLPITVEQVLTRAKVKKEDLDAVLIT  400

Query  343  GGSTRIPKVQQLLSDFFNGKEPCKSIN--PDEAVAFGATVQAAILSGNdsseklqdllll  400
            GG+ ++PK++++L D     E    I   P+   A GA++ AA  +G+        +L  
Sbjct  401  GGAMKVPKLREVLGDCL--AEHWNRIMDLPEHTAAIGASMIAAQSTGH--------VLKN  450

Query  401  dvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
            + TPLSLG+ ++ G    ++  +T VPT ++Q +  YA  Q  +   + E
Sbjct  451  EPTPLSLGIRSSSGDTLVVVPASTAVPTHQAQLY--YASCQREINFDILE  498

>PYVX_18450
Length=386

 Score = 177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 176/360 (49%), Gaps = 54/360 (15%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLI--GDAAKNQVAMNAH  69
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF     +   G AA  + A+ + 
Sbjct  58   VGIDLGTTYSVVAISQRNNVTVIPDSHGHLIIPSMVAFLPDGEVTAAGIAAPYEFAIAS-  116

Query  70   NTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMV  129
                    L G   ++   + D+                      G      P  I S+V
Sbjct  117  --------LEGNTTAEVCFELDVP---------------------GHPPCSAPVSIGSIV  147

Query  130  LIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIA  188
            +  ++ +A+ F+G  ++ NAVI VP  FN+ QR AT +A   AG+ V R++ EPTAAAIA
Sbjct  148  VRHLKTMAQRFVGHDQITNAVIAVPVDFNERQRDATVEAFRAAGLVVSRVLEEPTAAAIA  207

Query  189  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVS  248
            YGL +      VL+FD GGGT DVSLL +  G   V  T GD +LGGED D+ +      
Sbjct  208  YGLHQDPTVNFVLVFDFGGGTLDVSLLFVRAGSIRVLDTLGDNNLGGEDVDSTIAAFLAD  267

Query  249  EFKRK----------------HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  292
            EF R+                  +D  E    +  +R A E  KR LSS+  A      +
Sbjct  268  EFARQLGVDRITSASSEIEEADSEDPDELPCTIAGVRRAAESLKRKLSSATTATAM--CV  325

Query  293  FDGIDFNS---TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  349
              G  + +   ++TRA+ E +C   F +TM PV  VL    ++ +++  VVLVGGS+RIP
Sbjct  326  VQGETYRTASVSMTRAQLETICRPLFERTMAPVRSVLEGNHMTPAEIDAVVLVGGSSRIP  385

>SPRG_11007
Length=426

 Score = 178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 136/190 (72%), Gaps = 7/190 (4%)

Query  258  ITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRK  317
            +T   RA+RRLRTACE+AKR LS S  A +E++ LF  +DF S+ITRARFED+C   FRK
Sbjct  1    MTTCDRAVRRLRTACEKAKRDLSISNTATLELEVLFGNVDFRSSITRARFEDLCSGLFRK  60

Query  318  TMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN----GKEPCKSI-NPDE  372
              +P+EKVLRDAK+ KSQV +VVL GGS R+PK+QQLLS FF      K+ C SI N +E
Sbjct  61   VTQPIEKVLRDAKIDKSQVRDVVLAGGSMRMPKMQQLLSSFFGERYADKKLCHSILNNNE  120

Query  373  AVAFGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQ  432
            A A GATV AA+   +D+S  +  LL+L V P S+G+ET GGVMTT+I+RNTT+P+KKS+
Sbjct  121  AAAHGATVMAAL--NDDTSPDVWHLLVLHVVPYSVGIETGGGVMTTVISRNTTIPSKKSE  178

Query  433  TFSTYADNQP  442
             F       P
Sbjct  179  EFKISQPQSP  188

>PHYCA_558934
Length=489

 Score = 177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 131/411 (32%), Positives = 216/411 (53%), Gaps = 31/411 (8%)

Query  56   IGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKG  115
            +G  A N        TVFD   L+G+K  + +   D+  WPF + +G   K  +    + 
Sbjct  11   VGKRAVNHAKAGHPYTVFDLTMLLGQKM-ESLSPQDMDRWPFTIRAGVAGKALVECPQRL  69

Query  116  ESKTF-QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMN  174
            +S     PE++++M+L  ++  AE F GK V  AV+TV A +N +QRQA +DA +IAG++
Sbjct  70   QSPALVYPEQVAAMLLSTIKHRAETFTGKTVTRAVVTVSAAYNRTQRQALRDACSIAGLS  129

Query  175  VLRIINEPTAAAIAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIE------EGIFEV  224
            V R++   TA+A+A            ++ +L+ D  G + +V+L S+       E   EV
Sbjct  130  VERLVVSSTASAVANAKSDTDATAVFDKTILVVD-SGASLNVTLASVNSNDNGAEVEVEV  188

Query  225  KATAGDTHLGGEDFDNRLVDHFVSEFKRKHRKDITENQRAL-RRLRTACERAKRTLSSSA  283
             ATAGD   GGE   +RL +HF+ E   +     T +  A  RRLR AC  A+R LSS  
Sbjct  189  TATAGDVEAGGEPLTDRLFEHFLQEINAEDVNSETTSSPAFSRRLRRACTLAQRVLSSFP  248

Query  284  QAYIEIDSL-FDGIDFNSTITRARFEDMCG-DYFRKTMEPVEKVLRDAKLSKSQVHEVVL  341
            Q   ++  L      F STI+R+ F+ +CG + + +  E VE+VL+ A++ K  V  +++
Sbjct  249  QVSFDVPPLQLRRGWFTSTISRSEFDSLCGLELWNRLPETVERVLKLAQVKKEDVDAILV  308

Query  342  VGGSTRIPKVQQLLSDFFNGKEPCKSIN--PDEAVAFGATVQAAILSGNdsseklqdlll  399
             GG+ ++PK +++L + F   E    I   P    A G    AA+++ N        +L 
Sbjct  309  TGGAMQVPKFREVLGECF--VEHWNRIKDLPKHTAAIG----AALIAKN-----NGYILK  357

Query  400  ldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450
             + T L+LG+ ++GG +  ++  +T VPT++S+ +  YA  Q  +   + E
Sbjct  358  NEPTSLALGIRSSGGDLLVIVPPSTCVPTRQSRVY--YASVQREIRFDILE  406

>PYIW_19676
Length=664

 Score = 177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/304 (35%), Positives = 163/304 (54%), Gaps = 14/304 (5%)

Query  12   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  71
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  72   VFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLI  131
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  132  KMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYG  190
            KM+ +A A         AV++VP Y+ D QR+A  +A  IA +N LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDNVSPAYAVVSVPGYYTDVQRRALLNAAKIANLNCLRLINEHTAIALAYG  183

Query  191  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  241
            + K    RN+         +  DLG  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDLGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYA  241

Query  242  LVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  299
            L      +F+ K++ D   + +A  +L +ACE++K+ LS    +  Y+ I+ L D  D++
Sbjct  242  LAKDAARQFQEKYKIDPLADAKARIKLLSACEKSKKNLSPQGVSATYLNIECLADDRDYH  301

Query  300  STIT  303
            S +T
Sbjct  302  SQVT  305

>PPTG_13159
Length=197

 Score = 165 bits (417),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 134/256 (52%), Gaps = 65/256 (25%)

Query  133  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAAAIAYGLD  192
            MR+ A+AFI                   R+ATKDAG IAG+NV R  +E T A IAYG D
Sbjct  1    MRKPAQAFI-------------------RKATKDAGDIAGLNVPRTFSESTIAVIAYGQD  41

Query  193  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVSEFKR  252
            KK GE  VL+FDL G TF+ SLL IE GIFEVKAT  +THLG EDFD             
Sbjct  42   KKDGESKVLVFDLSGRTFNESLLPIEAGIFEVKATDRNTHLGDEDFD-------------  88

Query  253  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  312
                   +   ALR      ER K     + QAYIE+DSLF GIDFN TI    FE MCG
Sbjct  89   -------KTGGALR------ERVK-----APQAYIEVDSLFVGIDFNLTIMFTHFEAMCG  130

Query  313  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSINPDE  372
             YFRKTM+PVE     A  S S           TR P V  L  +   G      I  D 
Sbjct  131  YYFRKTMDPVESF---ATPSCSSAR-------CTRSPAVGLLQQE---GVHQVDQI--DG  175

Query  373  AVAFGATVQAAILSGN  388
            AV +GATVQAAILS N
Sbjct  176  AVTYGATVQAAILSRN  191

Lambda      K        H        a         alpha
   0.317    0.132    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 32287011702

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40