Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_5721731729114190.0
PHYSO_29655271351374551e-55
PPTG_1667372581674572e-54
PITG_0000974181493261e-33
PHYRA_8727093152371042872e-29
PHYRA_78821236502371042872e-29
PPTG_1667693152401082863e-29
PPTG_16677236502401032854e-29
PHYSO_32560793152411102776e-28
PHYSO_484316707772411102776e-28
PITG_1130093152411082715e-27
PHALS_0897993152161002617e-26
PHYCA_50470393152331042557e-25
HYAP_0151493152971122431e-22
PHYSO_4865219314239912146e-19
PPTG_1667470777217941933e-16
PHYRA_788239313834931854e-14
PPTG_166969299218931732e-13
PITG_112849299216931722e-13
PHYSO_32560150506246891733e-13
PHYRA_788339299220931671e-12
PHYKE_572350506227931671e-12
PPTG_16680505062371011636e-12
PHYKE_57249312224941626e-12
PHYSO_4813349299220941591e-11
PHYSO_47997056983253941602e-11
PHYKE_572256983400991571e-10
PHYRA_78822569832581011522e-10
PHYRA_78820707772581011522e-10
PPTG_166799313225921494e-10
PHYCA_5424439313239911494e-10
PPTG_1667856983247941485e-10
PITG_112989313231871468e-10
PPTG_166819312230941423e-09
PYVX_15873785465521531463e-09
PHYCA_1045019299180931378e-09
PYIW_23489836812351941398e-09
PHYCA_50470193142471031399e-09
PHYSO_4815779313240871362e-08
PYU1_G003223505062821071212e-06
PYAP_20400505062421101185e-06
PYAR_1881750506462511171e-05
PYIW_1527250506297511106e-05
PYIR_2121783681393691091e-04
PYU1_G00322483681369721044e-04
PHYSO_484450930721497980.001
PHYRA_78826930723389980.001
PYVX_15875930727589980.002
PYIR_212185050628151970.002
PHALS_08964930724990950.004
PHYCA_562391930720496930.005
PITG_11297931219095910.008
PHYCA_6035931218395890.016
PPTG_16686930726096890.022
PHYSO_478151931219793860.043
PYU1_G0032209307353113860.063
PITG_11292930725696850.071
PYIR_24418930728989850.086
PYIW_15275930730984840.10
PHYKE_5725930688696850.12
PHYCA_548442927320177800.28
H257_0086812356524286790.37
PHYCA_712193926413778770.37
PYVX_15645927319077760.83
PHYCA_5423884816719077760.86
PYU1_G0032029368523860761.0
PYU1_G003215929420859751.1
PYIR_215555857223378761.1
PHYKE_7014927418278741.2
PYU1_G0032039368622959751.2
PPTG_167154816722799751.3
PYU1_G013935927320489741.5
PHYRA_78855927319359731.9
PHYSO_554581927319359731.9
PHYKE_7013927319278732.0
PYU1_G0032015857223858732.1
PHYRA_737021267117592722.2
PYVX_15652927616378712.4
PYAP_198219307350128732.5
PYVX_156465386217781712.9
PYVX_15649927721694723.0
H310_010827766125499733.5
PITG_157061267115778704.1
PHYSO_3153551267119077704.4
PPTG_16723927318877696.7
PHALS_055031291960798708.0
PHYSO_284926927412677668.9
PHYSO_2849253926412677668.9
PYIW_18765433922764689.5
PYU1_G003204928421859689.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_5721

Length=317
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_5721                                                            551        0.0  
PHYSO_296552                                                          179        1e-55
PPTG_16673                                                            180        2e-54
PITG_00009                                                            130        1e-33
PHYRA_87270                                                           115        2e-29
PHYRA_78821                                                           115        2e-29
PPTG_16676                                                            114        3e-29
PPTG_16677                                                            114        4e-29
PHYSO_325607                                                          111        6e-28
PHYSO_484316                                                          111        6e-28
PITG_11300                                                            108        5e-27
PHALS_08979                                                           105        7e-26
PHYCA_504703                                                          102        7e-25
HYAP_01514                                                            98.2       1e-22
PHYSO_486521                                                          87.0       6e-19
PPTG_16674                                                            79.0       3e-16
PHYRA_78823                                                           75.9       4e-14
PPTG_16696                                                            71.2       2e-13
PITG_11284                                                            70.9       2e-13
PHYSO_325601                                                          71.2       3e-13
PHYRA_78833                                                           68.9       1e-12
PHYKE_5723                                                            68.9       1e-12
PPTG_16680                                                            67.4       6e-12
PHYKE_5724                                                            67.0       6e-12
PHYSO_481334                                                          65.9       1e-11
PHYSO_479970                                                          66.2       2e-11
PHYKE_5722                                                            65.1       1e-10
PHYRA_78822                                                           63.2       2e-10
PHYRA_78820                                                           63.2       2e-10
PPTG_16679                                                            62.0       4e-10
PHYCA_542443                                                          62.0       4e-10
PPTG_16678                                                            61.6       5e-10
PITG_11298                                                            60.8       8e-10
PPTG_16681                                                            59.3       3e-09
PYVX_15873                                                            60.8       3e-09
PHYCA_104501                                                          57.4       8e-09
PYIW_23489                                                            58.2       8e-09
PHYCA_504701                                                          58.2       9e-09
PHYSO_481577                                                          57.0       2e-08
PYU1_G003223                                                          51.2       2e-06
PYAP_20400                                                            50.1       5e-06
PYAR_18817                                                            49.7       1e-05
PYIW_15272                                                            47.0       6e-05
PYIR_21217                                                            46.6       1e-04
PYU1_G003224                                                          44.7       4e-04
PHYSO_484450                                                          42.4       0.001
PHYRA_78826                                                           42.4       0.001
PYVX_15875                                                            42.4       0.002
PYIR_21218                                                            42.0       0.002
PHALS_08964                                                           41.2       0.004
PHYCA_562391                                                          40.4       0.005
PITG_11297                                                            39.7       0.008
PHYCA_6035                                                            38.9       0.016
PPTG_16686                                                            38.9       0.022
PHYSO_478151                                                          37.7       0.043
PYU1_G003220                                                          37.7       0.063
PITG_11292                                                            37.4       0.071
PYIR_24418                                                            37.4       0.086
PYIW_15275                                                            37.0       0.10 
PHYKE_5725                                                            37.4       0.12 
PHYCA_548442                                                          35.4       0.28 
H257_00868                                                            35.0       0.37 
PHYCA_71219                                                           34.3       0.37 
PYVX_15645                                                            33.9       0.83 
PHYCA_542388                                                          33.9       0.86 
PYU1_G003202                                                          33.9       1.0  
PYU1_G003215                                                          33.5       1.1  
PYIR_21555                                                            33.9       1.1  
PHYKE_7014                                                            33.1       1.2  
PYU1_G003203                                                          33.5       1.2  
PPTG_16715                                                            33.5       1.3  
PYU1_G013935                                                          33.1       1.5  
PHYRA_78855                                                           32.7       1.9  
PHYSO_554581                                                          32.7       1.9  
PHYKE_7013                                                            32.7       2.0  
PYU1_G003201                                                          32.7       2.1  
PHYRA_73702                                                           32.3       2.2  
PYVX_15652                                                            32.0       2.4  
PYAP_19821                                                            32.7       2.5  
PYVX_15646                                                            32.0       2.9  
PYVX_15649                                                            32.3       3.0  
H310_01082                                                            32.7       3.5  
PITG_15706                                                            31.6       4.1  
PHYSO_315355                                                          31.6       4.4  
PPTG_16723                                                            31.2       6.7  
PHALS_05503                                                           31.6       8.0  
PHYSO_284926                                                          30.0       8.9  
PHYSO_284925                                                          30.0       8.9  
PYIW_18765                                                            30.8       9.5  
PYU1_G003204                                                          30.8       9.7  

>PHYKE_5721
Length=317

 Score = 551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/291 (100%), Positives = 291/291 (100%), Gaps = 0/291 (0%)

Query  27   NCRLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskre  86
            NCRLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVKESKRE
Sbjct  27   NCRLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVKESKRE  86

Query  87   rkkrelrekdelrPDYQVEYRYSTFRALRQRVGCGVPATAKPssasssHGYQKNPVELAK  146
            RKKRELREKDELRPDYQVEYRYSTFRALRQRVGCGVPATAKPSSASSSHGYQKNPVELAK
Sbjct  87   RKKRELREKDELRPDYQVEYRYSTFRALRQRVGCGVPATAKPSSASSSHGYQKNPVELAK  146

Query  147  RDPNKLQKALDRATQQERKKTRKMQKIANKAARQRGSSGSNRIALLSAGVCSIASDEDIL  206
            RDPNKLQKALDRATQQERKKTRKMQKIANKAARQRGSSGSNRIALLSAGVCSIASDEDIL
Sbjct  147  RDPNKLQKALDRATQQERKKTRKMQKIANKAARQRGSSGSNRIALLSAGVCSIASDEDIL  206

Query  207  AEIWASRSPSCDGIADDDLPEVDEDFSQSAPMEFVFFTGCPDDRNLRELDVGYRRHRSNT  266
            AEIWASRSPSCDGIADDDLPEVDEDFSQSAPMEFVFFTGCPDDRNLRELDVGYRRHRSNT
Sbjct  207  AEIWASRSPSCDGIADDDLPEVDEDFSQSAPMEFVFFTGCPDDRNLRELDVGYRRHRSNT  266

Query  267  RAARCPSTSSYATTIPIKPTLVSKMPPLFVPRLGNNSGCDDNYSLFSVCMH  317
            RAARCPSTSSYATTIPIKPTLVSKMPPLFVPRLGNNSGCDDNYSLFSVCMH
Sbjct  267  RAARCPSTSSYATTIPIKPTLVSKMPPLFVPRLGNNSGCDDNYSLFSVCMH  317

>PHYSO_296552
Length=135

 Score = 179 bits (455),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 104/137 (76%), Gaps = 8/137 (6%)

Query  170  MQKIANK---AARQRGSSGSNRIALLSAGV---CSIASDEDILAEIWASRSPSCDGIADD  223
            M+K+ N    +A  RG  GS RIA+LS G    CS  SDEDILAEIWA RSP  DG + D
Sbjct  1    MKKLVNNVDISATNRG--GSGRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGD  58

Query  224  DLPEVDEDFSQSAPMEFVFFTGCPDDRNLRELDVGYRRHRSNTRAARCPSTSSYATTIPI  283
            DLPEVD++ S++APMEF+FF+GCPDD+NLR LDVGYRR RSN RA R P T SYAT++PI
Sbjct  59   DLPEVDDELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSVPI  118

Query  284  KPTLVSKMPPLFVPRLG  300
            KPTLVS MPPLF PR G
Sbjct  119  KPTLVSNMPPLFAPRFG  135

>PPTG_16673
Length=258

 Score = 180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 121/167 (72%), Gaps = 10/167 (6%)

Query  139  KNPVELAKRDPNKLQKALDRATQQERKKTRKMQKIANKA---ARQRGSSGSNRIALLSAG  195
            + PVE+AK++  KL+KAL+RA +QERK+ RKMQK+A K+    R+RG S  NRIALLS  
Sbjct  96   QGPVEVAKKEQKKLRKALERAVKQERKEARKMQKLAKKSDRSVRERGGS-CNRIALLSTT  154

Query  196  V---CSIASDEDILAEIWASRSPSCDGIADDDLPEVDEDFSQSAPMEFVFFTGCPDDRNL  252
                CS+ SD++ILAEIWA RS S   ++D+ +P VD+  + +APMEF+FFTGCPDD + 
Sbjct  155  TVSDCSVMSDQEILAEIWAMRSSSMGRVSDESMPVVDDKLADTAPMEFLFFTGCPDDNS-  213

Query  253  RELDVGYRRHRSNTRAARCPSTSSYATTIPIKPTLVSKMPPLFVPRL  299
              LDV +RR RS  R AR  +T S+ TT+P+K TLVS MPPLFVPR 
Sbjct  214  --LDVRHRRARSKARLARYSATPSFTTTVPVKSTLVSNMPPLFVPRF  258

>PITG_00009
Length=418

 Score = 130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 105/149 (70%), Gaps = 10/149 (7%)

Query  139  KNPVELAKRDPNKLQKALDRATQQERKKTRKMQKIANKA---ARQRGSSGSNRIALLSAG  195
            ++PV++AK D  KL+KAL+RA +QERK+ RK QK+A K+    R+RGSS SNRIALLSA 
Sbjct  268  QDPVQIAKNDQKKLRKALERAAKQERKEARKKQKLARKSHRSLRERGSS-SNRIALLSAS  326

Query  196  V---CSIASDEDILAEIWASRSPSCDGIADDDLPEVDEDFSQSAPMEFVFFTGCPDDRNL  252
                CSI S+E+ILAEIWA RS     ++D+D+   D+  + SAP+EF+FF GCPDD + 
Sbjct  327  SVYDCSITSNEEILAEIWAMRSSFTAQVSDEDVSAADDKAASSAPIEFLFFMGCPDDSS-  385

Query  253  RELDVGYRRHRSNTRAARCPSTSSYATTI  281
               ++GY R R  +R+AR  +T S+AT I
Sbjct  386  --REIGYLRARPKSRSARNTATPSFATAI  412

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 30/54 (56%), Gaps = 11/54 (20%)

Query  65   LDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            +DVF+QS  +GI K           +     D+  PDY VE+RYS FRALR+ +
Sbjct  103  VDVFMQSTLKGIAK-----------KSKCSTDDRTPDYCVEHRYSAFRALRKAI  145

>PHYRA_87270
Length=237

 Score = 115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 8/104 (8%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGI--------PKPV  80
            RLSQLSRAK+AVALN VHHVRM TAYDREEHVTVYVLDVFLQ+ PRG+         KP 
Sbjct  32   RLSQLSRAKVAVALNSVHHVRMCTAYDREEHVTVYVLDVFLQAPPRGLSRTAAPASAKPP  91

Query  81   keskrerkkrelrekdelrPDYQVEYRYSTFRALRQRVGCGVPA  124
            + S+ ER++RELR++D+LR DYQVE+RYSTFRALR+R+G  V A
Sbjct  92   RLSRSERRRRELRQQDDLRADYQVEHRYSTFRALRERIGEAVAA  135

>PHYRA_78821
Length=237

 Score = 115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 8/104 (8%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGI--------PKPV  80
            RLSQLSRAK+AVALN VHHVRM TAYDREEHVTVYVLDVFLQ+ PRG+         KP 
Sbjct  32   RLSQLSRAKVAVALNSVHHVRMCTAYDREEHVTVYVLDVFLQAPPRGLSRTAAPASAKPP  91

Query  81   keskrerkkrelrekdelrPDYQVEYRYSTFRALRQRVGCGVPA  124
            + S+ ER++RELR++D+LR DYQVE+RYSTFRALR+R+G  V A
Sbjct  92   RLSRSERRRRELRQQDDLRADYQVEHRYSTFRALRERIGEAVAA  135

>PPTG_16676
Length=240

 Score = 114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 81/108 (75%), Gaps = 12/108 (11%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerk  88
            RLSQLSRAK+AVALN VHHV+M T+YDREEHVTVYVLDVFLQSAPRG+P  +  +     
Sbjct  32   RLSQLSRAKVAVALNSVHHVQMCTSYDREEHVTVYVLDVFLQSAPRGLPSCIATTSASTT  91

Query  89   k------------relrekdelrPDYQVEYRYSTFRALRQRVGCGVPA  124
            +            RELREKDELR DYQVE+RYSTFRALR+R+G  V A
Sbjct  92   QHRHKESKRERRRRELREKDELRADYQVEHRYSTFRALRERIGEVVAA  139

>PPTG_16677
Length=240

 Score = 114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 79/103 (77%), Gaps = 12/103 (12%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerk  88
            RLSQLSRAK+AVALN VHHV+M T+YDREEHVTVYVLDVFLQSAPRG+P  +  +     
Sbjct  32   RLSQLSRAKVAVALNSVHHVQMCTSYDREEHVTVYVLDVFLQSAPRGLPSCIATTSASTT  91

Query  89   k------------relrekdelrPDYQVEYRYSTFRALRQRVG  119
            +            RELREKDELR DYQVE+RYSTFRALR+R+G
Sbjct  92   QHRHKESKRERRRRELREKDELRADYQVEHRYSTFRALRERIG  134

>PHYSO_325607
Length=241

 Score = 111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 72/110 (65%), Gaps = 12/110 (11%)

Query  27   NCRLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskre  86
              RLSQLSRAK+AVALN VHHV+M TAYDRE HVT YVLDVFLQ+APRG+P     + R 
Sbjct  30   GARLSQLSRAKVAVALNSVHHVQMCTAYDREGHVTAYVLDVFLQAAPRGLPVASAATGRS  89

Query  87   rkkrelrekdel------------rPDYQVEYRYSTFRALRQRVGCGVPA  124
            + K   +                 R DYQVE+RYSTFRALR+R+G  V A
Sbjct  90   KSKHTQKHSRSERVRRGLREEDELRADYQVEHRYSTFRALRERIGAAVAA  139

>PHYSO_484316
Length=241

 Score = 111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 72/110 (65%), Gaps = 12/110 (11%)

Query  27   NCRLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskre  86
              RLSQLSRAK+AVALN VHHV+M TAYDRE HVT YVLDVFLQ+APRG+P     + R 
Sbjct  30   GARLSQLSRAKVAVALNSVHHVQMCTAYDREGHVTAYVLDVFLQAAPRGLPVASAATGRS  89

Query  87   rkkrelrekdel------------rPDYQVEYRYSTFRALRQRVGCGVPA  124
            + K   +                 R DYQVE+RYSTFRALR+R+G  V A
Sbjct  90   KSKHTQKHSRSERVRRGLREEDELRADYQVEHRYSTFRALRERIGAAVAA  139

>PITG_11300
Length=241

 Score = 108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 72/108 (67%), Gaps = 12/108 (11%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerk  88
            RLSQLSRAK+AVALN VHHV+M T YDREEHVT+YVLDVFLQ APRG+P     +     
Sbjct  33   RLSQLSRAKMAVALNNVHHVQMCTTYDREEHVTIYVLDVFLQLAPRGLPSSALTASASTT  92

Query  89   krelrekd------------elrPDYQVEYRYSTFRALRQRVGCGVPA  124
            + + ++              ELR DYQVE+RY TFR LR+R+G  V A
Sbjct  93   EHKYKQSKRERRRRELREKDELRADYQVEHRYLTFRVLRERIGEAVAA  140

>PHALS_08979
Length=216

 Score = 105 bits (261),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 4/100 (4%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGI--PKPVkeskre  86
            RLSQLSRAK+AVALN VHHV+MS  YD +EHVT+YVLDVFLQSAPRG+          + 
Sbjct  18   RLSQLSRAKVAVALNNVHHVQMSKTYDYKEHVTMYVLDVFLQSAPRGLLSQNATVLVTKS  77

Query  87   rkkrelrekdelrPDYQVEYRYSTFRALRQRV--GCGVPA  124
             ++  + E++   PD+QVE+RYS+FR+LR+R+     VP+
Sbjct  78   AQRNSVLEREIHSPDFQVEHRYSSFRSLRKRIREAVAVPS  117

>PHYCA_504703
Length=233

 Score = 102 bits (255),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 73/104 (70%), Gaps = 8/104 (8%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPK-----PVkes  83
            RLS LSRAK+AVALN VHHV+M T+YDREE+VTVYVLDVFLQ+ PRG+P      P  + 
Sbjct  28   RLSHLSRAKVAVALNNVHHVQMCTSYDREENVTVYVLDVFLQTPPRGLPSRSGAVPTTQK  87

Query  84   krerkkrelrekdel---rPDYQVEYRYSTFRALRQRVGCGVPA  124
              ++ +R  RE       R DYQVE+RY TFR LR+R+G  V A
Sbjct  88   LVKKSERRRRELRAKDDLRADYQVEHRYLTFRMLRERIGEAVVA  131

>HYAP_01514
Length=297

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 70/112 (63%), Gaps = 16/112 (14%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerk  88
            RLSQLSRAK AVALN VHH RM+T Y+ E+HVTVYVLDV+LQ+ PRG+PK      R   
Sbjct  19   RLSQLSRAKGAVALNSVHHARMNTTYELEKHVTVYVLDVYLQATPRGLPKTTTIKGRRTT  78

Query  89   krel----------------rekdelrPDYQVEYRYSTFRALRQRVGCGVPA  124
             R+                  E+  +R DYQVE+RYS FR LR+RVG  V A
Sbjct  79   YRQSRRQCRRFERHEKEEEEEEEGNVRADYQVEHRYSAFRELRERVGEAVAA  130

>PHYSO_486521
Length=239

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 60/91 (66%), Gaps = 7/91 (8%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerk  88
            +LSQLSRAK+AVALN +HHVRM   Y +EE VTVY LDVF+QS   G+         + K
Sbjct  35   QLSQLSRAKMAVALNSIHHVRMFKTYGQEERVTVYALDVFVQSTLTGV-------VSKSK  87

Query  89   krelrekdelrPDYQVEYRYSTFRALRQRVG  119
            K    E D  R  YQV YRYS+FR LRQR+G
Sbjct  88   KLIKGESDSGRIAYQVAYRYSSFRTLRQRIG  118

>PPTG_16674
Length=217

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 57/94 (61%), Gaps = 12/94 (13%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerk  88
            +LSQLSRAK+AV LN +HHV+M  A +   HVT Y L+VFLQS P+GI K          
Sbjct  34   QLSQLSRAKVAVVLNSIHHVKMCKAKE-GGHVTAYALEVFLQSTPKGIAK----------  82

Query  89   krelrekdelrPDYQVEYRYSTFRALRQRVGCGV  122
             +     D+  PDY VE+RYS FR LR+ +   V
Sbjct  83   -KNKCTTDDRSPDYSVEHRYSAFRTLRECISEAV  115

>PHYRA_78823
Length=834

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 60/93 (65%), Gaps = 4/93 (4%)

Query  30   LSQLSR-AKIAVALNQVHHVRMSTAYDREEH---VTVYVLDVFLQSAPRGIPKPVkeskr  85
            LSQ+S  AK AV LNQ+ HV +  AY  EEH   VTVYVLDVF+Q   +G+PK   +   
Sbjct  241  LSQMSSSAKFAVTLNQISHVAIRAAYSCEEHERIVTVYVLDVFVQDVQKGLPKTPTQHNF  300

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            +   R  R+K   R +YQVE+RYS FR LRQR+
Sbjct  301  KLTWRPKRDKPSERAEYQVEHRYSAFRLLRQRI  333

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 60/87 (69%), Gaps = 4/87 (5%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrer  87
            RLSQLS  AK A++LN+++ V +S+ Y+ +   T+YV+DVFL++  +G+P    E+  +R
Sbjct  635  RLSQLSTTAKSAMSLNEIYRVEISSTYETDS-ATIYVVDVFLRTTQKGLP--TVETLDQR  691

Query  88   kkrelrekdelrPDYQVEYRYSTFRAL  114
            ++R   E     PDYQVE+RYS FRA+
Sbjct  692  RRRLRLENQSQTPDYQVEHRYSDFRAM  718

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 9/93 (10%)

Query  29   RLSQLS-RAKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFLQSAPRGIPKPVkeskr  85
            RLSQLS  AK AV LNQ+  V +   +D  EH   T+YV++V+LQ A +G+PK       
Sbjct  17   RLSQLSDSAKFAVTLNQLQRVAIRGLFDSPEHDGATLYVVEVYLQKAQQGLPK------S  70

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
              K++ LRE++  RP+  V +RYS FRALR  +
Sbjct  71   NAKRQLLREQERERPECHVVHRYSDFRALRHEI  103

>PPTG_16696
Length=218

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 3/93 (3%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFLQSAPRGIPKPVkeskr  85
            RLS+LS  +K A  LNQV  V++   YDRE+    T+YVLDV+LQ   RG+P    ++  
Sbjct  21   RLSKLSNNSKHAFTLNQVQRVKVCATYDREDEDGATMYVLDVYLQYVQRGLPTTPGKTTS  80

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            ER+ R  +EK+E  P+YQVE+RYS FR LR+R+
Sbjct  81   ERRSRLQQEKEETEPEYQVEHRYSAFRELRKRI  113

>PITG_11284
Length=216

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 3/93 (3%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFLQSAPRGIPKPVkeskr  85
            RLS LS  +K A  LNQV  V++   YDRE+    TVYVLDV+LQ   RG+P    E+  
Sbjct  19   RLSTLSNNSKHAFTLNQVQRVKVCATYDREDGDGATVYVLDVYLQYVQRGLPTTPGETTS  78

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            ER+ R  +EK+E  P+YQVE+RYS FR LR+RV
Sbjct  79   ERRSRLQQEKEEAEPEYQVEHRYSAFRELRKRV  111

>PHYSO_325601
Length=246

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 6/89 (7%)

Query  36   AKIAVALNQVHHVRMSTAYDREEH-----VTVYVLDVFLQSAPRGIPKPVkeskrerkkr  90
            AK AV+LNQ+ HV +  A++R EH     VTVYV+DVFLQ   +G+PK      + ++  
Sbjct  44   AKSAVSLNQISHVAIRAAHNRAEHQHGPVVTVYVMDVFLQDVLKGLPKSAANRDKHKRTW  103

Query  91   elr-ekdelrPDYQVEYRYSTFRALRQRV  118
              + EK     DYQVE+RYS+FR LRQR+
Sbjct  104  RQKPEKRSEHVDYQVEHRYSSFRLLRQRI  132

>PHYRA_78833
Length=220

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 3/93 (3%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDR--EEHVTVYVLDVFLQSAPRGIPKPVkeskr  85
            RLS LS  +K A  LNQV  V++   YDR  E   TVYVLDV+LQ   RG+P    E+K 
Sbjct  23   RLSTLSNNSKHAFTLNQVQRVKVCATYDRQGENGATVYVLDVYLQYVQRGLPVTPGETKS  82

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            ER+ R   EK+E  P+YQVE+RYS FR LR+R+
Sbjct  83   ERRSRLQLEKEETEPEYQVEHRYSAFRELRKRI  115

>PHYKE_5723
Length=227

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 14/93 (15%)

Query  30   LSQLSR-AKIAVALNQVHHVRMSTAYDREEH---VTVYVLDVFLQSAPRGIPKPVkeskr  85
            LSQLS  A+ AV LNQ++HV + + Y+ EEH   VTVYV+DVFLQ   +G+PK       
Sbjct  31   LSQLSNSARFAVRLNQMNHVAIQSFYEHEEHGRAVTVYVVDVFLQRMQKGLPK-------  83

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
                   RE+    P Y+V++RYS FR LRQ +
Sbjct  84   ---TDRKREQQSEHPAYRVQHRYSEFRLLRQHI  113

>PPTG_16680
Length=237

 Score = 67.4 bits (163),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 66/101 (65%), Gaps = 4/101 (4%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEHVTV---YVLDVFLQSAPRGIPKPVkesk  84
            RLS+LS  AK AV+LNQ+ HV +  AY+REEH  +   YV+DVFL    +G+P    +S 
Sbjct  28   RLSKLSNSAKFAVSLNQISHVVIREAYNREEHGAIVVVYVVDVFLMGVQKGLPSTSVQSW  87

Query  85   rerkkrelrekdelrPDYQVEYRYSTFRALRQRVGCGVPAT  125
             +   R+ REK   RP+YQVE+RYS FR LRQR+   V AT
Sbjct  88   HKLTWRQKREKQSERPEYQVEHRYSAFRLLRQRILDVVSAT  128

>PHYKE_5724
Length=224

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 62/94 (66%), Gaps = 4/94 (4%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFLQSAPRGIPKP-Vkesk  84
            RLSQLS  AK AV LNQ+  V +   YD  EH   TVY++DV++    +G+P     ESK
Sbjct  21   RLSQLSENAKFAVGLNQIQRVAVRDLYDSPEHDGATVYIMDVYIHKTQKGLPTANAGESK  80

Query  85   rerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
             +RK+R   +++  RP+Y VE+RYS FRALRQR+
Sbjct  81   TDRKRRLQHQQESERPEYDVEHRYSDFRALRQRI  114

>PHYSO_481334
Length=220

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 3/94 (3%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFLQSAPRGIPKPVkeskr  85
            RLS LS  +K A  LNQV  V++   YDRE+    TVYVLDV+LQ   RG+P    E+K 
Sbjct  23   RLSALSNNSKHAFTLNQVQRVKVCATYDREDEGGATVYVLDVYLQYVQRGLPTTPGETKS  82

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRVG  119
            ER+ R  +EK+E  P+YQVE+RYS FR LR+R+ 
Sbjct  83   ERRSRLEQEKEEAEPEYQVEHRYSAFRELRKRIA  116

>PHYSO_479970
Length=253

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 4/94 (4%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREE-HVTVYVLDVFLQSAPRGI--PKPVkesk  84
            RLS LS  AK A+ LNQ+HHV++   YD  E   TVYV++V+L+   +G+  P P  ES+
Sbjct  52   RLSCLSSIAKFAMKLNQIHHVKICATYDESEGGATVYVMNVYLRYVQKGLPPPPPAGESE  111

Query  85   rerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
             +RKKR  RE++   P YQVE+RYS FR LR+R+
Sbjct  112  GQRKKRLRRERELEHPVYQVEHRYSAFRELRRRI  145

>PHYKE_5722
Length=400

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 67/99 (68%), Gaps = 3/99 (3%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIP--KPVkeskr  85
            RLS+LS  AK A+ LNQ+HH+R+ + YD      VYVL+V+L+   +G+P   P +ES+R
Sbjct  202  RLSRLSTIAKFAMKLNQIHHIRICSTYDDGSGAIVYVLNVYLRYVQKGLPPVTPRRESER  261

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRVGCGVPA  124
            +RKKR   ++D  RP YQVE+RYS FR L++ +   V A
Sbjct  262  QRKKRLQLQRDTERPMYQVEHRYSAFRELKRHIVKTVNA  300

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 98/197 (50%), Gaps = 15/197 (8%)

Query  40   VALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelr  99
            ++LN+++ + + ++Y  E+  TVYV++VFL+   +G+  P  E+  +RK+R   E+  + 
Sbjct  1    MSLNEIYRIHICSSYIHEDGATVYVVNVFLKKTQKGL--PTVETLSQRKRRLRHEQKLMA  58

Query  100  PDYQVEYRYSTFRALRQRVGCGV---------PATAKPssasssHGYQKNPVELAKRDPN  150
            PDYQVE+RYS FRA+ + +   V            ++  +  S+ G+   P  +  R P 
Sbjct  59   PDYQVEHRYSDFRAMVKSISAVVNDHDHFRFCAYCSRVGTTKSAAGF---PSRVPSRGPV  115

Query  151  KLQKALDRATQQERKKTRKMQKIANKAARQRGSSGSNRIALLSAGVCSIASDEDILAEIW  210
            +      R ++ E     +M K A   + + GSS  +R  ++S  +    +D       +
Sbjct  116  RQLVTRIRKSRLE-HFVNQMLKAAKDNSYRSGSSLCHRFLIVSELLHKTRADLQRRNSAF  174

Query  211  ASRSPSCDGIADDDLPE  227
            +  S S D    D+LP+
Sbjct  175  SHASSSEDSDEADELPQ  191

>PHYRA_78822
Length=258

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 5/101 (5%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDR-EEHVTVYVLDVFLQSAPRGIPKP---Vkes  83
            RLS+LS   K A+ LNQ+HHV++   +D  E   TVYV++V+L+   +G+P     + ES
Sbjct  56   RLSRLSTITKFAMKLNQIHHVKICATFDECEGGATVYVVNVYLRYMQKGLPPASLLLGES  115

Query  84   krerkkrelrekdelrPDYQVEYRYSTFRALRQRVGCGVPA  124
            + +RKKR   E++  RP YQVE+RYS FR LR+RV   V A
Sbjct  116  ESQRKKRLQLEREMERPMYQVEHRYSVFRELRRRVMKTVSA  156

>PHYRA_78820
Length=258

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 5/101 (5%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDR-EEHVTVYVLDVFLQSAPRGIPKP---Vkes  83
            RLS+LS   K A+ LNQ+HHV++   +D  E   TVYV++V+L+   +G+P     + ES
Sbjct  56   RLSRLSTITKFAMKLNQIHHVKICATFDECEGGATVYVVNVYLRYMQKGLPPASLLLGES  115

Query  84   krerkkrelrekdelrPDYQVEYRYSTFRALRQRVGCGVPA  124
            + +RKKR   E++  RP YQVE+RYS FR LR+RV   V A
Sbjct  116  ESQRKKRLQLEREMERPMYQVEHRYSVFRELRRRVMKTVSA  156

>PPTG_16679
Length=225

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 65/92 (71%), Gaps = 4/92 (4%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrer  87
            RLSQLS  AK A++LN+++ V +S+ Y+ E+  T+YV++VFL++  +G+P    E+  +R
Sbjct  30   RLSQLSTIAKSAMSLNEIYSVEISSTYESED-ATIYVVNVFLRTTQKGLP--TVETLDQR  86

Query  88   kkrelrekdelrPDYQVEYRYSTFRALRQRVG  119
            ++R  RE   L PDYQVE+RYS FRA+ + + 
Sbjct  87   RRRLRREYKGLTPDYQVEHRYSDFRAMVKSIS  118

>PHYCA_542443
Length=239

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 63/91 (69%), Gaps = 4/91 (4%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrer  87
            RLSQLS  AK A+ LN+++ V +S++Y+R+   T+YVL+VFL++  +G+P    E+  +R
Sbjct  31   RLSQLSTTAKSAMLLNEIYRVEISSSYERD-GATIYVLNVFLRTTQKGLP--TLETLDQR  87

Query  88   kkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            + R  RE     PDYQVE+RYS FRA+ + V
Sbjct  88   RCRLRRENKGQTPDYQVEHRYSDFRAMVKSV  118

>PPTG_16678
Length=247

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 66/94 (70%), Gaps = 4/94 (4%)

Query  29   RLSQLS-RAKIAVALNQVHHVRM-STAYDREEHVTVYVLDVFLQSAPRGIPKP--Vkesk  84
            RLS LS  +K ++ LNQ+HH+++ +T  + ++  TVYVL+V+L+   +G+P P  + ES+
Sbjct  47   RLSHLSAMSKFSMKLNQIHHIKICATNNETKDGATVYVLNVYLRFVQKGLPPPPGLGESE  106

Query  85   rerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
             +RKKR   E++   P YQVE+RYS FR LR+R+
Sbjct  107  GQRKKRLRLEREMECPLYQVEHRYSEFRELRRRI  140

>PITG_11298
Length=231

 Score = 60.8 bits (146),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 63/87 (72%), Gaps = 4/87 (5%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrer  87
            RLSQLS  AK A++LN+++ V +S+A++ ++  T+YV++VFL++  +G+P    E+  +R
Sbjct  32   RLSQLSTTAKSAMSLNEIYRVEISSAFESDD-ATIYVVNVFLRTTQKGLP--TMETLDQR  88

Query  88   kkrelrekdelrPDYQVEYRYSTFRAL  114
            ++R  RE     PDYQVE+RYS FRA+
Sbjct  89   RRRLRREYQGQTPDYQVEHRYSDFRAM  115

>PPTG_16681
Length=230

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 4/94 (4%)

Query  29   RLSQLSRA-KIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFLQSAPRGIPKP-Vkesk  84
            RLSQ S + K AV+LNQ+  V +   YD  EH   T+YV+DV+LQ + +G+P     ES 
Sbjct  22   RLSQFSDSTKFAVSLNQIQRVAIRGMYDSPEHDGATMYVVDVYLQRSQKGLPSSNSSESV  81

Query  85   rerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            R RK+R L E+D  RP+ QV++RYS FRALR+++
Sbjct  82   RARKRRLLHEQDAERPECQVQHRYSDFRALREKI  115

>PYVX_15873
Length=552

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 73/153 (48%), Gaps = 15/153 (10%)

Query  150  NKLQKALDRATQQERKKTRKMQK--IANKAARQRGSSGSNRIALLSAGVCSIASDEDILA  207
             KL +A+ RA   E K+ RK++K  +  K           R    S  V +  ++ED   
Sbjct  111  GKLAEAVHRALHYEPKRKRKLKKGSLLQKLV--------GRAPAESPPVSNTTTEEDECE  162

Query  208  EIWASRSPSCD-GIADDDLPEVDEDFSQSAPMEFVFFTGCPDDRNLRELDVGYRRHRSNT  266
             + A+     D GI+     + D+     APMEF+FF+GCPDD NL  L++   R R + 
Sbjct  163  SLEAAIMNLPDQGIST----QWDDREEWPAPMEFLFFSGCPDDSNLYRLEMNQHRRRPDA  218

Query  267  RAARCPSTSSYATTIPIKPTLVSKMPPLFVPRL  299
             +       S +    ++ +LV  MPP+F PRL
Sbjct  219  VSREAADRGSASDAAFLRRSLVYDMPPVFAPRL  251

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 58/122 (48%), Gaps = 13/122 (11%)

Query  191  LLSAGVCSIASDEDI-----LAEIWASRSPSCDGIADDDLPEVDEDFSQSAP--MEFVFF  243
            LL   V   ++D+ +     L+E W S   S       D+     D   S P  MEF+FF
Sbjct  427  LLQKMVWCTSADDAVMPAKTLSESWESLEASILTTQGSDMSARFSDLRASGPEPMEFLFF  486

Query  244  TGCPDDRNLRELDVGYRRHRSN--TRAARCPSTSSYAT----TIPIKPTLVSKMPPLFVP  297
              CPDD  +  L++   R R+N  +  A   S  S AT    +I +  TLV+ MPPLF P
Sbjct  487  PSCPDDLVVNTLEINQFRRRANIASGGATAQSEPSAATSDLDSIRVGRTLVTDMPPLFTP  546

Query  298  RL  299
            RL
Sbjct  547  RL  548

>PHYCA_104501
Length=180

 Score = 57.4 bits (137),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 26/93 (28%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFLQSAPRGIPKPVkeskr  85
            RLS+LS  +K A  LNQV  V++   YDRE+    TVYVLDV+LQ               
Sbjct  6    RLSKLSNNSKHAFTLNQVQRVKVCATYDREDEDGATVYVLDVYLQ---------------  50

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
                     K+E+ P+YQVE+RYS FR LR+R+
Sbjct  51   --------YKNEVEPEYQVEHRYSAFRELRKRI  75

>PYIW_23489
Length=235

 Score = 58.2 bits (139),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 81/194 (42%), Gaps = 37/194 (19%)

Query  143  ELAKRDPNKLQKALDRATQQERKKTRKMQKIANKAARQ--RGSSGSNRIALLSAGVCSIA  200
            +L +++  KL++++ R  + E KK RK++K   K A+Q  R      ++A     V  + 
Sbjct  38   QLTRKEERKLRRSVARVIRSEEKKLRKLEKANRKRAKQYARADEFFEQVASAPLDVSELR  97

Query  201  S-------------DEDILAEIWASRSPSCDGIADDDLPEVDEDFSQSAP----------  237
            +             D +     W  +       A + L      + +             
Sbjct  98   TSYSVSRQSESYHFDMEAAESKWHRQQQQHQQRASESLSSSLTHYGRQRSDSVSSLSRSR  157

Query  238  -----MEFVFFTGCPD-DRNLRELDVGYRR---HR---SNTRAARCPSTSSYATTIPIKP  285
                 MEF+FF G PD D NL EL+VG+RR   HR    N+ AA      S   +I I P
Sbjct  158  GKPPRMEFLFFGGSPDADSNLNELEVGHRRFQPHRIDYYNSSAASEYPRESCTVSIKINP  217

Query  286  TLVSKMPPLFVPRL  299
            TLV  MP  F PR+
Sbjct  218  TLVRNMPRPFNPRM  231

>PHYCA_504701
Length=247

 Score = 58.2 bits (139),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 67/103 (65%), Gaps = 6/103 (6%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDRE-EHVTVYVLDVFLQSAPRGIPKP---Vkesk  84
            R+S +S  K A+ LNQ+HHV++   YD   +  TVYV++V+L+   +G+P     + E+ 
Sbjct  48   RISTIS--KFAMKLNQIHHVKICATYDDSVDGATVYVVNVYLRYIQKGLPPACVLLGETD  105

Query  85   rerkkrelrekdelrPDYQVEYRYSTFRALRQRVGCGVPATAK  127
            ++R++R   E++  RP YQVE+RYS FR LR+R+   V A ++
Sbjct  106  KQRRQRLQLERELERPVYQVEHRYSAFRDLRRRIMKTVSARSE  148

>PHYSO_481577
Length=240

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 60/87 (69%), Gaps = 4/87 (5%)

Query  29   RLSQLSR-AKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrer  87
            RL+QLS  AK A++LN+++ V +S+ Y+  + VT+YV+ VFL++  +G+P    E+  +R
Sbjct  34   RLAQLSTTAKSAMSLNEIYRVEISSTYE-TDGVTMYVVSVFLRTTQKGLP--TMETLDQR  90

Query  88   kkrelrekdelrPDYQVEYRYSTFRAL  114
            ++R  RE     PDY VE+RYS FRA+
Sbjct  91   RRRLRREYQGQTPDYHVEHRYSDFRAM  117

>PYU1_G003223
Length=282

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 17/107 (16%)

Query  29   RLSQLS-RAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrer  87
            RLS+LS   K A++LNQ+ H+ + + Y+ E  V +YVLDV +Q    GIP  +K ++   
Sbjct  58   RLSRLSSNTKCALSLNQIDHIDIHSCYEDEHGVLLYVLDVHVQPYQTGIPSALKSAEFFD  117

Query  88   kkrelrekdelr----------------PDYQVEYRYSTFRALRQRV  118
            +    R   E+                 P Y + +R+S FRALR+R+
Sbjct  118  ELAPRRSMTEVSGDPSGTTPRQSGKLPLPQYHIVHRFSAFRALRKRL  164

>PYAP_20400
Length=242

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 58/110 (53%), Gaps = 13/110 (12%)

Query  29   RLSQLS-RAKIAVALNQVHHVRMSTAYDREEH-VTVYVLDVFLQSAPRGIPKPVkeskre  86
            RLS++S   K AVALNQ+  V +   Y+REE  VT+YVLDV+L+    GIP   + S   
Sbjct  32   RLSRISCNTKYAVALNQIDRVDIQHTYEREEDGVTMYVLDVYLRCVQTGIPTVTRRSHSA  91

Query  87   rkk-----------relrekdelrPDYQVEYRYSTFRALRQRVGCGVPAT  125
                            ++ + E +P Y++ YR+S F  LR+++   V  T
Sbjct  92   HSDDGARIILEDDPLLVKREREEKPHYRMAYRFSEFYELRRQLQEAVTPT  141

>PYAR_18817
Length=462

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 1/51 (2%)

Query  29  RLSQLS-RAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPK  78
           RLS +S   K AVALNQ+  + +S A+DR + VT+YV+D++L     GIPK
Sbjct  28  RLSPISCNTKYAVALNQIDRIEISAAHDRTDGVTLYVVDIYLLCVQTGIPK  78

>PYIW_15272
Length=297

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 2/51 (4%)

Query  29  RLSQLSRA-KIAVALNQVHHVRMSTAYDR-EEHVTVYVLDVFLQSAPRGIP  77
           RLS++SR+ K AVALNQ+ HV + ++Y R ++ VT+YVLDV L+    GIP
Sbjct  50  RLSRMSRSTKSAVALNQLQHVAIPSSYTRAQDGVTMYVLDVALKPYQTGIP  100

>PYIR_21217
Length=393

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 36/69 (52%), Gaps = 8/69 (12%)

Query  238  MEFVFFTGCPDDRNLRELDVGYRRHR-------SNTRAARCPSTSSYATTIPIKPTLVSK  290
            MEF+FF G  DD NL  L+VG+ +         SNT A R     S   TI + PTLV  
Sbjct  322  MEFLFFGGSVDDYNLNCLEVGHHQFEPDTTAITSNT-AERDFQKDSSLITIKVNPTLVHN  380

Query  291  MPPLFVPRL  299
            MP  F PR+
Sbjct  381  MPRPFNPRM  389

>PYU1_G003224
Length=369

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 37/72 (51%), Gaps = 12/72 (17%)

Query  238  MEFVFFTGCPDDR--NLRELDVGYRRHRSNTRAARCPSTS----------SYATTIPIKP  285
            +EF+FF G PD+   +L +L+VG+R    N + A  P+ +          S    I I P
Sbjct  292  LEFLFFGGNPDESESSLMQLEVGHRSRIMNFQTATAPAFANPPADYSAADSRTNAIKINP  351

Query  286  TLVSKMPPLFVP  297
            TLV  MP  FVP
Sbjct  352  TLVRNMPRPFVP  363

>PHYSO_484450
Length=214

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 9/97 (9%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIP--------KPVke  82
            Q+SRA +I + L+++  + +  A +REE V  +VLDV+     +G+P        K    
Sbjct  25   QVSRATEIRLFLSRIEFIAIHEAIEREEGVVYFVLDVYRYRQQKGLPSTRSSRSRKLSAG  84

Query  83   skrerkkrelrekdelrPDYQVEYRYSTFRALRQRVG  119
               + K+   RE     PDYQ+E RYS+F  LR  V 
Sbjct  85   QPAQHKRLADREPQNRGPDYQIEQRYSSFARLRSNVA  121

>PHYRA_78826
Length=233

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 4/89 (4%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkr  90
            Q+SRA +I + L+++  + +    +REE V  +VLDV+     +G+P       R RK  
Sbjct  55   QVSRATEIRLFLSRIECIAIHQVIEREEGVVYFVLDVYRYRLQKGLP---CTRSRRRKLS  111

Query  91   elrekdelrPDYQVEYRYSTFRALRQRVG  119
              RE ++  PDYQ+E RYS+F  LR  V 
Sbjct  112  ADREPEDRGPDYQIEQRYSSFARLRSNVA  140

>PYVX_15875
Length=275

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkr  90
            QLSRA +I + L ++  + + +  +R+E V  YV+D++     +GIP   ++S     + 
Sbjct  94   QLSRATEIQLFLERIELLEVRSVIERDEGVVYYVVDLYRYQQQKGIPTR-RKSAPPTPRS  152

Query  91   elrekdelrPDYQVEYRYSTFRALRQRVG  119
                  + RPDYQ+E RYS+F  LR  V 
Sbjct  153  ASPAGQDRRPDYQIEQRYSSFARLRHNVA  181

>PYIR_21218
Length=281

 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 2/51 (4%)

Query  29  RLSQLS-RAKIAVALNQVHHVRMSTAYDR-EEHVTVYVLDVFLQSAPRGIP  77
           RLS++S   K AVALNQ+H V + + Y R +++  VYVLDV L+    GIP
Sbjct  24  RLSRMSCSTKNAVALNQLHRVEIRSCYARAKDNAVVYVLDVVLKPYQTGIP  74

 Score = 32.0 bits (71),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  100  PDYQVEYRYSTFRALRQRV  118
            P YQ+E+RYS FR LR+R+
Sbjct  151  PRYQIEHRYSAFRELRKRL  169

>PHALS_08964
Length=249

 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkr  90
            ++SRA +I + L+++ ++ +     REE  + +VLDV+L    +G+P   ++      KR
Sbjct  67   RVSRAMEIRLCLSRIEYIAIREVITREEGTSYFVLDVYLYRQQKGLPSSRRKLFSNSSKR  126

Query  91   elrek-delrPDYQVEYRYSTFRALRQRVG  119
                +    +PDY +E RYS+F  LR  V 
Sbjct  127  LADCEPQNRKPDYHIEQRYSSFARLRSNVS  156

>PHYCA_562391
Length=204

 Score = 40.4 bits (93),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIP-------KPVkes  83
            Q+SRA +I + L+++  + +    +REE V  +VLDV+     +GIP       K     
Sbjct  16   QVSRATEIRLFLSRIEFIGIHEVIEREEGVIYFVLDVYRYRQQKGIPSTRSTLRKLSTGH  75

Query  84   krerkkrelrekdelrPDYQVEYRYSTFRALRQRVG  119
                K+    E ++  PDYQ+E RYS+F  LR  V 
Sbjct  76   PVPYKRMVGLEPEDRGPDYQIEQRYSSFARLRSNVA  111

>PITG_11297
Length=190

 Score = 39.7 bits (91),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 46/95 (48%), Gaps = 31/95 (33%)

Query  30   LSQLS-RAKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFL---QSAPRGIPKPVkes  83
            LSQ S  AK AV+LNQ+  V +S  YD  ++   T+YV+D  L   Q A R         
Sbjct  7    LSQFSDSAKFAVSLNQIQRVAISGMYDSPDNDGATIYVVDRRLLHEQDAER---------  57

Query  84   krerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
                            P+  V++RYS FRALR+++
Sbjct  58   ----------------PECHVQHRYSDFRALREKI  76

>PHYCA_6035
Length=183

 Score = 38.9 bits (89),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 46/95 (48%), Gaps = 31/95 (33%)

Query  30   LSQLS-RAKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFL---QSAPRGIPKPVkes  83
            LSQLS  AK AV+LNQ+  V +   YD  E+   T+YV+D  L   Q A R         
Sbjct  7    LSQLSDNAKFAVSLNQLQRVAIRGMYDSPENDGATMYVVDRRLLHEQDAER---------  57

Query  84   krerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
                            P+ QV+ RYS FRALR+++
Sbjct  58   ----------------PECQVQRRYSDFRALREKI  76

>PPTG_16686
Length=260

 Score = 38.9 bits (89),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIP-------KPVkes  83
            Q+SRA +I + L+++  + +    +REE    +VLDV+     +G+P       K     
Sbjct  72   QVSRATEIRLFLSRIEFIGIHEVIEREEGAIYFVLDVYRYRQQKGLPSTRSSRRKLSAGQ  131

Query  84   krerkkrelrekdelrPDYQVEYRYSTFRALRQRVG  119
                K    RE ++  PDYQ+E RYS+F  LR  V 
Sbjct  132  LDPHKWLADREPEDRGPDYQIEQRYSSFARLRSNVA  167

>PHYSO_478151
Length=197

 Score = 37.7 bits (86),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 48/93 (52%), Gaps = 25/93 (27%)

Query  29   RLSQLS-RAKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFLQSAPRGIPKPVkeskr  85
            RLSQLS  AK AV LN++  V +   YD  EH   T+YV+D  L                
Sbjct  23   RLSQLSDSAKFAVTLNEIQRVAIRGVYDSPEHDGATMYVVDRRL----------------  66

Query  86   erkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
                  L E+D+ RP+ + + RYS FRALR+++
Sbjct  67   ------LHEQDQERPECRAQRRYSDFRALRRQI  93

>PYU1_G003220
Length=353

 Score = 37.7 bits (86),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 51/113 (45%), Gaps = 26/113 (23%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPK------------  78
            Q+ RA +I + LN++ ++ ++   +RE+ V  Y+LD++      GIP             
Sbjct  147  QVPRATEIQLFLNRIEYIEINDVVEREDDVVYYILDIYRYRQQNGIPTRRRAHTATAIAA  206

Query  79   -----------PVke--skrerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
                       PV     +++ +  +        PD+Q+E+RYS+F  LR  V
Sbjct  207  TSPQSSSTPRAPVLTAPQQKQPQLSKSDSLALRVPDFQIEHRYSSFARLRANV  259

>PITG_11292
Length=256

 Score = 37.4 bits (85),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (48%), Gaps = 8/96 (8%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIP-------KPVkes  83
            Q+SRA +I + L+ +  + +    +REE    +VLDV+     +G+P       K     
Sbjct  68   QVSRATEIRLFLSCIEFIAIHDVIEREEGTIYFVLDVYRYRQQKGLPSTRSSRRKLSAGQ  127

Query  84   krerkkrelrekdelrPDYQVEYRYSTFRALRQRVG  119
                K    RE ++  PDYQ+E RYS F  LR  V 
Sbjct  128  LDPHKWLADREPEDRAPDYQIEQRYSNFARLRSNVA  163

>PYIR_24418
Length=289

 Score = 37.4 bits (85),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (52%), Gaps = 2/89 (2%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkr  90
            Q+ RA +I + L+++ ++ +++  +REE V  YVLD    +A   +           ++ 
Sbjct  107  QVPRATEIQLFLSRIEYIEINSVVEREEGVIYYVLDQQQHTAVVDMNHIQHNKHNNIQQL  166

Query  91   elr-ekdelrPDYQVEYRYSTFRALRQRV  118
            +         PDYQ+E+RYS+F  LR  V
Sbjct  167  QRSGSSQSREPDYQIEHRYSSFARLRSNV  195

>PYIW_15275
Length=309

 Score = 37.0 bits (84),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 42/84 (50%), Gaps = 3/84 (4%)

Query  37   KIAVALNQVHHVRMSTAYDREEHVTVYVLDVF--LQSAPRGIPKPVkeskrerkkrelre  94
            +I + L+++  + +++   RE+ V  YVLDVF  LQ             + + K  +   
Sbjct  133  EIQLFLSRIEFIEINSVVCREDDVVYYVLDVFRYLQQQDHETAA-AHSKRHQLKHSDSSS  191

Query  95   kdelrPDYQVEYRYSTFRALRQRV  118
                 PDYQ+E+R+S+F  LR  V
Sbjct  192  VTGREPDYQIEHRFSSFARLRSNV  215

>PHYKE_5725
Length=886

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (48%), Gaps = 8/96 (8%)

Query  32   QLSRA-KIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIP-------KPVkes  83
            Q+SRA +I + L ++  + +     REE V  +VL ++     +G+P       K     
Sbjct  86   QISRATEIRLLLARIEFIAIHEVIVREEGVIYFVLGIYRYRQQKGLPSTRNSRRKLSASQ  145

Query  84   krerkkrelrekdelrPDYQVEYRYSTFRALRQRVG  119
                KK   RE  +  PDYQ+E RYS+F  LR  V 
Sbjct  146  PIASKKLSDREPTDRAPDYQIEQRYSSFARLRSNVA  181

>PHYCA_548442
Length=201

 Score = 35.4 bits (80),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 37/77 (48%), Gaps = 10/77 (13%)

Query  42   LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPD  101
            L ++ HV ++    R+  V  YVLDVFL+ +   IP           K         RPD
Sbjct  36   LEKIDHVEINRTIVRDG-VVYYVLDVFLEHSTSRIP---------TNKTAKVATANGRPD  85

Query  102  YQVEYRYSTFRALRQRV  118
            YQ+E R++ F  LR +V
Sbjct  86   YQLERRFNDFADLRYQV  102

>H257_00868
Length=242

 Score = 35.0 bits (79),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 36/86 (42%), Gaps = 21/86 (24%)

Query  36   AKIAVALNQVHHVRMST------AYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkk  89
            +K AVALN + HV + +      A  R      Y +DV+L  A  GI             
Sbjct  66   SKYAVALNDIEHVHIDSHKIVKCADARRLSTVAYSMDVYLAVAELGI-------------  112

Query  90   relrekdelrPDYQVEYRYSTFRALR  115
                     +P YQV++RYS  R LR
Sbjct  113  --YDHWTSRQPHYQVQHRYSDCRTLR  136

>PHYCA_71219
Length=137

 Score = 34.3 bits (77),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query  41   ALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrP  100
            +L ++ HV ++    R   V  YVLDVFL+ +   IP            + ++     RP
Sbjct  31   SLEKIDHVEINRTIVRGG-VVYYVLDVFLEHSTSRIP----------TNKTVKSSTTGRP  79

Query  101  DYQVEYRYSTFRALRQRV  118
            DYQ+E R++ F  LR +V
Sbjct  80   DYQLERRFNDFANLRYQV  97

>PYVX_15645
Length=190

 Score = 33.9 bits (76),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 10/77 (13%)

Query  42   LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPD  101
            L  +  V +S   +R+  V  YVLDVFL+     IP           K    +   + PD
Sbjct  33   LETIDRVEISDTVERDG-VVYYVLDVFLEHHSSRIP---------TNKSRETKMSRVMPD  82

Query  102  YQVEYRYSTFRALRQRV  118
            Y+VE+R++ F  LR +V
Sbjct  83   YKVEHRFNDFADLRYQV  99

>PHYCA_542388
Length=190

 Score = 33.9 bits (76),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (52%), Gaps = 11/77 (14%)

Query  42   LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPD  101
            L+++  V ++   +R+  V  YVLDVFL+ +   IP            + ++     RPD
Sbjct  32   LSKIDRVEINHTTERDG-VVYYVLDVFLEHSTSHIP----------TLKAVKTSPSGRPD  80

Query  102  YQVEYRYSTFRALRQRV  118
            YQ+E R++ F  LR +V
Sbjct  81   YQLERRFTAFADLRYQV  97

>PYU1_G003202
Length=238

 Score = 33.9 bits (76),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 1/60 (2%)

Query  60   VTVYVLDVFLQSAPRGIPKPVkeskrerkk-relrekdelrPDYQVEYRYSTFRALRQRV  118
            VT YVLDV+L      +P  +   +R +        +++ +PDYQVE R+S F  LRQ V
Sbjct  82   VTYYVLDVYLYHVASRLPTNLNNLRRSQSVCTSRVAREDAQPDYQVERRFSEFCELRQSV  141

>PYU1_G003215
Length=208

 Score = 33.5 bits (75),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 30/59 (51%), Gaps = 5/59 (8%)

Query  60   VTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            VT YVLDV+L  +                K + +     RPDYQ+E R+S FR LR+++
Sbjct  70   VTYYVLDVYLNRS-----TATTRLSSNLAKTKTQLSCTTRPDYQIERRFSEFRRLREQI  123

>PYIR_21555
Length=233

 Score = 33.9 bits (76),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 37/78 (47%), Gaps = 9/78 (12%)

Query  42   LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPD  101
            L ++  + +++   R+  VT YVLDVFL      +P  V   +   +           PD
Sbjct  61   LERIERIEINSTVVRD-GVTFYVLDVFLYHFNSRLPTNVTNHRSLVRSTR--------PD  111

Query  102  YQVEYRYSTFRALRQRVG  119
            +QVE R+S F  LR +V 
Sbjct  112  FQVERRFSEFVKLRSQVS  129

>PHYKE_7014
Length=182

 Score = 33.1 bits (74),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 39/78 (50%), Gaps = 12/78 (15%)

Query  41   ALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrP  100
            +L +++ V ++   +R+  V  Y+LDVFL+     IP             +   K   RP
Sbjct  25   SLEKINRVEINHTTERDG-VVYYILDVFLEHNTSRIP-----------TNKKASKTANRP  72

Query  101  DYQVEYRYSTFRALRQRV  118
            DYQ+E R++ F  LR +V
Sbjct  73   DYQLERRFNDFANLRYQV  90

>PYU1_G003203
Length=229

 Score = 33.5 bits (75),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)

Query  60   VTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            VT Y+LDV+L      +P  +   ++  +    R  ++ +PDYQVE R+S F  LR+ V
Sbjct  72   VTYYILDVYLYHFNTRLPSNLNNPQKASRYLSTRRSNDRQPDYQVERRFSDFCYLRRFV  130

>PPTG_16715
Length=227

 Score = 33.5 bits (75),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query  34   SRAKIAVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSA------PRGIPKPVkeskrer  87
            SR+   + L +   VR++    R+ H  +YV  VFL  +        G+ K    SK   
Sbjct  39   SRSGSFLPLQRFECVRVAKKLRRDGH-RLYVASVFLHRSEAQRRRSEGVYKVTPASKLSV  97

Query  88   kkrelrekdelrPDYQVEYRYSTFRALRQRVGCGVPATA  126
            +        E +PD+ VE R+S FR LR RV   V A A
Sbjct  98   EAMHAVMMAERQPDFVVERRFSEFRQLRDRVTALVRADA  136

>PYU1_G013935
Length=204

 Score = 33.1 bits (74),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 6/89 (7%)

Query  34   SRAKIAVA-LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIP---KPVkeskrerkk  89
            SRA   +A L ++  + ++  Y R   V  YVLDV+L+     IP   KP   ++RE+  
Sbjct  26   SRASAPLAFLQKIDAIEINHTYVRNG-VVYYVLDVYLKHYTSRIPTNQKPTTPTQREQSN  84

Query  90   relrekdelrPDYQVEYRYSTFRALRQRV  118
             ++ E+    PDYQVE R++ F   R RV
Sbjct  85   NKVHERRSK-PDYQVEKRFTDFADFRYRV  112

>PHYRA_78855
Length=193

 Score = 32.7 bits (73),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 29/59 (49%), Gaps = 10/59 (17%)

Query  60   VTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            V  YVLDVFL+ +   IP            +  +     RPDYQ+E R++ F  LR +V
Sbjct  53   VVYYVLDVFLEHSTSRIP----------TNKTAKTASTGRPDYQLERRFNDFANLRYQV  101

>PHYSO_554581
Length=193

 Score = 32.7 bits (73),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 29/59 (49%), Gaps = 10/59 (17%)

Query  60   VTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            V  YVLDVFL+ +   IP            +  +     +PDYQ+E R++ F  LR +V
Sbjct  53   VVYYVLDVFLEHSTSRIP----------TNKTTKASSSGQPDYQLERRFNDFANLRYQV  101

>PHYKE_7013
Length=192

 Score = 32.7 bits (73),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 40/78 (51%), Gaps = 12/78 (15%)

Query  41   ALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrP  100
            +L +++ V ++   +R+  V  Y+LDVFL+     IP             ++  K   RP
Sbjct  35   SLEKINRVEINRTTERD-GVVYYILDVFLEHNTSRIP-----------TNKMAPKTADRP  82

Query  101  DYQVEYRYSTFRALRQRV  118
            DYQ+E R++ F  LR +V
Sbjct  83   DYQLERRFNDFANLRYQV  100

>PYU1_G003201
Length=238

 Score = 32.7 bits (73),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query  60   VTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPDYQVEYRYSTFRALRQR  117
            VT YVLDV+L      +P     +   R   +    +  +PDYQVE+RYS F  LR++
Sbjct  78   VTYYVLDVYLFHYNSRLP--AILNNPRRALAQQTPVEGRKPDYQVEHRYSEFSLLREQ  133

>PHYRA_73702
Length=175

 Score = 32.3 bits (72),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 42/92 (46%), Gaps = 19/92 (21%)

Query  29   RLSQLSRAKIAVALNQVHHVRMSTAYDREEH--VTVYVLDVFLQSAPRGIPKPVkeskre  86
            R S +S A +A  L ++HHV ++T     EH  V  Y L V+L+     IP         
Sbjct  16   RFSNIS-APLAF-LEKIHHVEINTT---TEHAGVVYYQLGVYLKHNDSHIP---------  61

Query  87   rkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
                        +PDYQ++ R+S F +LR  V
Sbjct  62   ---TVKVTTCGEQPDYQLDKRFSDFASLRHDV  90

>PYVX_15652
Length=163

 Score = 32.0 bits (71),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 11/78 (14%)

Query  41   ALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrP  100
             L Q+  V +++  DR   V  Y+LDV+ +     IP   +     R+K          P
Sbjct  7    VLEQIDRVEINSFVDRGG-VIYYILDVYRKQQLHRIPSNFRLGLERREK----------P  55

Query  101  DYQVEYRYSTFRALRQRV  118
            DYQ+E RYS F +LR  V
Sbjct  56   DYQLEKRYSEFESLRYNV  73

>PYAP_19821
Length=350

 Score = 32.7 bits (73),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 59/128 (46%), Gaps = 6/128 (5%)

Query  36   AKIAVALNQVHHVRMSTAY--DREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelr  93
            A++ + L+++  + +   Y  + E+    YVLDV+       IP    E+ R R+     
Sbjct  149  AQLWMFLDRIECITIRDVYTSNDEDCTVFYVLDVYHYQEQHSIPTLRHEALRRRRPHVTP  208

Query  94   ekd-elrPDYQVEYRYSTFRALRQRVGCGVPATAKPssasssHGYQKNPVELAKRDPNKL  152
             +     PDYQ+++R+S F  LR +V   + AT    +       ++NP E  +R    L
Sbjct  209  LQPPTRAPDYQIQHRFSNFIQLRNKV---LEATRVKHNDGRGRWSKRNPCEYCRRVEAFL  265

Query  153  QKALDRAT  160
             K  + AT
Sbjct  266  TKGSETAT  273

>PYVX_15646
Length=177

 Score = 32.0 bits (71),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 34/81 (42%), Gaps = 7/81 (9%)

Query  39   AVALNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdel  98
             VAL ++  V +ST +     V  YVLD+FL      IP         +           
Sbjct  10   VVALKRIRRVEIST-FKIINGVVFYVLDIFLVHPTSRIP------TVNQSASSTATGAAN  62

Query  99   rPDYQVEYRYSTFRALRQRVG  119
             PD+++  R+  F  LR+RV 
Sbjct  63   APDFRILRRFREFDTLRRRVA  83

>PYVX_15649
Length=216

 Score = 32.3 bits (72),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 47/94 (50%), Gaps = 8/94 (9%)

Query  32   QLSRAKIAVA-LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIP------KPVkesk  84
            Q +RA  A+A L  +  + ++ +  R   +  YVLDV+L++A   IP      K      
Sbjct  28   QYTRAADALAFLKTIDRIEVNASVKRHGGL-FYVLDVYLRNAENRIPTSRASRKSSVGCL  86

Query  85   rerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
                +++  +++   PDYQVE R++ F  LR  +
Sbjct  87   VAADEKDKEKEEPREPDYQVERRFAEFEKLRYNI  120

>H310_01082
Length=1254

 Score = 32.7 bits (73),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 21/99 (21%)

Query  225  LPEVDEDFS---QSAPMEFVFFTGCPDDRNLRELDVGYRRHRSNTRAARCP-------ST  274
            +PE DED +   Q+AP ++V      +  N   + +G RR  S   +   P       +T
Sbjct  250  IPEGDEDATETKQAAPKKYVIEEEASNPLNQGGIGLGQRRRTSGNYSLHSPRHKEVGDAT  309

Query  275  SSYATTIPIKPTLVSKMP-----------PLFVPRLGNN  302
            S+ +TT PI P  V+  P           P+ V ++G+ 
Sbjct  310  SANSTTSPISPQNVTIQPTDGVIIVVHRLPVLVTKIGDG  348

>PITG_15706
Length=157

 Score = 31.6 bits (70),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 21/78 (27%), Positives = 34/78 (44%), Gaps = 13/78 (17%)

Query  42   LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPD  101
            L+ + H+ ++   +R+  V  Y +DVFL      IP                     +PD
Sbjct  36   LDTIDHIEINDTVERDG-VVFYRIDVFLTHKTSHIP------------TIKSTVVSDQPD  82

Query  102  YQVEYRYSTFRALRQRVG  119
            YQ+E R++ F  LR +V 
Sbjct  83   YQLERRFNEFANLRYKVW  100

>PHYSO_315355
Length=190

 Score = 31.6 bits (70),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 34/77 (44%), Gaps = 13/77 (17%)

Query  42   LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPD  101
            L ++ H+ ++   +R   V  Y ++VFLQ +   IP                      PD
Sbjct  32   LEKIDHIEINGTTERNG-VVYYRVEVFLQHSMSRIP------------TVKATAVADHPD  78

Query  102  YQVEYRYSTFRALRQRV  118
            YQ+E R+S F  LR +V
Sbjct  79   YQLERRFSDFANLRYQV  95

>PPTG_16723
Length=188

 Score = 31.2 bits (69),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 36/77 (47%), Gaps = 14/77 (18%)

Query  42   LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPD  101
            L ++ HV ++    R   V  YVLDV+L+ +   IP               +     RPD
Sbjct  35   LEKIGHVEINRTIVRGG-VVYYVLDVYLEHSTSRIP-------------TNKSTTTGRPD  80

Query  102  YQVEYRYSTFRALRQRV  118
            YQ++ R++ F  LR +V
Sbjct  81   YQLQRRFNDFANLRYQV  97

>PHALS_05503
Length=607

 Score = 31.6 bits (70),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 25/98 (26%), Positives = 50/98 (51%), Gaps = 15/98 (15%)

Query  153  QKALDRATQQERKKTRKMQKIANKAARQRGSSGSNRIALLSAGVCSIASDEDILAEIWAS  212
            +K+++ +++Q+R++ R     A K  RQR +    ++  L     S+A++   L+++   
Sbjct  390  RKSMNYSSEQKRERNRA----AVKKCRQRQAL---KLEYLQRKAESLAAENQTLSQMLVR  442

Query  213  RSPSCD--------GIADDDLPEVDEDFSQSAPMEFVF  242
            ++   D        GI  D L ++ E F+QS P +FV 
Sbjct  443  KTELGDEQRTSLTRGIQIDILLKIKEIFTQSLPKDFVL  480

>PHYSO_284926
Length=126

 Score = 30.0 bits (66),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 37/77 (48%), Gaps = 10/77 (13%)

Query  42   LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPD  101
            L ++  V ++   +R+  V  YVLDVFL+ +   IP          +K         RPD
Sbjct  39   LAKIDRVEINHTTERDG-VVYYVLDVFLEHSTSRIP---------TRKTTQASSASGRPD  88

Query  102  YQVEYRYSTFRALRQRV  118
            Y ++ R++ F  LR +V
Sbjct  89   YTLQKRFNDFADLRHQV  105

>PHYSO_284925
Length=126

 Score = 30.0 bits (66),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 37/77 (48%), Gaps = 10/77 (13%)

Query  42   LNQVHHVRMSTAYDREEHVTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPD  101
            L ++  V ++   +R+  V  YVLDVFL+ +   IP          +K         RPD
Sbjct  39   LAKIDRVEINHTTERDG-VVYYVLDVFLEHSTSRIP---------TRKTTQASSASGRPD  88

Query  102  YQVEYRYSTFRALRQRV  118
            Y ++ R++ F  LR +V
Sbjct  89   YTLQKRFNDFADLRHQV  105

>PYIW_18765
Length=227

 Score = 30.8 bits (68),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query  60   VTVYVLDVFLQSAPRGIP----KPVkeskrerkkrelrekdelrPDYQVEYRYSTFRALR  115
            VT YV+DV+L  +   IP    KP    K     +         PD+++  R+++F  LR
Sbjct  62   VTYYVVDVYLAHSTSRIPTNNVKPSAHHKTTSFSKTTTVTANREPDFRIVRRFASFDQLR  121

Query  116  QRVG  119
             ++G
Sbjct  122  AQIG  125

>PYU1_G003204
Length=218

 Score = 30.8 bits (68),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 27/59 (46%), Gaps = 2/59 (3%)

Query  60   VTVYVLDVFLQSAPRGIPKPVkeskrerkkrelrekdelrPDYQVEYRYSTFRALRQRV  118
            VT YVLDV+L      +P        +R           +PDYQVE R+S F  LR  V
Sbjct  92   VTYYVLDVYLYHFTTRLP--ANLKNPQRAALHSSPLKANKPDYQVERRFSAFCQLRDEV  148

Lambda      K        H        a         alpha
   0.319    0.132    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 19962319932

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40