Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYKE_572092212216953e-92
PPTG_1667292862193921e-45
PITG_0001191602023672e-43
PHYCA_50470692532123578e-41
PHYSO_4782539169873352e-38
PHALS_108359264902585e-26
HYAP_015139248902507e-25
PYVX_158639181651854e-16
PYU1_G00322593697227661421e-09
HYAP_015081113286674.5
SDRG_162621269121937676.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYKE_5720

Length=221
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYKE_5720                                                            272        3e-92
PPTG_16672                                                            155        1e-45
PITG_00011                                                            145        2e-43
PHYCA_504706                                                          142        8e-41
PHYSO_478253                                                          133        2e-38
PHALS_10835                                                           103        5e-26
HYAP_01513                                                            100        7e-25
PYVX_15863                                                            75.9       4e-16
PYU1_G003225                                                          59.3       1e-09
HYAP_01508                                                            30.4       4.5  
SDRG_16262                                                            30.4       6.2  

>PHYKE_5720
Length=221

 Score = 272 bits (695),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 221/221 (100%), Positives = 221/221 (100%), Gaps = 0/221 (0%)

Query  1    METRVRPSVSEPTKRRHSGGFIRAIGGLFKRRSSDANGLSAPsdsessqrstsrwsrfsL  60
            METRVRPSVSEPTKRRHSGGFIRAIGGLFKRRSSDANGLSAPSDSESSQRSTSRWSRFSL
Sbjct  1    METRVRPSVSEPTKRRHSGGFIRAIGGLFKRRSSDANGLSAPSDSESSQRSTSRWSRFSL  60

Query  61   RHSLpeapmeveavaapeaapIRENDSVSTpspsphpeeppakkakkaekpkkekkekkp  120
            RHSLPEAPMEVEAVAAPEAAPIRENDSVSTPSPSPHPEEPPAKKAKKAEKPKKEKKEKKP
Sbjct  61   RHSLPEAPMEVEAVAAPEAAPIRENDSVSTPSPSPHPEEPPAKKAKKAEKPKKEKKEKKP  120

Query  121  kppsqkskpspTDTPELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLD  180
            KPPSQKSKPSPTDTPELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLD
Sbjct  121  KPPSQKSKPSPTDTPELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLD  180

Query  181  DLHENDLRPSLQAKMPQFFSPPVVEHMRRSSILPDPREYEF  221
            DLHENDLRPSLQAKMPQFFSPPVVEHMRRSSILPDPREYEF
Sbjct  181  DLHENDLRPSLQAKMPQFFSPPVVEHMRRSSILPDPREYEF  221

>PPTG_16672
Length=286

 Score = 155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 156/219 (71%), Gaps = 8/219 (4%)

Query  5    VRPSVSEPTKRRHSGGFIRAIGGLFKRRSSDANGLSAPsdsessqrstsrwsrfsLRH--  62
            V  + +EP  +R + G +RAIGGLFKR++SD +    PSDSE+SQR TSRWSR+S  H  
Sbjct  74   VHAAAAEPPTKRKTRGIMRAIGGLFKRKASDVDDAMEPSDSEASQRRTSRWSRWSHSHRG  133

Query  63   SLpeapmeveavaapeaapIRENDSVSTpspsphpeeppakkakkaekpkkekkekkpkp  122
            S PEAP+EV AVAAPE API+EN+S ++      P     KKA       ++K       
Sbjct  134  SFPEAPLEVAAVAAPETAPIQENESAASSPHPDEPPAKKVKKATVEHPTTEKKASPLSFN  193

Query  123  psqkskpspTDTPELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDL  182
             +++S    TD  ELL+A   +S DE GAEP R+SFLFFGGSD +STF P+LRPS+LDDL
Sbjct  194  KTKQSP---TDPSELLMA---DSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDL  247

Query  183  HENDLRPSLQAKMPQFFSPPVVEHMRRSSILPDPREYEF  221
            HEND+RPSLQAKMP FFSPP+VEHMRRSSILPDP+EYEF
Sbjct  248  HENDIRPSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF  286

>PITG_00011
Length=160

 Score = 145 bits (367),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 140/202 (69%), Gaps = 44/202 (22%)

Query  22   IRAIGGLFKRRSSDANGLSAPsdsessqrstsrwsrfsLRH--SLpeapmeveavaapea  79
            +RAIGGLFKR+ SDA+  +APSDSE+SQR TSRWSR+S  H  SLPEAP++V AVAAPE 
Sbjct  1    MRAIGGLFKRKCSDADDATAPSDSEASQRRTSRWSRWSHSHRGSLPEAPLDVAAVAAPET  60

Query  80   apIRENDSVSTpspsphpeeppakkakkaekpkkekkekkpkppsqkskpspTDTPELLL  139
            API+ENDS                                        K SPTD  +LLL
Sbjct  61   APIQENDST---------------------------------------KQSPTDPSDLLL  81

Query  140  AAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSLQAKMPQFF  199
            A   +S DE GAEP R+SFLFFGGSD +STF P+LRPS+LDDLH+ND+RPSLQAKMP FF
Sbjct  82   A---DSSDESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFF  138

Query  200  SPPVVEHMRRSSILPDPREYEF  221
            SPP+VE+MRRSSILPDP+EYEF
Sbjct  139  SPPLVENMRRSSILPDPKEYEF  160

>PHYCA_504706
Length=253

 Score = 142 bits (357),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 145/212 (68%), Gaps = 10/212 (5%)

Query  12   PTKRRHSGGFIRAIGGLFKRRSSDANGLSAPsdsessq--rstsrwsrfsLRHSLpeapm  69
            PTKR+H G  +RAIGGLFKR+SSDA+  +APSDSE+SQ   S       S R S+PEAP+
Sbjct  50   PTKRKHRG-LMRAIGGLFKRKSSDADDATAPSDSEASQRRTSRWSRWSHSNRGSMPEAPL  108

Query  70   eveavaapeaapIRENDSVSTpspsphpeeppakkakkaekpkkekkekkpkppsqkskp  129
            EV AVA PE API+EN+SV++      P     KK K  +  K+ K +       Q    
Sbjct  109  EVAAVAEPETAPIQENESVASSPHMEEPPAKKVKKVKAEKPKKEAKIKPPSFNTKQSP--  166

Query  130  spTDTPELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHENDLRP  189
              TD P  L+A  S S D    EP R+SFLFFGGSD +STF P+LRPS+ D+LHEND+RP
Sbjct  167  --TD-PSALVA--SGSSDGSVVEPQRISFLFFGGSDTDSTFQPELRPSEYDELHENDIRP  221

Query  190  SLQAKMPQFFSPPVVEHMRRSSILPDPREYEF  221
            SLQAKMP FFSPP+VE+MRRSSILPDP+EYEF
Sbjct  222  SLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253

>PHYSO_478253
Length=169

 Score = 133 bits (335),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)

Query  135  PELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSLQAK  194
            P  LL A  +S DE  AEPAR+SFLFFGGSD +STF P+LRPS+LDDLHEN++RPSLQ K
Sbjct  83   PSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVK  142

Query  195  MPQFFSPPVVEHMRRSSILPDPREYEF  221
            MP FFSPP+VE+MRRSSILPDP+EYEF
Sbjct  143  MPLFFSPPLVENMRRSSILPDPKEYEF  169

 Score = 32.0 bits (71),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)

Query  22  IRAIGGLFKRRSSDANGLSAP  42
           +RAIGGLFKR+S DA+   AP
Sbjct  1   MRAIGGLFKRKSIDADDPMAP  21

>PHALS_10835
Length=264

 Score = 103 bits (258),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 3/90 (3%)

Query  132  TDTPELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSL  191
            T+T E+L A      DE G E  R+SFLFFGGSD + TF P+LRPS+LDDLHEND+RPSL
Sbjct  178  TETSEMLSAT---LVDELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSL  234

Query  192  QAKMPQFFSPPVVEHMRRSSILPDPREYEF  221
            QAKMP F  PP+ +++RRSSILPDP EYEF
Sbjct  235  QAKMPLFLPPPLPKNVRRSSILPDPEEYEF  264

 Score = 36.2 bits (82),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 0/38 (0%)

Query  5   VRPSVSEPTKRRHSGGFIRAIGGLFKRRSSDANGLSAP  42
           V  +   P K+R   G +RAIGG F+R  SDA+  + P
Sbjct  59  VHAATGRPPKKRKHRGLMRAIGGFFRRNCSDADSDTRP  96

>HYAP_01513
Length=248

 Score = 100 bits (250),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 1/90 (1%)

Query  132  TDTPELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSL  191
            TD+ ELL  AES SG+E   +P R+SFL FGGS+ +STF P+L PS+ DD+H +++RP L
Sbjct  160  TDSSELL-RAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVL  218

Query  192  QAKMPQFFSPPVVEHMRRSSILPDPREYEF  221
            Q KMP FFS P+ E +RRSS   DP+EYE 
Sbjct  219  QNKMPLFFSLPLAERLRRSSAKSDPKEYEL  248

 Score = 34.3 bits (77),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  8   SVSEPT--KRRHSGGFIRAIGGLFKRRSSDANGLSAP  42
           SVS+PT  K++   G IRA+G  FKR+ SD +    P
Sbjct  33  SVSQPTEKKKKPHRGLIRAVGVFFKRKCSDGDATVRP  69

>PYVX_15863
Length=181

 Score = 75.9 bits (185),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 1/65 (2%)

Query  158  FLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSLQAKMPQFFSPPVVEHMRRSSIL-PDP  216
            FLF+GGSD +  F PDLRPS LD +  + +RP ++  MP FFS P  E++RRSSIL  DP
Sbjct  117  FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADP  176

Query  217  REYEF  221
            REYEF
Sbjct  177  REYEF  181

>PYU1_G003225
Length=227

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 2/66 (3%)

Query  158  FLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSLQAKMPQFFSPPV--VEHMRRSSILPD  215
            FLF+ GS  +++F P+   S + ++  N +RPSL  +MP FFSPP       RRSSIL D
Sbjct  126  FLFYPGSAEDNSFKPEKVTSSIVEIDYNAIRPSLTLQMPVFFSPPTEPSNFPRRSSILTD  185

Query  216  PREYEF  221
            PREYE 
Sbjct  186  PREYEL  191

>HYAP_01508
Length=132

 Score = 30.4 bits (67),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 35/86 (41%), Gaps = 20/86 (23%)

Query  142  ESESGDEYGAEPARLS-----------FLFFGGSDNESTFVPDL---------RPSDLDD  181
            + ++G+  GA  AR S           FL F GSD  ++    +         R + L+ 
Sbjct  40   KKKTGNRSGASEARCSTRFSSTVERSQFLLFCGSDTATSPAELVSADGTTLASRFAKLNA  99

Query  182  LHENDLRPSLQAKMPQFFSPPVVEHM  207
                  +P +   MP FF PPVV  +
Sbjct  100  PGTAATQPVINRHMPVFFMPPVVAEL  125

>SDRG_16262
Length=219

 Score = 30.4 bits (67),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  146  GDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDL  182
            GD Y  EPA  ++LF     +E+ F+ DLRPS + +L
Sbjct  12   GDVY--EPAEDTYLFLDAIQDETPFLADLRPSLVLEL  46

Lambda      K        H        a         alpha
   0.315    0.134    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11011317900

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40