Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_5561621475635135116880.0
PHYRA_811001475634935114250.0
PPTG_171271475635135114250.0
PHYSO_4715231475634835114210.0
PITG_184561475635135113880.0
PHALS_064781475634535112986e-180
PHYKE_83931475632635111334e-155
PYU1_G001735147563423528575e-113
PYIR_13451147563593638552e-112
PYAP_17762147563483578342e-109
PYVX_18171147562943387996e-105
PYIW_19971147563483647552e-97
PYAR_13570147563223276792e-86
CCA18899147563433295856e-72
CCI45123147563013044451e-51
SPRG_06336147563352334281e-48
SDRG_01781147563352324113e-46
H310_09223147563333384018e-45
H257_06294147563583553915e-43
CCI451271609872021972022e-17
HYAP_086451612815141161386e-08
PHYRA_849161612815411151377e-08
PHYKE_19901612814991151361e-07
PYIR_215891612815681321351e-07
PYU1_G0063471612810951151332e-07
PYAR_23286161286071171323e-07
PHYSO_3617471612815231161323e-07
PYVX_204381612813461341306e-07
PYAP_169971612810181111298e-07
PYIW_17381161289521291289e-07
CCI447521612815261181281e-06
PPTG_193711526711951661261e-06
PHYRA_825431526711991601262e-06
SPRG_060581612812581371252e-06
PPTG_188981612815591071252e-06
H310_002311612814951221243e-06
PITG_205621612815591071243e-06
CCA188751612815141111234e-06
SDRG_1276312510913171111208e-06
H257_067221612814821121191e-05
PYU1_G008848152677651291181e-05
PHYSO_5445981526711631441182e-05
SPRG_0605912510913121111172e-05
PITG_192131526712011431162e-05
PYIR_183821526711541291162e-05
PYU1_G00106314459783351153e-05
PYAP_1729014459835361154e-05
PHALS_040981526711831541154e-05
PYIW_1317214459939351154e-05
PYIR_1530914459937351154e-05
PYIW_16987152678211231144e-05
PYIW_21108951125931301154e-05
PHYKE_247914459171511086e-05
PYIR_17453951126191131137e-05
H257_067211251091238401127e-05
SDRG_127621612813921171128e-05
PYVX_1357414459950351119e-05
CCA180231526711381101119e-05
PYAR_1991414459788351111e-04
CCI4122514459981351111e-04
CCI462351526711551101111e-04
H310_002301251091248431111e-04
PHALS_0653314459930351092e-04
PYAR_154631526710911101092e-04
PITG_1806714459924541092e-04
PPTG_1340114459927541092e-04
PHYRA_7783414459936351092e-04
PYAP_186361526710091231082e-04
PHYCA_503112152926214341042e-04
CCI42457152926906351083e-04
PYVX_133121526710161101083e-04
CCA1648714459975351083e-04
PHYKE_6662152677651701073e-04
H257_03093152679751101064e-04
CCA17102152926884351064e-04
SDRG_01407152678151191055e-04
H310_04843152679681101056e-04
HYAP_044571526712031331030.001
SPRG_00890152678831101020.001
PITG_021091853522561010.002
PITG_11303931829334990.002
PHYCA_504801185339856990.002
CCI1048915870977737990.003
PHYSO_3436291445997730990.003
PPTG_14630185339856980.003
PHYSO_55616414313765136970.004
H257_0336112342869960970.004
PYIW_20891185329156960.005
PITG_1789314313747119960.006
SPRG_091281431362030950.009
PPTG_045531431390451940.010
SPRG_1702213189210739870.011
PHALS_0669914313884129940.013
H257_098231431365426930.013
PHYRA_7353514313875136930.014
PHYSO_478611185352256930.014
PYVX_18338241774644930.016
SDRG_05150241778739930.016
H310_070709639680117930.017
H310_063781445983735930.017
SPRG_08346241779739930.018
PHYSO_344112241781337920.018
PYIW_2190185060913116930.018
PHYCA_506137241781037920.018
PPTG_05519241781037920.019
PITG_02762241781037920.019
SDRG_14487123428964114920.019
H257_135671445983635920.019
PHYRA_79281241780937920.019
PYIW_18480241775537920.019
HYAP_08026241779837920.021
SDRG_142861431367030920.021
PYVX_2334914313924113920.022
SDRG_088001445988135920.022
PHYRA_7353469686121051920.022
PYU1_G012870185335256910.022
PYAP_22646241781537910.024
SDRG_055678195980137920.024
CCA21715241778237910.025
CCA2186015507878237910.025
CCI3936728852046121910.026
SPRG_060218195983114910.029
H310_01921185334189900.030
PYIW_1961312330131471910.031
PHYRA_73430185339556900.032
SPRG_054491445972335900.032
PHYKE_5678241780944900.032
H257_0902812554556125900.035
PHYKE_491118534632790.035
PYU1_G004386241783742900.038
PYAP_2347885060897168900.038
PHALS_03645241783042900.040
SPRG_1631213132226160870.049
PYIR_13120241781437890.050
H257_039319639695118880.057
PYAR_19883241783337880.059
PHALS_0558728851361114880.059
H257_07514241781037870.071
PHYSO_50691837975848870.072
H310_07701241781137870.073
PYVX_145276030126956870.077
H257_03363185331673860.079
PHALS_035401690469870.080
PHALS_06568185338856860.087
PYIR_2458885060909113870.091
HYAP_1375711517262120850.098
PHYCA_52966011517345128850.098
SPRG_02752123428831112860.099
PYAR_157921109212142810.100
PHYRA_72718379732124860.10
PYAP_13695185334856850.11
PPTG_1075537972345860.11
SPRG_119001660582860.11
SDRG_0731061351116114860.11
HYAP_0640312330103765860.11
CCI40991241780147860.12
PYU1_G0032291681031860.12
PYAP_1956011517337137840.12
SPRG_143129639661123850.13
PYAP_161619866188941850.13
SPRG_00364122272255111830.14
PYU1_G0074238506092848850.14
CCI43793134791117181850.14
HYAP_0930413479114488850.14
PYVX_2343212330151060850.14
H257_051751643067865850.14
H310_136271431367826850.15
PYU1_G0128591850118356850.16
H257_108475920792186850.16
PITG_0041637969845850.16
PPTG_1604428851378114850.16
CCA2425210538323108830.17
PYIR_1316828851353110850.17
SDRG_0008012454429860830.17
PYAR_2606510677931460830.19
PITG_0331828851343114840.19
PHYKE_7856288534632830.19
PYAR_186909511245569840.20
H310_046671643068065840.20
PPTG_1462618501055116840.20
H257_06469219447630760.21
SDRG_03531122272255111820.21
PYIR_13555185335556830.21
PITG_0210618501015147840.21
H257_13346749058745830.22
PYU1_G0122741583587384840.22
SDRG_0215412656882259830.22
H310_140199204683161830.22
PYIR_144941681952830.23
HYAP_06101288598435830.23
PPTG_1898913479121332830.24
SDRG_1477112554549118830.24
PYAP_1673481951314113830.25
PYIR_1511813479122280830.25
PYAR_1929185060711136830.25
PYU1_G0007249278718936800.26
H310_09363140947195467830.26
SPRG_14955749063563830.27
SPRG_00889122518994110830.27
PYVX_14593185096450830.28
H310_14473749061346820.29
H310_06666863288734820.30
PHALS_0793013479120032820.30
PHYRA_8194413479114932820.30
PITG_20103158351301138820.31
PYAP_237441109212342770.32
H257_02642640397536820.33
H257_09270142234884129820.34
CCA2689061471530112820.35
PITG_115789511213152820.35
PHALS_06336185251156810.35
SDRG_01408122518916110820.36
PHYRA_944092885127035820.37
PHYSO_2484812885128335820.37
PPTG_117149511244452820.38
PHALS_125031151734031800.40
SPRG_02753185330957800.42
H310_1244812554555124810.42
PYU1_G00924995112580124810.44
PHYRA_830719511230058810.44
SDRG_14486185330857800.46
SDRG_062881664154800.48
PYAR_1342937969446800.49
SPRG_0883412656882559810.50
PHYSO_5299319511221158810.50
H257_030951395771086143810.51
CCA1903395111883143810.52
CCA27255157810112568800.53
CCA1551328851341114800.55
SDRG_14070749063054800.57
CCI109286147153072800.57
SPRG_0921112554549118800.58
H310_0666713886889640800.58
SPRG_082171643068755800.60
SDRG_048711643068755800.60
PHYRA_7842512330153260800.61
PHYKE_914612554557123790.62
PHYKE_3811517227117780.63
SDRG_07086128106656135800.63
H257_01308863289734800.65
PYIR_2337215835141536800.67
PYAR_14615863251734790.70
PHYSO_55923412330154460790.74
PHYSO_315255158351301137790.74
SDRG_08383123078132159790.79
PYAR_2248511517333120780.83
H257_0879361351178113790.86
PYIW_1891113479119670790.86
PYU1_G0095089576532832780.87
HYAP_117121255455897780.88
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_556162

Length=351
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_556162                                                          654        0.0   
PHYRA_81100                                                           553        0.0   
PPTG_17127                                                            553        0.0   
PHYSO_471523                                                          551        0.0   
PITG_18456                                                            539        0.0   
PHALS_06478                                                           504        6e-180
PHYKE_8393                                                            441        4e-155
PYU1_G001735                                                          334        5e-113
PYIR_13451                                                            333        2e-112
PYAP_17762                                                            325        2e-109
PYVX_18171                                                            312        6e-105
PYIW_19971                                                            295        2e-97 
PYAR_13570                                                            266        2e-86 
CCA18899                                                              229        6e-72 
CCI45123                                                              176        1e-51 
SPRG_06336                                                            169        1e-48 
SDRG_01781                                                            162        3e-46 
H310_09223                                                            159        8e-45 
H257_06294                                                            155        5e-43 
CCI45127                                                              82.4       2e-17 
HYAP_08645                                                            57.8       6e-08 
PHYRA_84916                                                           57.4       7e-08 
PHYKE_1990                                                            57.0       1e-07 
PYIR_21589                                                            56.6       1e-07 
PYU1_G006347                                                          55.8       2e-07 
PYAR_23286                                                            55.5       3e-07 
PHYSO_361747                                                          55.5       3e-07 
PYVX_20438                                                            54.7       6e-07 
PYAP_16997                                                            54.3       8e-07 
PYIW_17381                                                            53.9       9e-07 
CCI44752                                                              53.9       1e-06 
PPTG_19371                                                            53.1       1e-06 
PHYRA_82543                                                           53.1       2e-06 
SPRG_06058                                                            52.8       2e-06 
PPTG_18898                                                            52.8       2e-06 
H310_00231                                                            52.4       3e-06 
PITG_20562                                                            52.4       3e-06 
CCA18875                                                              52.0       4e-06 
SDRG_12763                                                            50.8       8e-06 
H257_06722                                                            50.4       1e-05 
PYU1_G008848                                                          50.1       1e-05 
PHYSO_544598                                                          50.1       2e-05 
SPRG_06059                                                            49.7       2e-05 
PITG_19213                                                            49.3       2e-05 
PYIR_18382                                                            49.3       2e-05 
PYU1_G001063                                                          48.9       3e-05 
PYAP_17290                                                            48.9       4e-05 
PHALS_04098                                                           48.9       4e-05 
PYIW_13172                                                            48.9       4e-05 
PYIR_15309                                                            48.9       4e-05 
PYIW_16987                                                            48.5       4e-05 
PYIW_21108                                                            48.9       4e-05 
PHYKE_2479                                                            46.2       6e-05 
PYIR_17453                                                            48.1       7e-05 
H257_06721                                                            47.8       7e-05 
SDRG_12762                                                            47.8       8e-05 
PYVX_13574                                                            47.4       9e-05 
CCA18023                                                              47.4       9e-05 
PYAR_19914                                                            47.4       1e-04 
CCI41225                                                              47.4       1e-04 
CCI46235                                                              47.4       1e-04 
H310_00230                                                            47.4       1e-04 
PHALS_06533                                                           46.6       2e-04 
PYAR_15463                                                            46.6       2e-04 
PITG_18067                                                            46.6       2e-04 
PPTG_13401                                                            46.6       2e-04 
PHYRA_77834                                                           46.6       2e-04 
PYAP_18636                                                            46.2       2e-04 
PHYCA_503112                                                          44.7       2e-04 
CCI42457                                                              46.2       3e-04 
PYVX_13312                                                            46.2       3e-04 
CCA16487                                                              46.2       3e-04 
PHYKE_6662                                                            45.8       3e-04 
H257_03093                                                            45.4       4e-04 
CCA17102                                                              45.4       4e-04 
SDRG_01407                                                            45.1       5e-04 
H310_04843                                                            45.1       6e-04 
HYAP_04457                                                            44.3       0.001 
SPRG_00890                                                            43.9       0.001 
PITG_02109                                                            43.5       0.002 
PITG_11303                                                            42.7       0.002 
PHYCA_504801                                                          42.7       0.002 
CCI10489                                                              42.7       0.003 
PHYSO_343629                                                          42.7       0.003 
PPTG_14630                                                            42.4       0.003 
PHYSO_556164                                                          42.0       0.004 
H257_03361                                                            42.0       0.004 
PYIW_20891                                                            41.6       0.005 
PITG_17893                                                            41.6       0.006 
SPRG_09128                                                            41.2       0.009 
PPTG_04553                                                            40.8       0.010 
SPRG_17022                                                            38.1       0.011 
PHALS_06699                                                           40.8       0.013 
H257_09823                                                            40.4       0.013 
PHYRA_73535                                                           40.4       0.014 
PHYSO_478611                                                          40.4       0.014 
PYVX_18338                                                            40.4       0.016 
SDRG_05150                                                            40.4       0.016 
H310_07070                                                            40.4       0.017 
H310_06378                                                            40.4       0.017 
SPRG_08346                                                            40.4       0.018 
PHYSO_344112                                                          40.0       0.018 
PYIW_21901                                                            40.4       0.018 
PHYCA_506137                                                          40.0       0.018 
PPTG_05519                                                            40.0       0.019 
PITG_02762                                                            40.0       0.019 
SDRG_14487                                                            40.0       0.019 
H257_13567                                                            40.0       0.019 
PHYRA_79281                                                           40.0       0.019 
PYIW_18480                                                            40.0       0.019 
HYAP_08026                                                            40.0       0.021 
SDRG_14286                                                            40.0       0.021 
PYVX_23349                                                            40.0       0.022 
SDRG_08800                                                            40.0       0.022 
PHYRA_73534                                                           40.0       0.022 
PYU1_G012870                                                          39.7       0.022 
PYAP_22646                                                            39.7       0.024 
SDRG_05567                                                            40.0       0.024 
CCA21715                                                              39.7       0.025 
CCA21860                                                              39.7       0.025 
CCI39367                                                              39.7       0.026 
SPRG_06021                                                            39.7       0.029 
H310_01921                                                            39.3       0.030 
PYIW_19613                                                            39.7       0.031 
PHYRA_73430                                                           39.3       0.032 
SPRG_05449                                                            39.3       0.032 
PHYKE_5678                                                            39.3       0.032 
H257_09028                                                            39.3       0.035 
PHYKE_4911                                                            35.0       0.035 
PYU1_G004386                                                          39.3       0.038 
PYAP_23478                                                            39.3       0.038 
PHALS_03645                                                           39.3       0.040 
SPRG_16312                                                            38.1       0.049 
PYIR_13120                                                            38.9       0.050 
H257_03931                                                            38.5       0.057 
PYAR_19883                                                            38.5       0.059 
PHALS_05587                                                           38.5       0.059 
H257_07514                                                            38.1       0.071 
PHYSO_506918                                                          38.1       0.072 
H310_07701                                                            38.1       0.073 
PYVX_14527                                                            38.1       0.077 
H257_03363                                                            37.7       0.079 
PHALS_03540                                                           38.1       0.080 
PHALS_06568                                                           37.7       0.087 
PYIR_24588                                                            38.1       0.091 
HYAP_13757                                                            37.4       0.098 
PHYCA_529660                                                          37.4       0.098 
SPRG_02752                                                            37.7       0.099 
PYAR_15792                                                            35.8       0.100 
PHYRA_72718                                                           37.7       0.10  
PYAP_13695                                                            37.4       0.11  
PPTG_10755                                                            37.7       0.11  
SPRG_11900                                                            37.7       0.11  
SDRG_07310                                                            37.7       0.11  
HYAP_06403                                                            37.7       0.11  
CCI40991                                                              37.7       0.12  
PYU1_G003229                                                          37.7       0.12  
PYAP_19560                                                            37.0       0.12  
SPRG_14312                                                            37.4       0.13  
PYAP_16161                                                            37.4       0.13  
SPRG_00364                                                            36.6       0.14  
PYU1_G007423                                                          37.4       0.14  
CCI43793                                                              37.4       0.14  
HYAP_09304                                                            37.4       0.14  
PYVX_23432                                                            37.4       0.14  
H257_05175                                                            37.4       0.14  
H310_13627                                                            37.4       0.15  
PYU1_G012859                                                          37.4       0.16  
H257_10847                                                            37.4       0.16  
PITG_00416                                                            37.4       0.16  
PPTG_16044                                                            37.4       0.16  
CCA24252                                                              36.6       0.17  
PYIR_13168                                                            37.4       0.17  
SDRG_00080                                                            36.6       0.17  
PYAR_26065                                                            36.6       0.19  
PITG_03318                                                            37.0       0.19  
PHYKE_7856                                                            36.6       0.19  
PYAR_18690                                                            37.0       0.20  
H310_04667                                                            37.0       0.20  
PPTG_14626                                                            37.0       0.20  
H257_06469                                                            33.9       0.21  
SDRG_03531                                                            36.2       0.21  
PYIR_13555                                                            36.6       0.21  
PITG_02106                                                            37.0       0.21  
H257_13346                                                            36.6       0.22  
PYU1_G012274                                                          37.0       0.22  
SDRG_02154                                                            36.6       0.22  
H310_14019                                                            36.6       0.22  
PYIR_14494                                                            36.6       0.23  
HYAP_06101                                                            36.6       0.23  
PPTG_18989                                                            36.6       0.24  
SDRG_14771                                                            36.6       0.24  
PYAP_16734                                                            36.6       0.25  
PYIR_15118                                                            36.6       0.25  
PYAR_19291                                                            36.6       0.25  
PYU1_G000724                                                          35.4       0.26  
H310_09363                                                            36.6       0.26  
SPRG_14955                                                            36.6       0.27  
SPRG_00889                                                            36.6       0.27  
PYVX_14593                                                            36.6       0.28  
H310_14473                                                            36.2       0.29  
H310_06666                                                            36.2       0.30  
PHALS_07930                                                           36.2       0.30  
PHYRA_81944                                                           36.2       0.30  
PITG_20103                                                            36.2       0.31  
PYAP_23744                                                            34.3       0.32  
H257_02642                                                            36.2       0.33  
H257_09270                                                            36.2       0.34  
CCA26890                                                              36.2       0.35  
PITG_11578                                                            36.2       0.35  
PHALS_06336                                                           35.8       0.35  
SDRG_01408                                                            36.2       0.36  
PHYRA_94409                                                           36.2       0.37  
PHYSO_248481                                                          36.2       0.37  
PPTG_11714                                                            36.2       0.38  
PHALS_12503                                                           35.4       0.40  
SPRG_02753                                                            35.4       0.42  
H310_12448                                                            35.8       0.42  
PYU1_G009249                                                          35.8       0.44  
PHYRA_83071                                                           35.8       0.44  
SDRG_14486                                                            35.4       0.46  
SDRG_06288                                                            35.4       0.48  
PYAR_13429                                                            35.4       0.49  
SPRG_08834                                                            35.8       0.50  
PHYSO_529931                                                          35.8       0.50  
H257_03095                                                            35.8       0.51  
CCA19033                                                              35.8       0.52  
CCA27255                                                              35.4       0.53  
CCA15513                                                              35.4       0.55  
SDRG_14070                                                            35.4       0.57  
CCI10928                                                              35.4       0.57  
SPRG_09211                                                            35.4       0.58  
H310_06667                                                            35.4       0.58  
SPRG_08217                                                            35.4       0.60  
SDRG_04871                                                            35.4       0.60  
PHYRA_78425                                                           35.4       0.61  
PHYKE_9146                                                            35.0       0.62  
PHYKE_38                                                              34.7       0.63  
SDRG_07086                                                            35.4       0.63  
H257_01308                                                            35.4       0.65  
PYIR_23372                                                            35.4       0.67  
PYAR_14615                                                            35.0       0.70  
PHYSO_559234                                                          35.0       0.74  
PHYSO_315255                                                          35.0       0.74  
SDRG_08383                                                            35.0       0.79  
PYAR_22485                                                            34.7       0.83  
H257_08793                                                            35.0       0.86  
PYIW_18911                                                            35.0       0.86  
PYU1_G009508                                                          34.7       0.87  
HYAP_11712                                                            34.7       0.88  
SPRG_04912                                                            34.3       0.92  
PYAR_23366                                                            34.7       0.94  
SPRG_02010                                                            34.7       0.96  
SDRG_08236                                                            34.7       0.96  
PYIR_18236                                                            34.7       0.96  
PHALS_03335                                                           34.7       0.97  
SPRG_01860                                                            34.7       0.97  
PITG_13665                                                            32.7       0.98  
CCI43456                                                              33.1       0.98  
H310_05692                                                            34.7       1.0   
PHALS_07062                                                           32.7       1.0   
PHYSO_289146                                                          32.7       1.0   
SDRG_05608                                                            32.7       1.0   
HYAP_08248                                                            34.7       1.0   
PHYCA_510506                                                          32.7       1.0   
PHYKE_7347                                                            32.7       1.0   
HYAP_02360                                                            32.7       1.0   
PPTG_06823                                                            34.7       1.1   
PPTG_19631                                                            32.7       1.1   
PYIW_21944                                                            34.7       1.1   
SDRG_02135                                                            34.3       1.1   
PHYKE_4910                                                            34.3       1.1   
SPRG_02502                                                            32.7       1.1   
PHYKE_2581                                                            34.3       1.1   
CCA24531                                                              34.3       1.1   
PYIW_23724                                                            34.7       1.1   
PYIW_26522                                                            32.7       1.2   
PYU1_G008119                                                          32.7       1.2   
PYIR_15407                                                            32.7       1.2   
PHYSO_350197                                                          34.3       1.2   
PYIW_17571                                                            34.7       1.2   
CCI47145                                                              34.3       1.2   
PHYRA_85100                                                           32.7       1.2   
PHYRA_85097                                                           32.7       1.2   
PYVX_15906                                                            32.7       1.2   
HYAP_11713                                                            34.3       1.2   
H257_08182                                                            34.3       1.2   
H310_00912                                                            34.7       1.3   
PHALS_08097                                                           34.3       1.3   
CCA25510                                                              34.3       1.3   
PHYSO_319942                                                          33.5       1.3   
PHYCA_21243                                                           34.3       1.3   
H310_05457                                                            33.5       1.4   
PYIW_17818                                                            34.3       1.5   
H310_02133                                                            33.9       1.6   
PHYRA_79348                                                           33.9       1.7   
PYIW_14463                                                            33.1       1.8   
PYAP_22685                                                            33.9       1.8   
PYAP_13647                                                            33.1       1.9   
PHYSO_320361                                                          33.5       1.9   
SDRG_17208                                                            33.9       1.9   
PYAR_13491                                                            33.9       1.9   
PHYKE_1044                                                            33.5       2.0   
PHYCA_509385                                                          33.5       2.0   
CCA19118                                                              32.0       2.1   
SPRG_02939                                                            33.9       2.1   
PITG_16799                                                            33.5       2.1   
PHALS_06334                                                           33.5       2.1   
SPRG_01654                                                            33.5       2.1   
CCI42088                                                              33.5       2.1   
PHALS_01010                                                           33.5       2.2   
PHYRA_83696                                                           33.1       2.2   
PITG_14197                                                            33.1       2.2   
PYVX_22150                                                            33.1       2.2   
PYVX_14287                                                            33.5       2.3   
PHYSO_489872                                                          33.5       2.3   
SDRG_12776                                                            33.5       2.3   
PYAR_16228                                                            33.5       2.4   
H310_04842                                                            33.5       2.4   
H310_01094                                                            31.6       2.4   
H257_00729                                                            31.6       2.4   
PHYCA_506274                                                          33.5       2.5   
SPRG_15871                                                            31.2       2.5   
PITG_10462                                                            33.5       2.5   
PYIR_16780                                                            33.5       2.6   
PPTG_19471                                                            33.1       2.6   
PYVX_13084                                                            33.5       2.6   
PHALS_09273                                                           33.1       2.6   
PHALS_09729                                                           33.1       2.8   
PHYRA_73432                                                           33.5       2.8   
PYAP_24144                                                            33.1       2.8   
PYIW_18491                                                            33.5       2.8   
PHYSO_558498                                                          33.1       2.8   
PHALS_02608                                                           33.1       2.9   
PPTG_08785                                                            33.1       2.9   
PHYRA_82040                                                           33.1       3.0   
SDRG_03175                                                            33.1       3.0   
PHYCA_564296                                                          33.1       3.1   
H257_09269                                                            33.1       3.1   
PHYSO_349983                                                          33.1       3.2   
PYAR_25500                                                            32.7       3.2   
CCI43715                                                              32.7       3.3   
PYAP_22195                                                            33.1       3.3   
SPRG_06629                                                            32.7       3.3   
PYIR_22246                                                            32.7       3.4   
SDRG_07085                                                            33.1       3.4   
PHYRA_76931                                                           33.1       3.5   
H310_12180                                                            33.1       3.5   
H310_00209                                                            33.1       3.5   
H257_01309                                                            32.7       3.5   
H310_08803                                                            32.7       3.6   
PYAR_24323                                                            32.7       3.6   
PPTG_19153                                                            33.1       3.6   
HYAP_13267                                                            32.7       3.7   
SPRG_11536                                                            32.7       3.7   
PYIW_14611                                                            32.7       3.8   
PYU1_G007013                                                          32.7       3.8   
HYAP_11295                                                            32.7       3.8   
PYU1_G000461                                                          32.3       3.9   
PYVX_16714                                                            32.7       3.9   
SPRG_11537                                                            32.7       4.0   
PYVX_19982                                                            32.7       4.0   
H310_05691                                                            32.7       4.0   
PYU1_G006732                                                          32.7       4.1   
PYU1_G002632                                                          32.7       4.1   
PYVX_22589                                                            32.7       4.2   
PITG_09930                                                            32.7       4.2   
H257_16349                                                            32.0       4.3   
PYIR_16539                                                            32.7       4.3   
HYAP_02230                                                            32.7       4.3   
PYAP_17850                                                            32.7       4.4   
CCA19097                                                              32.7       4.4   
PYAR_18912                                                            32.7       4.6   
CCI45895                                                              32.7       4.6   
PYAP_15374                                                            32.3       4.8   
PYAR_16674                                                            32.3       4.9   
CCI45857                                                              32.3       4.9   
PYIR_21473                                                            32.3       5.0   
H310_02582                                                            32.3       5.1   
SPRG_06273                                                            32.3       5.1   
H257_00263                                                            32.3       5.2   
PYAP_18434                                                            32.3       5.2   
PPTG_16659                                                            32.3       5.2   
SDRG_00756                                                            32.3       5.3   
PYIW_15014                                                            32.3       5.4   
CCA23572                                                              32.3       5.5   
SDRG_15907                                                            32.3       5.6   
SDRG_01838                                                            32.3       5.7   
PHYSO_478442                                                          32.3       5.8   
PITG_17594                                                            32.3       5.8   
PHYSO_484541                                                          32.3       5.9   
CCA22329                                                              32.3       5.9   
CCA22367                                                              32.3       5.9   
PHYKE_5588                                                            32.0       6.1   
HYAP_13688                                                            32.3       6.1   
PPTG_07800                                                            31.2       6.1   
PHYRA_78815                                                           32.0       6.2   
H310_01510                                                            32.0       6.4   
H310_02933                                                            32.0       6.4   
PYVX_16095                                                            32.0       6.5   
HYAP_08916                                                            31.6       6.5   
PHYSO_485120                                                          30.4       7.1   
SDRG_15262                                                            32.0       7.2   
PYAP_14828                                                            32.0       7.4   
HYAP_07348                                                            32.0       7.4   
CCI49856                                                              32.0       7.4   
PYU1_G008981                                                          32.0       7.8   
PYAP_16658                                                            31.6       7.9   
PYIR_22667                                                            32.0       7.9   
PYIW_19873                                                            30.8       8.0   
SDRG_06927                                                            32.0       8.0   
SPRG_09805                                                            31.6       8.1   
CCA17832                                                              31.6       8.6   
PYVX_15039                                                            31.6       8.8   
H257_10063                                                            31.6       8.8   
PYIR_15898                                                            31.6       9.1   
PHYSO_563553                                                          31.6       9.2   
PHYCA_505441                                                          31.6       9.5   

>PHYCA_556162
Length=351

 Score = 654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/351 (100%), Positives = 351/351 (100%), Gaps = 0/351 (0%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC
Sbjct  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
            HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG
Sbjct  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180
            DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180

Query  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQAAESRIDPGASDlerlaqalge  300
            TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE
Sbjct  241  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  300

Query  301  lelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351
            LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF
Sbjct  301  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351

>PHYRA_81100
Length=349

 Score = 553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/351 (83%), Positives = 312/351 (89%), Gaps = 2/351 (1%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            MNILRVPE+GA  SGDKARPTSCEGYVTKRGHFRKSWRVRFLVL+GSNLQ++YYESRAAC
Sbjct  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
            HP   E S PKGSFYLSSIEPHEYVVGVMGAAGKPFGFKM+GHAPKKGYVELDVFVET G
Sbjct  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180
            DRNKWLEVARNALSAKRQLTRQAIDQSVS NKKNLFGF VSLSPQP ++PQKQMQTLT+N
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180

Query  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KD+LLS ALRDIEAAK +GREACNEIVIQGEKLDAIEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQAAESRIDPGASDlerlaqalge  300
            TLH+FS+DSRPKST+S       +  Q  G SP+RL  A E+  D G SDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTASK--GHSPQRSQQSGGSPSRLPPAMETINDAGVSDLERLAQALGE  298

Query  301  lelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351
            LE+QAE+LN EAG STQQI+ +EH LS VT RVEKQTKQASATLRAGP+LF
Sbjct  299  LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349

>PPTG_17127
Length=351

 Score = 553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/351 (84%), Positives = 319/351 (91%), Gaps = 0/351 (0%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            MNILRVPE G   SGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
            HP TGE S PKGSFYLSSIEPHEYVVGVMGAA KPFGFKMVGHAPKKGYVELDVFV+T+ 
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180
            DRNKWLEVARNALS KRQLTRQAIDQSVSPNKK LFGFSV+LSPQPA+SPQKQMQTL K+
Sbjct  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180

Query  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KD+LLS+ALR++EAAK +GREACNEIVIQGEKLD IEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQAAESRIDPGASDlerlaqalge  300
            TLH+FS+DSRPKST  SK +SPQR  QSGGSSP+RL  A ++  D G SDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300

Query  301  lelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351
            LE+QAE+LN EA HS+QQI+ IEHHL+ VT RVEKQTKQASATL AGPRLF
Sbjct  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHYSO_471523
Length=348

 Score = 551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/351 (83%), Positives = 312/351 (89%), Gaps = 3/351 (1%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            MNILRVPEVGA  SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNL V+YYESRAAC
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
            HP TGE S PKGSFYLSSIEPHEYVVGVMGAA KPFGFKMVGHAP+KGYVELDVFVET+ 
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180
            DRNKWLEVARNALSAKRQLTRQAIDQSVSPN+KNLFGF++SLSPQP +SPQKQMQTLTK+
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180

Query  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            +D+LLSDALRDIEAAKQ+GREACNEIV QGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQAAESRIDPGASDlerlaqalge  300
            TLH+FS+DSRPK+ S+SKA+     +      P RL  A +S  D G SDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKA-SASKAS--SPQRSQQSGRPPRLPPAMDSINDAGVSDLERLAQALGE  297

Query  301  lelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351
            LE+QAELLN EAG  TQQI+ IEH LS VT RVEKQTKQASA L +GPRLF
Sbjct  298  LEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348

>PITG_18456
Length=351

 Score = 539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/351 (85%), Positives = 320/351 (91%), Gaps = 0/351 (0%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            MNILRVPE GA  SGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
            HP  G+ S PKG FYLSSIEPHEYVVGVMGAA KPFGFKMVGHAPKKGYVELDVFV+T+ 
Sbjct  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180
            DRNKWLEVARNAL AKRQLTRQAIDQSVSP KKNLFGFSVSLSPQPA+SPQKQ+QTL+K+
Sbjct  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180

Query  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KD+LLS ALR++EAAK +GREACNEIV+QGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQAAESRIDPGASDlerlaqalge  300
            TLH+FS+DSRPKST SSK +SPQRS QSGGSSPTRL  A E   D G SDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300

Query  301  lelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351
            LE+QAELLN EAG S+QQI+ IEHHL+ VT RVEKQTKQASATL AGPRLF
Sbjct  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHALS_06478
Length=345

 Score = 504 bits (1298),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 271/351 (77%), Positives = 296/351 (84%), Gaps = 6/351 (2%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            MNILR+PE GA  SGDKA+PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQV YYESRAAC
Sbjct  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
            HP  GE++ PKGSFYLS+IEPHEYV+GVMGAA +PFGFKMVGHAP+KG+VELDVFVET  
Sbjct  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180
            DRNKWLEVA NAL AKRQLTRQAIDQSVSPNKK LFGFSV  S QP +SPQKQMQTL  +
Sbjct  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180

Query  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            K+ LL +ALR+IEAAK +GREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  181  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240

Query  241  TLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQAAESRIDPGASDlerlaqalge  300
            TLH FS+D+RPK       +       SG +SP+RL  A E   D G SDL+RLAQALGE
Sbjct  241  TLHFFSDDTRPKVPLGDHPH------HSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294

Query  301  lelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351
            LE+QAELLN E+GHS+QQI+ IEHHLS VT RVEKQTKQA ATL AGPRLF
Sbjct  295  LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345

>PHYKE_8393
Length=326

 Score = 441 bits (1133),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 249/351 (71%), Positives = 277/351 (79%), Gaps = 25/351 (7%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            MNILRVPEVGA  SGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
            HP  GE    KGSFYLS+I PHEYVVGVMGAA KPFGFKMVGHAP+KGYVELDVFVET+ 
Sbjct  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180
            DRNKWLEVARNAL AKRQ+ RQAIDQSVSP KK +FGF +SLSPQP + PQKQ+Q LT N
Sbjct  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHN  155

Query  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            K++LL++ALR++EAAK +GREACNEIV+QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  156  KEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215

Query  241  TLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQAAESRIDPGASDlerlaqalge  300
            TLH+FS+D+RPKS ++S  +SPQR+ QS GS+P  L  +  S  D  ASDLERLA ALGE
Sbjct  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGE  275

Query  301  lelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351
            LELQAELLN EAG STQQI  IE  LS VT RVEKQTKQASATL AGPRLF
Sbjct  276  LELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326

>PYU1_G001735
Length=342

 Score = 334 bits (857),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 192/352 (55%), Positives = 246/352 (70%), Gaps = 18/352 (5%)

Query  1    MNILRVPEVGAATSG-DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59
            MNILRVP+   A SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQV+Y+ESR A
Sbjct  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60

Query  60   CHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETV  119
             H      + PKGSFY+SS+E HEY +GVMG   KPFGFK+VGHAP KGY+ELD+FVE++
Sbjct  61   AHAP---GTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117

Query  120  GDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTK  179
             D NKWLEV +NAL A ++LTR+ +  S     K++FGF  S+SPQ       Q++ L  
Sbjct  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVKKLAA  167

Query  180  NKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239
             K++LL +ALR+IE AK IGREA NEIV QGEKLD +E DL  ++ DLD  DKLLR LKS
Sbjct  168  TKEELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227

Query  240  PTLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQA-AESRIDPGA---SDlerla  295
            P LH+FSND+R K  + + A +      S  +SP    +    ++I  G    +DLE LA
Sbjct  228  PVLHVFSNDNRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLA  287

Query  296  qalgelelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAG  347
             AL ELE QA L+N EA  ST+QI  IE  L++V  RV+ QTK+A+AT++AG
Sbjct  288  LALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339

>PYIR_13451
Length=359

 Score = 333 bits (855),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 195/363 (54%), Positives = 240/363 (66%), Gaps = 23/363 (6%)

Query  1    MNILRVPEVGAATSG------DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54
            MNILRVP+   ATSG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQV YY
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  55   ESRAACHPTTGEASP----PKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYV  110
            ESR A   ++         PKGSFY+SS+E HEY VGVMG   KPFGFK+VGHAPKKGY+
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  111  ELDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSP  170
            ELD+FVE++GD NKW+EV +NAL A ++ +R    Q  S   K +FGFS S SPQ     
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTT-KTMFGFSASASPQL----  175

Query  171  QKQMQTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFG  230
              Q++ L   K+DLL DALR+IE AK IGREA NEIV+QGEKLD +E DL  ++ DLD  
Sbjct  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233

Query  231  DKLLRRLKSPTLHMFSNDSRPKST------SSSKANspqrsqqsggsspTRLAQAAESRI  284
            DKLLR +K P LH+FS D R K +      S     +         +  T   Q    + 
Sbjct  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQR  293

Query  285  DPGASDlerlaqalgelelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATL  344
            +   SDLE+LA ALGELE QA L+N EA  ST+QI  +E  L+ V  RV+ QTK+A+AT+
Sbjct  294  NDALSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATM  353

Query  345  RAG  347
            +AG
Sbjct  354  KAG  356

>PYAP_17762
Length=348

 Score = 325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/357 (53%), Positives = 249/357 (70%), Gaps = 25/357 (7%)

Query  1    MNILRVPEVGAAT----------SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            MNILR+P +GA +               +PTSCEGYVTKRGHFRKSWRVRFLVL+G++L 
Sbjct  1    MNILRLP-LGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLL  59

Query  51   VTYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYV  110
            V+YY+S+     T G  + PKGSFYLSS+E HEY VGV+GA  KPFGFKMVGHAP+KGYV
Sbjct  60   VSYYDSKEVAR-TAG--AVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYV  116

Query  111  ELDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSP  170
            ELD+FVET+GD NKWLEV +NAL A ++LTR    ++++P  K+LFGFS      PA SP
Sbjct  117  ELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSP  168

Query  171  QKQMQTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFG  230
            Q+QM+ +T  K+ +L  A+ +IE+AK IGR AC EI IQGE+LD I Q+L+ ++ DLD+ 
Sbjct  169  QQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYA  228

Query  231  DKLLRRLKSPTLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQAAESRIDPGA--  288
            DKLLR +K+P LHMFS+D+R ++ ++ +     R   S  S  TR A  ++S    G   
Sbjct  229  DKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAP  288

Query  289  -SDlerlaqalgelelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATL  344
             SD+ERLA  LGELE QA LLN+EA   T Q++ +   L+ V  RV+ QT++A+A++
Sbjct  289  LSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345

>PYVX_18171
Length=294

 Score = 312 bits (799),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 216/338 (64%), Gaps = 58/338 (17%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSS  78
            RPTSCEGYVTKRGHFRKSWRVR+LVLDG++L+V Y+ES+ A     G AS  KG FYLSS
Sbjct  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ--NGAAS--KGEFYLSS  65

Query  79   IEPHEYVVGVMGAAG---KPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSA  135
            I+ H YV G MGA G   KPFGFKMVGHAPKKGY ELD+FVET+ D  KWLEVA NAL +
Sbjct  66   IDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125

Query  136  KRQLTRQAI-DQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDIEA  194
               ++R+A  D   S   K+LFGFS + SPQ      +Q++ ++ +KD+LL DALR++E 
Sbjct  126  AAAMSRKAAGDGGGSATTKSLFGFSTTTSPQ------QQLKAMSVSKDELLKDALRELEG  179

Query  195  AKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSND-SRPKS  253
            AK IGREAC E+V+QGEKLD IE +L  I+ DLD+GDKLLRRLKSP LH+ + D  RP S
Sbjct  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRRPPS  239

Query  254  TSSSKANspqrsqqsggsspTRLAQAAESRIDPGASDlerlaqalgelelqaellNDEAG  313
             + + +N+                +AA  ++                             
Sbjct  240  PTKTLSNAGD-------------GRAALEQL-----------------------------  257

Query  314  HSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351
             STQQI  IE  L+TV  RV++QTKQA++ ++ G  +F
Sbjct  258  -STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYIW_19971
Length=348

 Score = 295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 185/364 (51%), Positives = 237/364 (65%), Gaps = 36/364 (10%)

Query  1    MNILRVPEVGAATS----GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            MNILRVP++  ATS    GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ      
Sbjct  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGG  60

Query  57   RAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFV  116
             +         + PKGSF++SS+E HEY VGVMG   KPFGFK+VGHAPKKGY+ELD+FV
Sbjct  61   ASP--------ATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFV  112

Query  117  ETVGDRNKWLEVARNALSAKRQLTRQ--AIDQSVSPNKKNLFGFSVSLSPQPALSPQKQM  174
            ET+GD NKW+EV +NAL A ++ TR   A D S +   KN+FGFS ++SPQ       Q+
Sbjct  113  ETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTT---KNMFGFSATVSPQL------QV  163

Query  175  QTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLL  234
            + L   K++LL DALR+IE AK IGREA ++I  QG KL+ IE DL  ++ DLD G KLL
Sbjct  164  KKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLL  223

Query  235  RRLKSPTLHMFSNDSRPKSTSSSKANspqrsqqsggsspTRLAQAAESRIDPGA------  288
              +K P LH+FSND+R K  +    +         G+ P+    +AE+    GA      
Sbjct  224  NHMKRPMLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETAT--GAQHHQQQ  281

Query  289  -----SDlerlaqalgelelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASAT  343
                 SDLERL  ALGELE QA  +N EA  ST+QI  +E  L+ V  RV+ QTK+A+AT
Sbjct  282  DTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATAT  341

Query  344  LRAG  347
            ++AG
Sbjct  342  MKAG  345

>PYAR_13570
Length=322

 Score = 266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 226/327 (69%), Gaps = 31/327 (9%)

Query  36   SWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKP  95
            SWRVR+LVL+G++L V+Y++S+     T G  + PKGSFYLSS+E HEYVVGV+GA  KP
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVAR-TPG--ASPKGSFYLSSVEKHEYVVGVLGAQKKP  64

Query  96   FGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNL  155
            FGFKMVGHAP+KGYVELD+FVE+ GD  KWLEV ++AL+A ++LTR  +  + S   K+L
Sbjct  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122

Query  156  FGFSVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQG-----  210
            FGFS      PA SPQKQ+Q L+ +K++LL  A+ +IE+AK +GREAC EIV+QG     
Sbjct  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176

Query  211  ----------EKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSNDSRPKSTSSSKAN  260
                      EKLD IE +L  +D DLD+GDKLL  LKSP L++FS+D+R K+ S+S A+
Sbjct  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKN-SASPAH  235

Query  261  spqrsqqsggsspTR---LAQAAESRIDPGASDlerlaqalgelelqaellNDEAGHSTQ  317
            SP +S+QS  SS  R   L Q  E R     SD+ERLA  LGELE QA LLN+EA   T 
Sbjct  236  SPVKSKQSALSSAARADALGQGVE-RASGEMSDMERLALLLGELEAQATLLNEEAVRGTT  294

Query  318  QIQTIEHHLSTVTGRVEKQTKQASATL  344
            Q++ +   L+ +  RV+ QTK+A + +
Sbjct  295  QVERVGDALAHINERVQNQTKKADSAV  321

>CCA18899
Length=343

 Score = 229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 197/329 (60%), Gaps = 18/329 (5%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QV+YYES+ +   +  + + PKGSF L S 
Sbjct  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDS---SKSKNATPKGSFILQSA  71

Query  80   EPHEYVVGVM---GAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
            E HEY +  M       KPFGFKMVGHAPK+GY+ELDVFV++  D ++WL+V  N L A 
Sbjct  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131

Query  137  RQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDIEAAK  196
            + + R+A    +    K++ GFS         + ++Q+Q L   K D + +AL+ IE AK
Sbjct  132  KCMAREAFMAEMDTT-KSVLGFSY-----IGTTSKQQIQVLKSKKCDYIHEALQQIEMAK  185

Query  197  QIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSNDSRPKSTSS  256
              G  AC+EIV QGE+L  +EQ+LS I  DL+  +KL++ ++ P  + FS  SRP   ++
Sbjct  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSR-SRPHDRAT  244

Query  257  SKANspqrsqqsg-----gsspTRLAQAAESRIDPGASDlerlaqalgelelqaellNDE  311
               +S              +   R        I    +D+E+LA AL +LE+QA+L+N E
Sbjct  245  ISKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSE  304

Query  312  AGHSTQQIQTIEHHLSTVTGRVEKQTKQA  340
            A  S +QI  IE  LS +  R++ QT Q 
Sbjct  305  AVKSNEQIARIEGQLSGINDRIQAQTSQV  333

>CCI45123
Length=301

 Score = 176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 179/304 (59%), Gaps = 19/304 (6%)

Query  49   LQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVM---GAAGKPFGFKMVGHAP  105
            +QV+YYES+ +        + PKGSF L ++E HEY +  M       +PFGFKMVGHAP
Sbjct  1    MQVSYYESKDSY---KNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57

Query  106  KKGYVELDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQ  165
            K+GYVELDVFV+++ + ++WL+V  N L A +++ R+A    +    K + GFS +    
Sbjct  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTT-KGVLGFSFA----  112

Query  166  PALSPQKQMQTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDR  225
               + ++Q++ L   K D + +AL+ IE AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  113  -GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171

Query  226  DLDFGDKLLRRLKSPTLHMFS------NDSRPKSTSSSKANspqrsqqsggsspTRLAQA  279
            DL+  +KL++ ++ P  + FS       D+  K+ ++ +++  Q        +  ++   
Sbjct  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231

Query  280  AESRIDPGASDlerlaqalgelelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQ  339
            AE    P  +DLE+LA AL ELE+QA+L+N EA  S  QI  IE  LS +  R++ QT Q
Sbjct  232  AEEICVP-TNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQ  290

Query  340  ASAT  343
              A+
Sbjct  291  VVAS  294

>SPRG_06336
Length=335

 Score = 169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 138/233 (59%), Gaps = 24/233 (10%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPP--KGSFYL  76
            + TSCEGYVTKRGH  KSWR R++VLDG  L+V+YY+S+     T  ++  P  KGSF L
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK-----TIYKSDKPKEKGSFIL  63

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
            + IE H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NAL   
Sbjct  64   AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--  119

Query  137  RQLTRQA-IDQSVSPNKKNLFGF---SVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDI  192
            + +T QA +DQ  S     L G    S  L+  P      Q++ + K K++LL  A+  +
Sbjct  120  KNVTPQASVDQRASA----LLGHRAPSGFLTSAPV-----QLRNVNKTKEELLRKAIVTL  170

Query  193  EAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMF  245
            E A+ +G    +E+    E LD  E ++  ++ +LD GD +++++ SP  + F
Sbjct  171  EHARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYF  223

>SDRG_01781
Length=335

 Score = 162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 22/232 (9%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPP--KGSFYL  76
            + TSCEGYVTKRGH  KSWR R++VLDG  L+V+Y++S+     T  ++  P  KGSF L
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK-----TIYKSDKPKEKGSFIL  63

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
            + IE H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NAL  K
Sbjct  64   AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-GK  120

Query  137  RQLTRQAIDQSVSPNKKNLFGFSVS---LSPQPALSPQKQMQTLTKNKDDLLSDALRDIE  193
                + + DQ  +     L G   +   L+  P      Q++ + K K++LL  A+  +E
Sbjct  121  NVAPQASADQRATA----LLGHRAASGFLTSAPV-----QLRNVNKTKEELLRKAIVTLE  171

Query  194  AAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMF  245
             A+ +G    +E+    E LD  E ++  +  +LD GD +++++ SP  + F
Sbjct  172  HARTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYF  223

>H310_09223
Length=333

 Score = 159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 109/338 (32%), Positives = 176/338 (52%), Gaps = 22/338 (7%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL  76
            K   TSCEGYVTKRGH  K+W+ R++VL G  L V YY+S+   + + G   PPKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE-IYKSNG---PPKGSFVL  62

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
            S  E  +  +   G + KPFGFK +GH P +GY E  VFVET  D+ KWL VA NAL   
Sbjct  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120

Query  137  RQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDIEAAK  196
              +   +++       K   G  +SL        + Q++ + K   +LL  A+ D + A 
Sbjct  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172

Query  197  QIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSND-SRPKSTS  255
            +IG    +E+  Q E L+  E  + A+ + +D  + L + +K P L+ F++  SR KS  
Sbjct  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKR  232

Query  256  SSKANspqrsqqsggsspTRLAQAAESRIDP-------GASDlerlaqalgelelqaell  308
              +  S ++      +  +R+ +  + ++ P           L+ L++ L +L   A+ +
Sbjct  233  GKRGASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTI  292

Query  309  NDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRA  346
            +D    +T+Q+  I+  +++V  RV K+ K   + L+A
Sbjct  293  SDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330

>H257_06294
Length=358

 Score = 155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 182/355 (51%), Gaps = 31/355 (9%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL  76
            K   TSCEGYVTKRGH  KSW+ R++VL+G  L V+YY+S+   + + G    PKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK-EIYTSKGH---PKGSFVL  62

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL---  133
            S  E  +  +   GA+ KPFGFK +GH P +GY E  V+VE+  D+ KWL VA NAL   
Sbjct  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120

Query  134  SAKRQLTRQAIDQSVSP-----------NKKNLFGFSVSLSPQPA---LSPQKQMQTLTK  179
            S+ ++   Q I++   P            ++++   +     + A    S + QM+ + K
Sbjct  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180

Query  180  NKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239
               +LL  A+ D + A +IG    NE+V Q + L+  E  +  + R +D  + L R LK 
Sbjct  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240

Query  240  PTL----HMFSNDSRPKSTSSSKANspqrsqqsggsspTRLA----QAAESRIDPGASDl  291
            P L    H+F+     K            ++ S  S  +R+     Q   +   P    L
Sbjct  241  PILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQL  300

Query  292  erlaqalgelelqaellNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRA  346
            ++L++ L +L   A+ ++D    +T+Q+  I+  +++V  RV+K+ K   A L+A
Sbjct  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355

>CCI45127
Length=202

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 111/197 (56%), Gaps = 12/197 (6%)

Query  153  KNLFGFSVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQGEK  212
            K + GFS +       + ++Q++ L   K D + +AL+ IE AK  G  AC+EIV QGE+
Sbjct  5    KGVLGFSFA-----GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQ  59

Query  213  LDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFS------NDSRPKSTSSSKANspqrsq  266
            L  +EQ+LS I+ DL+  +KL++ ++ P  + FS       D+  K+ ++ +++  Q   
Sbjct  60   LGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI  119

Query  267  qsggsspTRLAQAAESRIDPGASDlerlaqalgelelqaellNDEAGHSTQQIQTIEHHL  326
                 +  ++   AE    P  +DLE+LA AL ELE+QA+L+N EA  S  QI  IE  L
Sbjct  120  LHMRKNDGKIEHVAEEICVP-TNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQL  178

Query  327  STVTGRVEKQTKQASAT  343
            S +  R++ QT Q  A+
Sbjct  179  SGINDRIQSQTTQVVAS  195

>HYAP_08645
Length=1514

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 19/116 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL ++YY      + T G          L+ +
Sbjct  305  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGRP--------LAEV  354

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSA  135
                 V  V    G+PFGF  + +     Y    V+ +   +RNKW+  A N L+A
Sbjct  355  ----LVEDVQSWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWMN-ALNKLNA  401

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 29/120 (24%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVTYYESRAACHPTTGEASPPKGSFY  75
             SCEGY+TKRGH   S R+ + VL+G++L     Q  Y E+++A                
Sbjct  206  VSCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSAM-----------AEVE  254

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSA  135
            + S+ P E         G+  G   +       YV  D    TVG++ KWL   + + ++
Sbjct  255  IRSVAPWE---------GETNGLMFMTVTGNVFYVIAD----TVGEQQKWLATVKKSTAS  301

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54
            CEGY+TKRGH   +W+ R+  L G+ L+  YY
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YY  142

>PHYRA_84916
Length=1541

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      + T G+         L+ +
Sbjct  402  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKP--------LAEV  451

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS  134
                 V  V    G+PFGF  + +     Y    V+ +   +RNKW+    NAL+
Sbjct  452  ----LVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWM----NALN  494

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 51/111 (46%), Gaps = 23/111 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  259

Query  83   EYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
                     +G+  GF    +  K+  +   V+  + G+R++WL   +  +
Sbjct  260  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEGERSRWLRALKEFM  297

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            SCEGY+TKRGH   S R+ + VL+G++L+
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  332

>PHYKE_1990
Length=1499

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ +L GS   ++YY      + + G+A        L+ +
Sbjct  403  PVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKA--------LAEV  452

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS  134
                 V  V    G+PFGF  +       Y    V+ +   +RNKW+    NAL+
Sbjct  453  ----LVEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM----NALN  495

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  242

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            SCEGY+TKRGH   S R+ + VL+G++L+
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLR  333

>PYIR_21589
Length=1568

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 61/132 (46%), Gaps = 20/132 (15%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL + YY      +   G A        L+ +
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYYPDYDLANSAKGRA--------LAEV  452

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQL  139
                 V  V    G+PFGF  +       Y    V+ +   +RNKW+   R   +   + 
Sbjct  453  T----VEDVQKWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLTTVAEEP  504

Query  140  TRQAIDQSVSPN  151
            T  ++++   PN
Sbjct  505  T--SLEKKRCPN  514

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 29/127 (23%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            CEG++TKRGH   +W+ R+ VL G+ L+    E +   +          GS  ++ + P 
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFAGEDKGKRY----------GSVTVAKVAPW  260

Query  83   EYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLE------VARNALSAK  136
                     +G+  GF    +  K+  +   V+  +  +R+KWL       V    +S +
Sbjct  261  ---------SGEAHGFMF--YTTKQ--IPYYVYAASEAERSKWLRALKEFVVEPEEVSCE  307

Query  137  RQLTRQA  143
              LTR+ 
Sbjct  308  GYLTRRG  314

 Score = 39.3 bits (90),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
             SCEGY+T+RGH   S R+ + VL+G++L+
Sbjct  304  VSCEGYLTRRGHLVPSQRMAYYVLNGTSLR  333

>PYU1_G006347
Length=1095

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 56/115 (49%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL ++YY      +   G+         L+ +
Sbjct  392  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGKP--------LAEV  441

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS  134
                 V  V    G+PFGF  +        V   V+ +   +RNKW+    NALS
Sbjct  442  A----VEDVQKWDGEPFGFMFM----TSEQVPYYVYADNDRERNKWM----NALS  484

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (45%), Gaps = 29/114 (25%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVTYYESRAACHPTTGEASPPKGSFYL  76
            SCEGY+T+RGH   S R+ + VL+G++L     Q  Y ++++A                +
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASLRHYADQSAYRDNQSA----------------I  337

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
            + +E    V  V    G+P G           Y   D    TVG++ KWL+  +
Sbjct  338  AEVE----VRSVAPWDGEPNGLMFQTSTGNVFYASTD----TVGEQQKWLQTVK  383

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 50/105 (48%), Gaps = 25/105 (24%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPK-GSFYLSSIEP  81
            CEG++TKRGH   +W+ R+ VL G  L+  Y+         +GE    K GS  ++ + P
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE--YF---------SGEEKNKKYGSVTVAKVAP  248

Query  82   HEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWL  126
                      +G+  GF    +  K+  +   V+  +  +R+KWL
Sbjct  249  W---------SGEAHGFMF--YTTKQ--IPYYVYAASEAERSKWL  280

>PYAR_23286
Length=607

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 22/117 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ VL GS+  V+YY            A+ PKG       
Sbjct  386  PIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDT-------ANSPKG-------  429

Query  80   EPHEYVV--GVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS  134
            +P   VV   V    G+PFGF  +       Y    V+ +   +R KW+   R   S
Sbjct  430  KPLAEVVIEDVQRWDGEPFGFMFMTSEQIPYY----VYADNERERTKWMNALRKLTS  482

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            CEG++TKRGH   +W++R+ VL G+ L+
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE  221

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            +CEGY+T+RGH   S R  + VL+G++L+
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  316

>PHYSO_361747
Length=1523

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 19/116 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      + + G+         L+ +
Sbjct  411  PVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKP--------LAEV  460

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSA  135
                 V  V    G+PFGF  +       Y    V+ +   +RNKW+  A N L+A
Sbjct  461  ----LVEDVQKWDGEPFGFMFMTTEQVPYY----VYADNDRERNKWMN-ALNKLNA  507

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  250

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            SCEGY+TKRGH   S R+ + VL+G++L+
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  341

>PYVX_20438
Length=1346

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 65/134 (49%), Gaps = 27/134 (20%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ +L G++  ++Y+      +   G+A        L+ +
Sbjct  316  PVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGKA--------LAEV  365

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQL  139
                 V  V    G+PFGF  +       Y    V+ +   +RNKW+    NAL   R+L
Sbjct  366  T----VEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM----NAL---RKL  410

Query  140  TRQAIDQSVSPNKK  153
               A+D+     KK
Sbjct  411  --NAVDEEPEAEKK  422

 Score = 41.2 bits (95),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L+  Y+ S
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS  154

 Score = 39.3 bits (90),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 5/44 (11%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVTYYESRAA  59
             SCEGY+TKRGH   S R+ + VL G+ L     Q  Y E+++A
Sbjct  217  VSCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA  260

>PYAP_16997
Length=1018

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 53/111 (48%), Gaps = 18/111 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ VL G++  +TY+      +   G+A        L+ +
Sbjct  399  PIACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSNKGKA--------LAEV  448

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
                 V  V    G+PFGF  +        V   V+ +   +R KW+   R
Sbjct  449  ----IVEDVQRWDGEPFGFMFM----TSEQVPYYVYADNERERGKWMNALR  491

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 23/119 (19%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEP  81
            +CEG++TKRGH   +W++R+ VL G+ L+  Y+        +  + S   GS  +  + P
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YF--------SGDDKSKRYGSVIVEKVAP  255

Query  82   HEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQLT  140
                      +G+  GF    +  K+  V   V+  +  +R KWL   R+ +    ++T
Sbjct  256  W---------SGEAHGFMF--YTTKQ--VPYYVYASSEAERAKWLRALRDFMVEPEEVT  301

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            +CEG++T+RGH   S R  + VL+G++L+
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR  329

>PYIW_17381
Length=952

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 62/129 (48%), Gaps = 25/129 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL + Y+      +   G+         L+ +
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGKP--------LAEV  452

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQL  139
                 V  V    G+PFGF  +        V   V+ +   +RNKW+    NAL   R+L
Sbjct  453  T----VEDVQKWDGEPFGFMFM----TSEQVPYYVYADNDRERNKWM----NAL---RKL  497

Query  140  TRQAIDQSV  148
            T  A + +V
Sbjct  498  TTVAEEPTV  506

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 50/104 (48%), Gaps = 23/104 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            CEG++TKRGH   +W+ R+ VL G+ L+  Y+         +GE    KG  Y S     
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YF---------SGED---KGKRYGSVT---  253

Query  83   EYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWL  126
              V  V   +G+  GF    +  K+  V   V+  +  +R+KWL
Sbjct  254  --VAKVAPWSGEAHGFMF--YTTKQ--VPYYVYASSEAERSKWL  291

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 29/113 (26%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVTYYESRAACHPTTGEASPPKGSFYLS  77
            CEGY+T+RGH   S R+ + VL+G++L     Q  Y E+++A                + 
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSAI-----------AEVDVK  354

Query  78   SIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
            SI P E         G+P G           Y   D    T+G++ KW++  +
Sbjct  355  SIAPWE---------GEPNGLMFQTSTGNVFYASAD----TLGEQQKWIQTVK  394

>CCI44752
Length=1526

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 56/118 (47%), Gaps = 18/118 (15%)

Query  13   TSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKG  72
            T+ +   P +C GY+TK+GH RKSW+ R+ +L G+   ++YY+     +   G+A     
Sbjct  408  TTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANNAKGKA-----  460

Query  73   SFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
               L+ ++    V  V    G+ FGF  +       Y    V+ +   +R KW+   R
Sbjct  461  ---LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKWMSALR  507

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 53/129 (41%), Gaps = 23/129 (18%)

Query  2    NILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACH  61
            ++ R  E  A      +   + EGY+TKRGH   +W+ RF VL G+ L+  YY S     
Sbjct  201  SLTREKETCAPIPESSSTEITYEGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE----  254

Query  62   PTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGD  121
                E +   GS  ++ + P          +G+  GF          Y    V+  +  +
Sbjct  255  ----EKTKRYGSVVVAKVAPW---------SGEAHGFMFYTTKQIPYY----VYAASEAE  297

Query  122  RNKWLEVAR  130
            + KWL   R
Sbjct  298  KTKWLRALR  306

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            +CEGY+T+RGH   S RV + VL G+ L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  344

>PPTG_19371
Length=1195

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 72/166 (43%), Gaps = 26/166 (16%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            M+ L V    A+T          EGYV K+G +   W  R+L+LDG+ L  TYY S+   
Sbjct  48   MDDLLVDSSTASTPAAMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEA  105

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
                  A   +G   +S + P  Y        GK  GF +      +G+    +   T  
Sbjct  106  R----SARNLRGRMIISKVRPENY--------GKAHGFLI----ETQGHKHFHLCCTTEL  149

Query  121  DRNKWLEVARNALS-----AKRQLT---RQAIDQSVSPNKKNLFGF  158
            +++ W+E+ + A+      A  +L+    +A+    SP + +L GF
Sbjct  150  EKDMWVEMMQAAIEEGVRHAHSRLSMEGMEALQMQTSPTQVDLRGF  195

>PHYRA_82543
Length=1199

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 70/160 (44%), Gaps = 26/160 (16%)

Query  11   AATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPP  70
            A+T    A     EGYV K+G +   W  R+L+LDG+ L  TYY S+         A   
Sbjct  48   ASTPAAIAHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEAR----SARNL  101

Query  71   KGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
            +G   +S + P  Y        GK  GF +      +G+    +   T  +++ W+E+ +
Sbjct  102  RGRMIISKVRPENY--------GKAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQ  149

Query  131  NALSAKRQLTR--------QAIDQSVSPNKKNLFGFSVSL  162
             A+    + T+        +A+    SP + +L GF ++ 
Sbjct  150  AAIEEGVRHTQSSMSMEGMEALQMQSSPTQVDLRGFYLAF  189

>SPRG_06058
Length=1258

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 63/137 (46%), Gaps = 22/137 (16%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL  76
            K  P +C G++TK+GH RKSW+ R+ VL G+ L  +YY    A +   G+A        L
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANTRAGKA--------L  192

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
            S +   +  VG        F F  + + P        VF +   D+ KW+   + A+ A 
Sbjct  193  SDVSLKD--VGPWDGEACGFMFTTLENVPYY------VFADNERDQAKWMSALKKAVGAD  244

Query  137  RQLTRQAIDQSVSPNKK  153
              L  + ID+   P KK
Sbjct  245  -TLAIETIDE---PEKK  257

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 2/42 (5%)

Query  18  ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59
           ARP  CEGY+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  42  ARPVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  81

>PPTG_18898
Length=1559

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 51/107 (48%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+         L+ +
Sbjct  405  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKP--------LAEV  454

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWL  126
                 V  V    G+PFGF  + +     Y    V+ +   +R KW+
Sbjct  455  ----LVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERTKWM  493

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (46%), Gaps = 23/111 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  262

Query  83   EYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
                     +G+  GF    +  K+  +   V+  +  +R++WL   ++ +
Sbjct  263  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEAERSRWLRALKDFM  300

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            SCEGY+TKRGH   S R+ + VL+G++L+
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  335

>H310_00231
Length=1495

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 56/122 (46%), Gaps = 18/122 (15%)

Query  9    VGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEAS  68
            +G  T     +P +C G++TK+GH RKSW+ R+ VL G+ L   YY        T  +AS
Sbjct  338  LGKVTVDKPVQPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYY--------TDFDAS  387

Query  69   PPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEV  128
              + S  L  +   E    V    G+P GF  V +     Y    VF +   D+ KWL  
Sbjct  388  NMRHSRPLGEVTVRE----VSTWDGEPGGFMFVTNDNVPYY----VFADNERDQAKWLTA  439

Query  129  AR  130
             R
Sbjct  440  LR  441

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (67%), Gaps = 4/42 (10%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQV----TYYESRAAC  60
            CEGY+TKRGH   S+R+R+ VL G++++     T Y S A+ 
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMKYFADETAYRSGASA  292

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 43/103 (42%), Gaps = 22/103 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEY  84
            GY+TKRGH   +W+ RF VL     +++YY                 G  +L  + P   
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYYADEGMKKKL--------GEVHLEKVSPW--  205

Query  85   VVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLE  127
                   +G+  GF M   + +  Y    V+  T  +R +WLE
Sbjct  206  -------SGEANGF-MFYTSKQIAYY---VYASTNSERRRWLE  237

>PITG_20562
Length=1559

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 51/107 (48%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+         L+ +
Sbjct  406  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKP--------LAEV  455

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWL  126
                 V  V    G+PFGF  + +     Y    V+ +   +R KW+
Sbjct  456  ----LVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERTKWM  494

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 54/118 (46%), Gaps = 23/118 (19%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  263

Query  83   EYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQLT  140
                     +G+  GF    +  K+  +   V+  +  +R++WL   ++ +    +++
Sbjct  264  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEAERSRWLRALKDFMVETEEVS  308

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            SCEGY+TKRGH   S R+ + VL+G++L+
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  336

>CCA18875
Length=1514

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 18/111 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ +L G+   ++YY+     +   G+A        L+ +
Sbjct  415  PVTCAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANHVKGKA--------LAEV  464

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
            +    V  V    G+ FGF  +       Y    V+ +   +R KW+   R
Sbjct  465  Q----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKWMSALR  507

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 53/129 (41%), Gaps = 23/129 (18%)

Query  2    NILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACH  61
            ++ R  E  A      +   + EGY+TKRGH   +W+ RF VL G+ L+  YY S     
Sbjct  201  SLTREKETCAPIPESSSTEITYEGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE----  254

Query  62   PTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGD  121
                E +   GS  ++ + P          +G+  GF          Y    V+  +  +
Sbjct  255  ----EKTKRYGSVVVAKVAPW---------SGEAHGFMFYTTKQIPYY----VYAASETE  297

Query  122  RNKWLEVAR  130
            + KWL   R
Sbjct  298  KAKWLRALR  306

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            +CEGY+T+RGH   S RV + VL G+ L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  344

>SDRG_12763
Length=1317

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 52/111 (47%), Gaps = 27/111 (24%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSS  78
            +P SC GY+TK+GH RKSW+ R+ VL G+ L  +YY                  S Y S 
Sbjct  220  KPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYY------------------SDYDSM  259

Query  79   IEPHEYVVGVMGAA---GKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWL  126
             +     VGV   A   G+ FGF+ +       Y    VF E+  +R KW+
Sbjct  260  NKQSLAEVGVEDVALWDGEQFGFQFITTEQVPYY----VFAESDRERQKWM  306

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 51/136 (38%), Gaps = 29/136 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            C GY+TKRGH   +W+ RF VL    + + YY   +             G  +L  + P 
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYYADDSMVKKL--------GQVHLVKVAPW  60

Query  83   EYVVGVMG------AAGK---PFGFKMVGHAPKKGYVELDVFVETVGDRNKWL-------  126
            EY     G      A G     FGF          YV  +V  E    R +WL       
Sbjct  61   EYFSATTGNSVLKSARGSDEMKFGFMFFTTKRVAYYVYANVNAE----RQRWLLALQDLY  116

Query  127  EVARNALSAKRQLTRQ  142
             V  NA   +  LT++
Sbjct  117  VVTSNATDCEGYLTKR  132

>H257_06722
Length=1482

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 18/112 (16%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSS  78
            +P +C G++TK+GH RKSW+ R+ VL G+ L   YY    A +   G+   P G   +  
Sbjct  348  QPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGK---PLGEVTVRE  402

Query  79   IEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
            +   +         G+P GF  + +     Y    VF +   D+ KWL   R
Sbjct  403  VSAWD---------GEPSGFMFITNDSVPYY----VFADNDRDQAKWLAALR  441

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59
            CEGY+TKRGH   S+R+R+ VL GS ++  YY    A
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGSTIK--YYADETA  285

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54
            GY+TKRGH   +W+ RF VL     +++YY
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYY  185

>PYU1_G008848
Length=765

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 58/129 (45%), Gaps = 20/129 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L  TYY ++         A   +G   +S + P  
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEAR----SARNLRGRMIISKVRPEN  187

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS--AKRQLTR  141
            Y        GK  GF +      KG+    +   T  +++ W+E+ + A+    K  +  
Sbjct  188  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSVNG  235

Query  142  QAIDQSVSP  150
             ++D  V P
Sbjct  236  NSMDSDVVP  244

>PHYSO_544598
Length=1163

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 27/144 (19%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L  TYY S+         A   +G   +S + P  
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEAR----SARNLRGRMIISKVRPEN  72

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS------AKR  137
            Y        GK  GF +      +G+    +   T  +++ W+E+ + A+       A  
Sbjct  73   Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGAHS  120

Query  138  QLT---RQAIDQSVSPNKKNLFGF  158
            +++    +A+    SP + +L GF
Sbjct  121  RVSMEGMEALQMQASPTQVDLRGF  144

>SPRG_06059
Length=1312

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 49/111 (44%), Gaps = 27/111 (24%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSS  78
            +P SC GY+TK+GH RKSW+ R+ VL G  L   YY                    Y S 
Sbjct  222  KPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYYAD------------------YDSM  261

Query  79   IEPHEYVVGVMGAA---GKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWL  126
             +     VGV   A   G+ FGF+ +       Y    VF E+  +R KW+
Sbjct  262  NKQSLAEVGVEDVALWDGEQFGFQFITTEQVPYY----VFAESDRERQKWM  308

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 50/136 (37%), Gaps = 29/136 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            C GY+TKRGH   +W+ RF VL    +   Y +   A            G  +L  + P 
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADESMA---------KKLGQVHLVKVAPW  62

Query  83   EYVVGVM---------GAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWL-------  126
            EYV             G+    FGF          YV  +V  E    R KWL       
Sbjct  63   EYVSATTANSILKSTRGSDEMKFGFMFFTTKRVAYYVYANVNAE----RQKWLLALQDLY  118

Query  127  EVARNALSAKRQLTRQ  142
             V  NA   +  LT++
Sbjct  119  VVTSNATDCEGYLTKR  134

>PITG_19213
Length=1201

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/143 (27%), Positives = 65/143 (45%), Gaps = 26/143 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L  TYY S+         A   +G   ++ + P  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEAR----SARNLRGRMIINKVRPEN  124

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS-----AKRQ  138
            Y        GK  GF +      +G+    +   T  +++ W+E+ + A+      A  +
Sbjct  125  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  172

Query  139  LT---RQAIDQSVSPNKKNLFGF  158
            L+    +A+    SP + +L GF
Sbjct  173  LSMEGMEALQLQTSPTQVDLRGF  195

>PYIR_18382
Length=1154

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 57/129 (44%), Gaps = 20/129 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L  TYY ++         A   +G   +S + P  
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEAR----SARNLRGRMIISKVRPEN  182

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS--AKRQLTR  141
            Y        GK  GF +      KG+    +   T  +++ W+E+ + A+    K  L  
Sbjct  183  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSLNG  230

Query  142  QAIDQSVSP  150
             ++D    P
Sbjct  231  SSVDPETLP  239

>PYU1_G001063
Length=783

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  +YYES+ 
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKV  179

>PYAP_17290
Length=835

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
             EGYVTKRGH  ++W++RF  L+G+NL  +YYE++ 
Sbjct  152  WEGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKV  185

>PHALS_04098
Length=1183

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 24/154 (16%)

Query  11   AATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPP  70
            A+T+         EGYV K+G +   W  R+L+LDG+ L  TYY S+         A   
Sbjct  62   ASTTAFMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEAR----SARNM  115

Query  71   KGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
            +G   +  + P  Y        GK  GF +   + K    +  +   T  +++ W+E+  
Sbjct  116  RGRMTVYKVRPENY--------GKAHGFLLETQSHK----QFHLCCATELEKDMWVEMMH  163

Query  131  NALS--AKRQLTRQAID----QSVSPNKKNLFGF  158
             A+   A+++ +R +++      +SP + +L GF
Sbjct  164  AAVEEGARQRNSRLSVEGMEILQISPTQVDLRGF  197

>PYIW_13172
Length=939

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  +YYES+ 
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  182

>PYIR_15309
Length=937

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  +YYES+ 
Sbjct  148  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  180

>PYIW_16987
Length=821

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (46%), Gaps = 18/123 (15%)

Query  11   AATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPP  70
            AA++   A     EGYV K+G +   W  R+LVLDG+ L  TYY ++         A   
Sbjct  107  AASTPGVAHEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEAR----SARNL  160

Query  71   KGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
            +G   +S + P  Y        GK  GF +      KG+    +   T  +++ W+E+ +
Sbjct  161  RGRMIISKVRPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQ  208

Query  131  NAL  133
             A+
Sbjct  209  AAI  211

>PYIW_21108
Length=2593

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 61/130 (47%), Gaps = 8/130 (6%)

Query  6     VPEVGAATSGDKARPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLQVTYYESRAACHPTT  64
             + +   ++ G  A+    EGYV  R HF  + WR RF VL+G+ L + Y +S AA     
Sbjct  2139  ISQSAKSSGGASAKRDQFEGYVRVRHHFLGAIWRERFAVLEGTRL-LLYTDSSAAMDEDR  2197

Query  65    GEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNK  124
                +  K    L ++E           +G  FGF++   A   GY+E  V  E   ++ K
Sbjct  2198  ERTALEKHD--LIAVEKWHPTYSANLGSGSRFGFRVENEA--GGYLECTVTTE--DEQTK  2251

Query  125   WLEVARNALS  134
             WL V  +A+S
Sbjct  2252  WLAVVSDAVS  2261

 Score = 32.0 bits (71),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 29/65 (45%), Gaps = 4/65 (6%)

Query  10    GAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASP  69
             G +  G   R    EGY+ KRGH   S R R+ VL   N  + Y+   A    +   A  
Sbjct  1220  GDSQPGGGLREALMEGYLVKRGHLIPSMRKRYCVL-LKNASLEYF---ATHEDSRNPAIR  1275

Query  70    PKGSF  74
             P GSF
Sbjct  1276  PHGSF  1280

>PHYKE_2479
Length=171

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 2/51 (4%)

Query  7    PEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            P+     S   +  +  EGYVTKRGH  ++W++RF  L+G NL V+YYE++
Sbjct  59   PDTRPPHSNSTSSRSKWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  107

>PYIR_17453
Length=2619

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 55/113 (49%), Gaps = 7/113 (6%)

Query  23    CEGYVTKRGHFR-KSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEP  81
             CEGYV  R HF   +WR RF VL+ + L + Y ++ AA      + +  K    ++  + 
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL-YPDTSAALSEGREQKALEKHDL-IAVKKW  2217

Query  82    HEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS  134
             H      +G     FGF++   A   GY+E  V +E   ++ KWL    NA+S
Sbjct  2218  HPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIE--DEQTKWLAAITNAVS  2266

 Score = 31.6 bits (70),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query  10    GAATSGDKA---RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ--VTYYESRAACHPTT  64
             G   SG +A   R    EGY+ KRGH   S R R+ VL  + L+   T+ +SR       
Sbjct  1205  GDDDSGSEAGSNRQILMEGYLVKRGHLIPSMRKRYCVLVKNTLEYFATHEDSR-------  1257

Query  65    GEASPPKGSF  74
               A  P GSF
Sbjct  1258  NPAIRPHGSF  1267

>H257_06721
Length=1238

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54
            G   +P +C GY+TK+GH RKSW+ R+ VL GS L  +YY
Sbjct  224  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  261

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (52%), Gaps = 9/62 (15%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
           C GY+TKRGH   +W++R+ VL   +  ++YYE  +             G  +L+ + P 
Sbjct  14  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYEDESMAKKL--------GQVHLAKVAPW  64

Query  83  EY  84
           EY
Sbjct  65  EY  66

>SDRG_12762
Length=1392

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 54/117 (46%), Gaps = 18/117 (15%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL  76
            K  P +C G++TK+GH RKSW+ R+ VL G+ L  +Y+    A +   G+A        L
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAANTRLGKA--------L  403

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            S +     V  V    G+  GF  V       Y    VF +   D+ KW+   + A+
Sbjct  404  SEVS----VKDVAPWDGEVCGFMFVTLENVPYY----VFADNERDQAKWMTALKKAV  452

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59
            P  CEGY+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  255  PVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  292

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54
            GY+TKRGH   +W+ RF  L  S  +++YY
Sbjct  164  GYLTKRGHVITNWKTRFFALR-SQGRLSYY  192

>PYVX_13574
Length=950

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYVTKRGH  ++W++RF  L+G NL V+YYES+ 
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYESKV  191

>CCA18023
Length=1138

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L  TYY ++         A   +G   +  + P  
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEAR----SARNLRGKMMIVKVRPEN  178

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            Y        GK  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  179  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  216

>PYAR_19914
Length=788

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  +YYE++ 
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKV  178

>CCI41225
Length=981

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYVTKRGH  ++W++RF  L+G+ L  +YYES+ 
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESKV  172

>CCI46235
Length=1155

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L  TYY ++         A   +G   +  + P  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEAR----SARNLRGKMMIVKVRPEN  173

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            Y        GK  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  174  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  211

>H310_00230
Length=1248

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ-VTYYES  56
            G   +P +C GY+TK+GH RKSW+ R+ VL G+ L   T YES
Sbjct  218  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALLSYYTDYES  260

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 9/62 (15%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
           C GY+TKRGH   +W++RF VL   +  ++YYE  +         S   G  +L+ + P 
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYEDES--------MSKKLGQVHLAKVAPW  62

Query  83  EY  84
           EY
Sbjct  63  EY  64

>PHALS_06533
Length=930

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYVTKRGH  ++W++RF  L+G NL V+YYE++ 
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  143

>PYAR_15463
Length=1091

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L  TYY S+      +G     +G   +S + P  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEAR--SGRNL--RGRMIISKVRPEN  131

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            Y        GK  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  132  Y--------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAI  169

>PITG_18067
Length=924

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 8/54 (15%)

Query  11   AATSGDKARPT------SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            + +SGD A  +        EGYVTKRGH  ++W++RF  L+G NL V+YYE++ 
Sbjct  90   SMSSGDNAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PPTG_13401
Length=927

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 8/54 (15%)

Query  11   AATSGDKARPT------SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            + +SGD A  +        EGYVTKRGH  ++W++RF  L+G NL V+YYE++ 
Sbjct  90   SMSSGDNAVESLDLPMVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PHYRA_77834
Length=936

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYVTKRGH  ++W++RF  L+G NL V+YYE++ 
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  151

>PYAP_18636
Length=1009

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (46%), Gaps = 20/123 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L  TYY ++      +G     +G   +S + P  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEAR--SGRNL--RGRMIISKVRPEN  156

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL--SAKRQLTR  141
            Y        GK  GF +       G+    +   T  +++ W+E+ + A+    K +L R
Sbjct  157  Y--------GKAHGFLLE----TMGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHKLER  204

Query  142  QAI  144
              I
Sbjct  205  SLI  207

>PHYCA_503112
Length=214

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            EGYVTKRGH  ++W+ RF  L+G NL V+YYE++
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEG-NL-VSYYENK  148

>CCI42457
Length=906

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYV KRGH  ++W++RF  L+G+  +V+YYES+ 
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESKG  162

>PYVX_13312
Length=1016

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L  TYY S+      +G     +G   LS + P  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEAR--SGRNL--RGRMQLSRVRPEN  129

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            Y        GK  GF +      +G+    +   T  +++ W+E+ + A+
Sbjct  130  Y--------GKAHGFLI----ETRGHKSFHLCCTTELEKDMWVEMMQAAI  167

>CCA16487
Length=975

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYVTKRGH  ++W++RF  L+G+ L  +YYE++ 
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKV  170

>PHYKE_6662
Length=765

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/170 (23%), Positives = 69/170 (41%), Gaps = 26/170 (15%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            M  L +    A+T          EG+V K+G +   W  R+L+LDG+ L  TYY S+   
Sbjct  49   MEDLLMDSSAASTPATITHEVHWEGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEA  106

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
                  A   +G   +  + P  Y        GK  GF +      +G+    +   T  
Sbjct  107  R----SARNLRGRMIIVKVRPENY--------GKAHGFLI----ETQGHKHFHLCCSTEL  150

Query  121  DRNKWLEVARNALS-----AKRQLTRQAIDQ---SVSPNKKNLFGFSVSL  162
            +++ W+E+ + A+          ++ + +D      SP + +L GF  + 
Sbjct  151  EKDMWVEMMQAAIEEGVRHGPNSMSLEGMDALALQASPTQVDLRGFYFAF  200

>H257_03093
Length=975

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG++L  TYY S+      T      +G   ++ + P  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEARTGTNL----RGRMIITKVLPEN  157

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            Y        GK  GF +       G+    +   T  +++ W+E+ + A+
Sbjct  158  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  195

>CCA17102
Length=884

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRA  58
            EGYV KRGH  ++W++RF  L+G+ L  +YYES+ 
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESKG  142

>SDRG_01407
Length=815

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 53/119 (45%), Gaps = 18/119 (15%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSF  74
            G  A     EGYV K+G +   W  R+LVLDG++L  TYY ++             +G  
Sbjct  76   GPPAHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR----SGRNLRGRM  129

Query  75   YLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
             ++ + P  Y        GK  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  130  IITRVLPENY--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  176

>H310_04843
Length=968

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG++L  TYY S+      TG+    +G   ++ + P  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEAR--TGKNL--RGRMIITRVLPEN  156

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            Y        GK  GF +       G+    +   T  +++ W+E+ + A+
Sbjct  157  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  194

>HYAP_04457
Length=1203

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 57/133 (43%), Gaps = 18/133 (14%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            M+ + +    A+TS         EGYV K+G +   W  R+L+LDG  L  TYY S+   
Sbjct  39   MDDMLMDSSSASTSAVMTHEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKEDA  96

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
                  A   +G   L  + P  Y        GK  GF +   + K  ++     +E   
Sbjct  97   R----SARNLRGRMLLLKVRPENY--------GKAHGFFLETQSHKHFHLCCSSELE---  141

Query  121  DRNKWLEVARNAL  133
             ++ W+E+ + A+
Sbjct  142  -KDMWVEMMQAAI  153

>SPRG_00890
Length=883

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG++L  TYY ++             +G   ++ + P  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR----SGRNLRGRMIITRVLPEN  84

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            Y        GK  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  85   Y--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  122

>PITG_02109
Length=522

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
            G+V K+G   K+W+ RF+VL G   Q+TYY++ +  +PT      PKGSF + ++E
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLNPTVK----PKGSFQVITVE  186

>PITG_11303
Length=293

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  245

>PHYCA_504801
Length=398

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           G+V K+G   K+W+ RF+VL G   Q+TYY++ A  +PTT      KGSF + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVNPTT----KAKGSFQVITVE  60

>CCI10489
Length=777

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ KRGH  +SWR RF VL G+ L  +YY S+
Sbjct  104  TDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSK  138

>PHYSO_343629
Length=977

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTY  53
            EGYVTKRGH  ++W++RF  L+G+ +  T+
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>PPTG_14630
Length=398

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           G+V K+G   K+W+ RF+VL G   Q+TYY++ +   PT      PKGSF + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLVPTV----KPKGSFQVITVE  60

>PHYSO_556164
Length=765

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 57/136 (42%), Gaps = 16/136 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+  YY        T    S  KG   
Sbjct  214  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR--YY--------TDSSCSKLKGEVL  263

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKM-VGHAPKKGYVELDVFVETVGDRNKWLEVARNALS  134
            L   +   + V V  A G+   F + VG      Y  L +    + DR  W+    +AL 
Sbjct  264  LFHPQTRVHYVDVHVAGGRDASFAIQVG----PDYTLL-LQAAQLRDRENWMYCIEDALL  318

Query  135  AKRQLTRQAIDQSVSP  150
             +     Q + +   P
Sbjct  319  CRDSYHPQGMTEGPEP  334

>H257_03361
Length=699

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 37/60 (62%), Gaps = 7/60 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
           +G++ K+G    SW+ R+LVL G N  ++Y++ +   +P   E    KGSF L+ ++P++
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPRAKE----KGSFVLAGVQPNK  63

>PYIW_20891
Length=291

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           G+V K+G   ++W+ RFLVL G   Q+TYY++ A+  P T E    KGSF + ++E
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGK--QLTYYDT-ASLTPKTKE----KGSFQVITVE  57

>PITG_17893
Length=747

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 52/119 (44%), Gaps = 16/119 (13%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+  YY        T    +  KG   
Sbjct  212  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR--YY--------TDSSCAKLKGEVL  261

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKM-VGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            L   +   + V V  A G+   F + VG      Y  L +    + DR  W+    +AL
Sbjct  262  LFHPQTRVHYVDVHVAGGRDASFAIQVG----PDYTLL-LQAAQLRDRENWMYCIEDAL  315

>SPRG_09128
Length=620

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54
            G++ K GH RKSW+ RF VLDGS LQ  YY
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YY  295

>PPTG_04553
Length=904

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 3/51 (6%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGE  66
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C    GE
Sbjct  355  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYADSSCTKLKGE  402

>SPRG_17022
Length=107

 Score = 38.1 bits (87),  Expect = 0.011, Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+    TYY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PHALS_06699
Length=884

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 50/129 (39%), Gaps = 14/129 (11%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFY  75
            D A   S  G++ KRGH  K+W+ R+ VL  S L+   Y S A C    GE        +
Sbjct  329  DDAFLDSMSGWLRKRGHVCKNWKDRYFVLHKSVLR---YYSDACCTKLKGEV-----LLF  380

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSA  135
                  H   V V G     F  + VG         L +  E + DR  W+    +AL  
Sbjct  381  HPQTCVHYVDVHVTGGRDASFAIQ-VG-----SEYTLLLQAERLSDRENWMYCIEDALLC  434

Query  136  KRQLTRQAI  144
            +     Q +
Sbjct  435  RDSYQNQQV  443

>H257_09823
Length=654

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 0/26 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            G++ K GH RK+W+ RF VLDGS LQ
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ  290

>PHYRA_73535
Length=875

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 57/136 (42%), Gaps = 16/136 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+  YY        T    +  KG   
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR--YY--------TDPSCAKLKGEVL  382

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKM-VGHAPKKGYVELDVFVETVGDRNKWLEVARNALS  134
            L   +   + V V  A G+   F + VG  P+     L +    + DR  W+    +AL 
Sbjct  383  LFHPQTRVHYVDVHVAGGRDASFAIQVG--PE---YTLLLQAAQLRDRENWMYCIEDALL  437

Query  135  AKRQLTRQAIDQSVSP  150
             +     Q +     P
Sbjct  438  CRDSYHPQGMTSGPGP  453

>PHYSO_478611
Length=522

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
            G+V K+G   K+W+ RF+VL G   Q+TYY++ A   PT       KGSF + ++E
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVDPTVKA----KGSFQVITVE  189

>PYVX_18338
Length=746

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (5%)

Query  14   SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            S + A  T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  72   SIEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  113

>SDRG_05150
Length=787

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+    TYY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>H310_07070
Length=680

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 14/117 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFY  75
            D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S      TT E + P+G   
Sbjct  114  DFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVS-----GTTSEETYPRGVIS  166

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNA  132
            LS ++ H   V       K F F+ + H     Y  L +  +   D  +W+   ++A
Sbjct  167  LSGVDVHPLDVSKF---KKQFCFE-ISHP---NYRSLYMVAKNDADLVQWMSSIKSA  216

>H310_06378
Length=837

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            EG+V K+GH  ++W+VR+  L+G+ L  +YYE++
Sbjct  58  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  90

>SPRG_08346
Length=797

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+    TYY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PHYSO_344112
Length=813

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PYIW_21901
Length=913

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 50/116 (43%), Gaps = 16/116 (14%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEP  81
            S  G++ K GH RK+W+ R+ VLD S L+    ES A            KG   L     
Sbjct  423  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLARL----------KGEVLLFHPAT  472

Query  82   HEYVVGVMGAAGKPFGFKM-VGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
              + V +  + GK   F + VG    K Y  L +  E + DR  W+    +AL  +
Sbjct  473  RVHYVDIHLSGGKDGTFAIHVG----KDYALL-LQAEQLSDRENWMYCIEDALLCR  523

>PHYCA_506137
Length=810

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PPTG_05519
Length=810

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PITG_02762
Length=810

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>SDRG_14487
Length=964

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 28/114 (25%), Positives = 56/114 (49%), Gaps = 24/114 (21%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEP  81
            + EG++ K+G    +W+ R++VL G +  + YY+ +   +P   E    KG+F L+++E 
Sbjct  5    AWEGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVSNPRAKE----KGTFTLAAVE-  56

Query  82   HEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSA  135
                       G   G  + G+    G + + ++ +TVG+      +  NA++A
Sbjct  57   --------RTPGMELGLTLAGY---DGKI-MHIYTKTVGE----FVLCNNAMTA  94

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYE  55
            G++ K G   KSW+ RF VL G++L  TYY+
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>H257_13567
Length=836

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            EG+V K+GH  ++W+VR+  L+G+ L  +YYE++
Sbjct  60  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  92

>PHYRA_79281
Length=809

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  134

>PYIW_18480
Length=755

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
           T  EGYV K+GH  +SWR R+ +L G+    +YY S+
Sbjct  50  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  84

>HYAP_08026
Length=798

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  122

>SDRG_14286
Length=670

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54
            G++ K GH RK+W+ RF VLDGS LQ  YY
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YY  304

>PYVX_23349
Length=924

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 16/113 (14%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEP  81
            S  G++ K GH RK+W+ R+ VL+ S L+    ESR+            KG   L     
Sbjct  444  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRL----------KGEVLLFHPAT  493

Query  82   HEYVVGVMGAAGKPFGFKM-VGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
              + V +  + G+   F + VG      Y  L +  E + DR  W+    +AL
Sbjct  494  RVHYVDIHLSGGRDNTFAIQVG----SDYTLL-LQAERLSDRENWMYCIEDAL  541

>SDRG_08800
Length=881

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            EG+V+K+GH  ++W++R+  L+ SNL ++YYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>PHYRA_73534
Length=1210

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (57%), Gaps = 3/51 (6%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGE  66
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y +  +C    GE
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGE  380

>PYU1_G012870
Length=352

 Score = 39.7 bits (91),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           G+V K+G   ++W+ RF+VL G   Q+TYY++ A+  P T E    KGSF + + E
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGK--QLTYYDT-ASISPKTKE----KGSFQVITAE  55

>PYAP_22646
Length=815

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ +L G+    +YY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISK  134

>SDRG_05567
Length=980

 Score = 40.0 bits (92),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 59/137 (43%), Gaps = 23/137 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEY  84
            GY++KRG +RK+W+ R+ +L   +  + Y +S        G+            I P+  
Sbjct  137  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLE-LVGQV----------PITPNTR  185

Query  85   VV-GVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNA--LSAKRQLTR  141
            V+   +G    PF F++  H P++    L +   TV +  KW+   R    L   R++  
Sbjct  186  VIDNSIGCQKAPFYFEV--HTPRR---VLYLGAGTVQEHRKWIRSIRETVELVRSREIGE  240

Query  142  QAIDQSV----SPNKKN  154
              + QS     SP   N
Sbjct  241  NYVTQSCVVRPSPTDTN  257

>CCA21715
Length=782

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>CCA21860
Length=782

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>CCI39367
Length=2046

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 56/121 (46%), Gaps = 31/121 (26%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            G++ K+GH  KSWRVRF VL  DG+   + YY  R       G+    KG      I+ +
Sbjct  86   GWLRKQGHLWKSWRVRFFVLYTDGT---LAYYRKR-------GDVK-MKG-----YIKLN  129

Query  83   EYVVGVM----GAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQ  138
            E ++G+         + + F++     +KG+  L    +T  +   W+ V R+     RQ
Sbjct  130  EGIIGIQYIDAWKTNRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVSVLRST----RQ  180

Query  139  L  139
            L
Sbjct  181  L  181

>SPRG_06021
Length=983

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (45%), Gaps = 17/114 (15%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEY  84
            GY++KRG +RK+W+ R+ +L   +  + Y +S        G+            I P+  
Sbjct  139  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLE-LVGQV----------PITPNTR  187

Query  85   VV-GVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKR  137
            V+   +G    PF F++  H P++    L +   TV +  KW+   R  +   R
Sbjct  188  VIDNSIGCQKAPFYFEV--HTPRR---VLYLGASTVQEHRKWIRSIRETVELVR  236

>H310_01921
Length=341

 Score = 39.3 bits (90),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 45/89 (51%), Gaps = 10/89 (11%)

Query  9   VGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEAS  68
           V   TS    +     G+V K+G   KSW+ R++VL   N Q+TY+ES        G  S
Sbjct  8   VNCPTSSTTMQSYDYAGWVYKQGSMIKSWKKRYMVL--KNKQLTYFES----EKVEGN-S  60

Query  69  PPKGSFYLSSIE-PHEYVVGVM--GAAGK  94
             KGSF + ++E  H+   G++  G  G+
Sbjct  61  KAKGSFQVITVEIAHDIKNGLLVHGTGGR  89

>PYIW_19613
Length=1314

 Score = 39.7 bits (91),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 34/71 (48%), Gaps = 7/71 (10%)

Query  53   YYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVEL  112
            ++E    CH    E +P  GS  LS+  P E     + AA   FG+K V  AP K  VE 
Sbjct  608  FFEHLGICHTVMPEKAP-DGSLRLSASSPDE---QALVAAAACFGYKFVARAPGKAMVE-  662

Query  113  DVFVETVGDRN  123
              +   +GD++
Sbjct  663  --YFSCLGDQD  671

>PHYRA_73430
Length=395

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           G+V K+G   ++W+ RF+VL G   Q+TYY++ A   PT       KGSF + ++E
Sbjct  12  GWVFKQGSLVRNWKKRFMVLRGR--QLTYYDT-AKVDPTV----KAKGSFQVITVE  60

>SPRG_05449
Length=723

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            EG+V+K+GH  ++W++R+  L+ SNL ++YYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>PHYKE_5678
Length=809

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 2/44 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTT  64
            T  EGY+ K+GH  +SWR R+ VL G  +  +YY S+      T
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSG--VTFSYYVSKEVAKTDT  141

>H257_09028
Length=556

 Score = 39.3 bits (90),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 23/125 (18%)

Query  12   ATSGDKARPTSCEGYVTKRGHFRKS--WRVRFLVLDGSNLQVTYYESRAACHPTTGEASP  69
            A +   A PT C GYV  + H + S  W+ R+ VL  ++L + +Y++  A   T GE   
Sbjct  11   AKTSSIAVPTLCTGYVYNQ-HEKNSIIWKKRYCVLQENSLYIFHYDNAEAA--TQGEL--  65

Query  70   PKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAP-KKGYVELDVFVETVGDRNKWLEV  128
             KG    SS+   E         GKP GF+   + P  K Y    V+ +T  ++ KW+  
Sbjct  66   -KGKIPYSSVHDWE---------GKPHGFQF--YTPTNKCY---KVYTDTEEEKLKWVST  110

Query  129  ARNAL  133
             +  L
Sbjct  111  MQKQL  115

>PHYKE_4911
Length=46

 Score = 35.0 bits (79),  Expect = 0.035, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
           G+V K+G   K+W+ RF+VL G   Q+TYY++
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT  38

>PYU1_G004386
Length=837

 Score = 39.3 bits (90),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            D    T  EGY+ K+GH  +SWR R+ +L G+    +YY S+
Sbjct  131  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  170

>PYAP_23478
Length=897

 Score = 39.3 bits (90),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 71/168 (42%), Gaps = 29/168 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEY  84
            G++ K GH RK+W++R+ VLD S L+  YY                KG   L       +
Sbjct  380  GWLRKLGHVRKNWKLRYFVLDKSVLR--YYSDEGMTR--------LKGEVLLFHPATQVH  429

Query  85   VVGVMGAAGKPFGFKM-VGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQLTR--  141
             V +  + GK   F + VG  P+     L +  E + DR  W+    +AL  +    +  
Sbjct  430  YVDIHESRGKDHTFAIQVG--PE---YTLLLQAERLADRENWMYCIEDALLCRDSYLQDP  484

Query  142  ---QAIDQSVSPNKKN------LFGFSVSLSPQPALSPQKQMQTLTKN  180
               Q + +SV+  ++N      LF  S   SP   ++P   +   +K+
Sbjct  485  KRAQDVRESVA-RRRNFSSESILFSLSTG-SPHDGINPMNMVMLHSKS  530

>PHALS_03645
Length=830

 Score = 39.3 bits (90),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            D    T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  96   DDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSK  135

>SPRG_16312
Length=261

 Score = 38.1 bits (87),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 31/60 (52%), Gaps = 9/60 (15%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
           P    GYV K+G F K+W+ RF+VL    L   YY S  A        + P+G F ++S+
Sbjct  38  PPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAM-------AKPRGFFRVTSV  88

>PYIR_13120
Length=814

 Score = 38.9 bits (89),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  +SWR R+ +L G+    +YY S+
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  138

>H257_03931
Length=695

 Score = 38.5 bits (88),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 53/118 (45%), Gaps = 14/118 (12%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSF  74
             D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S      T+ E + P+G  
Sbjct  103  SDFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVS-----GTSSEETFPRGVI  155

Query  75   YLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNA  132
             LS ++ H           K F F+ + H     Y  L +  +   D  +WL   ++A
Sbjct  156  SLSGVDVHPLDTAKF---KKQFCFE-ISHP---NYRSLYMVAKNEADLVQWLSSIKSA  206

>PYAR_19883
Length=833

 Score = 38.5 bits (88),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            T  EGY+ K+GH  ++WR R+ +L G+    +YY S+
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISK  134

>PHALS_05587
Length=1361

 Score = 38.5 bits (88),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 27/114 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            G++ K+GH  KSW+ RF VL  DG+   V YY++++            KG  +L+     
Sbjct  139  GWLKKQGHMWKSWKARFFVLFSDGT---VVYYKNKS--------RKKIKGYMHLN-----  182

Query  83   EYVVGV----MGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNA  132
            + VV V    +  AGK + F++     +KG+  L     +  D   W+   R+ 
Sbjct  183  DGVVSVQHVDIRVAGKAYVFQI-----EKGFYRLLCHCSSQIDAELWVTALRSV  231

>H257_07514
Length=810

 Score = 38.1 bits (87),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
           T  EGYV K+GH  ++WR R+ +L G+    TYY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>PHYSO_506918
Length=758

 Score = 38.1 bits (87),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query  25   GYVTKRG-HFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPK  71
            G + KRG  +R+ W++RF+ LDG   Q+ YYE   A   TT  AS  K
Sbjct  121  GSLEKRGFRWRRKWKLRFVELDGR--QLAYYEDSGAFSATTASASGVK  166

>H310_07701
Length=811

 Score = 38.1 bits (87),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
           T  EGYV K+GH  ++WR R+ +L G+    TYY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>PYVX_14527
Length=1269

 Score = 38.1 bits (87),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
            G+V K+G   ++W+ RF+VL G   Q+TYY++ A   P+       KGSF L ++E
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGR--QLTYYDT-ARLTPSV----KAKGSFTLITVE  951

 Score = 31.6 bits (70),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            G+V K G   +SW+ RFLV  G++L   YY++
Sbjct  589  GWVFKEGSLVRSWKKRFLVAKGADL--AYYKN  618

>H257_03363
Length=316

 Score = 37.7 bits (86),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 10/73 (14%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE-PHE  83
           G+V K+G   KSW+ R++VL   N Q+TY+E+        G  S  KGSF + +IE  H+
Sbjct  8   GWVYKQGSMVKSWKKRYMVL--KNKQLTYFEN----EKIEGN-SKAKGSFQVITIEIAHD  60

Query  84  YVVGVM--GAAGK  94
              G++  G  G+
Sbjct  61  IKNGLLVHGTGGR  73

>PHALS_03540
Length=904

 Score = 38.1 bits (87),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 36/69 (52%), Gaps = 8/69 (12%)

Query  14  SGDKARPTSCE--GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPK  71
           +G  AR + C+  G+  K+G   KSW+ RF VL G  L   Y+E R+     +G+    K
Sbjct  33  AGRVARSSYCDHSGWGYKQGSIIKSWKRRFFVLKGREL--IYFEERSP----SGKGIDEK  86

Query  72  GSFYLSSIE  80
           G   +S +E
Sbjct  87  GRLRISGVE  95

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 55/133 (41%), Gaps = 25/133 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P  C G++ K G   K+W+ R+  L G+ L   Y++S               G+   S  
Sbjct  783  PVVCSGWLRKEGGTVKNWKRRYFTLHGATL--CYFKS-------------DNGALLRSFT  827

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQL  139
              H     V+    K    ++     +K    L V  ET  D ++WL+    A++A++Q 
Sbjct  828  VCH-----VVTLRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAIAAEKQ-  877

Query  140  TRQAIDQSVSPNK  152
             +Q  D S   N+
Sbjct  878  KKQNTDSSQWTNE  890

 Score = 33.9 bits (76),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            CEG++ KRG     W+ R+ +L G  LQ
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>PHALS_06568
Length=388

 Score = 37.7 bits (86),  Expect = 0.087, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 32/56 (57%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           G+V K+G   KSW+ R++VL G   Q+TYY++         +   PKGS  + ++E
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGR--QLTYYDT-----AKVDQKVKPKGSCQVITVE  60

 Score = 32.3 bits (72),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 26/53 (49%), Gaps = 0/53 (0%)

Query  14   SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGE  66
            S D +   +  G++ K G   KSWR RF VL G++L     E   A    +G+
Sbjct  142  SEDGSEQVTHSGWLKKEGARVKSWRRRFFVLRGNSLSYFNSEDTGAIAKGSGD  194

>PYIR_24588
Length=909

 Score = 38.1 bits (87),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 16/113 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEY  84
            G++ K GH RK+W+ R+ VL+ S L+    ES A            KG   L       +
Sbjct  412  GWLRKLGHVRKNWKSRYFVLEKSVLRYYADESMARL----------KGEVLLFHPATRVH  461

Query  85   VVGVMGAAGKPFGFKM-VGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
             V +  + GK   F + VG    K Y  L +  + + DR  W+    +AL  +
Sbjct  462  YVDIHLSGGKDCTFAIHVG----KDYALL-LQADQLSDRENWMYCIEDALLCR  509

>HYAP_13757
Length=262

 Score = 37.4 bits (85),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 33/120 (28%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEA---------SPPKGSFY  75
            G++ KRGH  K+W+ RF +L+G+ L  TYY+    C   T +           P +G   
Sbjct  15   GWLWKRGHTFKTWKKRFFLLNGAAL--TYYKQ---CCVITWDILGGGIRCLDLPVRGGLR  69

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGD---RNKWLEVARNA  132
            ++  E  +            FG ++   + +  YV+        GD   R +WL+  ++A
Sbjct  70   VAQAEASDLT---------SFGLRITSSSGRLLYVQ-------AGDLESRTQWLKALKDA  113

>PHYCA_529660
Length=345

 Score = 37.4 bits (85),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 57/128 (45%), Gaps = 27/128 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYY-ESRAACHPTTGEAS-----PPKGSFYLSS  78
            G++ KRG   K+W+ RF +L+G+ L  TYY +         G  +     P +G   ++ 
Sbjct  100  GWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASDVLGGGTQCLDLPVRGGLRVAK  157

Query  79   IEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGD---RNKWLEVARNALSA  135
            +E  +            FG K+  ++ +  YV+        GD   R +WL+V + A  A
Sbjct  158  VELSDMT---------SFGLKITSYSGRVLYVQ-------AGDQESREQWLKVLKEAPLA  201

Query  136  KRQLTRQA  143
            + ++  Q 
Sbjct  202  RGEMMGQV  209

>SPRG_02752
Length=831

 Score = 37.7 bits (86),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 54/112 (48%), Gaps = 24/112 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EG++ K+G    +W+ R++VL G +  + YY+ +   +P   E    KG+F L+++E   
Sbjct  7    EGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVTNPRAKE----KGTFTLAAVE---  56

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSA  135
                         G  + G+    G + + ++ +TVG+      +  NA++A
Sbjct  57   ------RTPAMELGLTLAGY---DGKI-MHIYTKTVGE----FVLCNNAMTA  94

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYE  55
            G++ K G   KSW+ RF VL G++L  TYY+
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>PYAR_15792
Length=121

 Score = 35.8 bits (81),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTG  65
           EG +TKR  + K WR RF VL G+ L    Y  RAA  P  G
Sbjct  16  EGELTKRSVWLKEWRRRFFVLKGNKL----YFCRAAKEPAHG  53

>PHYRA_72718
Length=732

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 49/124 (40%), Gaps = 21/124 (17%)

Query  18   ARPTSCEGYVTKRGH-FRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL  76
             R     G + KRG  +RK W++RF+ LDG   Q+ YYE   A   TT   +  K     
Sbjct  87   VRAPVVSGSLEKRGFRWRKKWKLRFVELDGR--QLAYYEDTGAFCATTASCNGTK-----  139

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
             S +P   V+    A  +    K V   P               D   W+  AR+A + +
Sbjct  140  RSCKPKRKVMLTADATLEDVDDKTVSVTPAL-------------DEKPWMLRARDAATKQ  186

Query  137  RQLT  140
            R L 
Sbjct  187  RWLV  190

>PYAP_13695
Length=348

 Score = 37.4 bits (85),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           G++ K+G   K+W+ RF+VL G   Q+TYY++     P   E    KGSF + ++E
Sbjct  12  GWIYKQGSLVKNWKRRFMVLRGK--QLTYYDTE-RISPRVKE----KGSFQVITVE  60

>PPTG_10755
Length=723

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 3/45 (7%)

Query  25   GYVTKRGH-FRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEAS  68
            G + KRG  +RK W++R++ LDG   Q+ YYE   A   TT  AS
Sbjct  103  GSLEKRGFRWRKKWKLRYVELDGR--QLAYYEDSGAFSATTATAS  145

>SPRG_11900
Length=605

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (48%), Gaps = 19/82 (23%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSS  78
            +P  C GY+ K+G   K+WR R+  +DG + Q++Y ++         + +PPKG      
Sbjct  234  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDA---------DGAPPKG------  277

Query  79   IEPHEYVVGVMGAAGKPFGFKM  100
                 +VV V     +PF   +
Sbjct  278  ---FGHVVDVCVNTKRPFALYI  296

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 7/55 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
           G+V K+G   KSW+ RFLV+ G +  VTYY+ R+   P   E    KGS  L  +
Sbjct  7   GFVFKQGALIKSWKKRFLVVQGRH--VTYYD-RSVHEPNPRE----KGSLVLVDV  54

>SDRG_07310
Length=1116

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (43%), Gaps = 7/114 (6%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P   EG+++KR  + + W   + VL G+ L+   Y S+ A +  T + SP  G       
Sbjct  147  PIEWEGFLSKRSEWLRRWEKHYYVLHGTTLK--RYASKEA-YVATLQLSPVDGKPPPPPA  203

Query  80   EPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
                 + GV  A G+  GF       K     L +   +  +R  W+ +A+ A+
Sbjct  204  YTAYTISGVKEAPGRTHGFVFATADGKT----LQLTAPSAMERVIWMRLAQEAM  253

>HYAP_06403
Length=1037

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query  53   YYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVEL  112
            ++E  A CH    E +P   S  LS+  P E     + AA   FG+K V  AP K  VE 
Sbjct  102  FFEHLAVCHTVMPEKAP-DNSLRLSASSPDEQA---LVAAAACFGYKFVARAPGKAMVEY  157

Query  113  DVFVE  117
               +E
Sbjct  158  FCCIE  162

>CCI40991
Length=801

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 0/47 (0%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEA  67
            T  EGY+ K+GH  +SWR R+ VL G+         ++     TG+ 
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQSVITQLTGDC  152

>PYU1_G003229
Length=810

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYE  55
            G++ K+GH  KSW+ RF V++GS   +TY+E
Sbjct  402  GWLNKQGHRMKSWKRRFFVVEGST--ITYFE  430

 Score = 35.4 bits (80),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            CEG++ KRG    +W+ RF  L+G  LQ
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ  287

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 9/78 (12%)

Query  15  GDKARPTSCE--GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKG  72
           G  A+ T C+  G+ +K+G   KSW+ R+ VL G  L   Y+  R+     +G+    KG
Sbjct  19  GRVAKSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSERSP----SGKGINEKG  72

Query  73  SFYLSSIE-PHEYVVGVM  89
              +  +E   E+  G++
Sbjct  73  RLKIVGVEFTPEFTNGLL  90

 Score = 33.5 bits (75),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            C G++ K G   K+W++R+  L G+ L  TY++S
Sbjct  702  CSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS  733

>PYAP_19560
Length=337

 Score = 37.0 bits (84),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 57/137 (42%), Gaps = 31/137 (23%)

Query  2    NILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACH  61
            +ILR+P +         R     G++ K+G   K+W+ RF +L+GS L  TYY       
Sbjct  73   SILRLPTM-------YVRGPVFHGWLWKKGASFKTWKKRFFLLNGSTL--TYYTQSCVVA  123

Query  62   PTTGEAS---PPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVET  118
               G      P KG   ++S +  +            FG ++V  + +  +V+       
Sbjct  124  TEVGTRCFDMPAKGGLRVASADFTDET---------SFGIRIVSSSGRVLFVQ-------  167

Query  119  VGDRN---KWLEVARNA  132
             GDR    KWL V + A
Sbjct  168  AGDRTSRIKWLGVLQEA  184

>SPRG_14312
Length=661

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 54/123 (44%), Gaps = 18/123 (15%)

Query  12   ATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPK  71
            A   D   P S  G + K+ +  K+W+ RF+VL G +L   YY S AA      E S PK
Sbjct  100  AECPDFYAPLSRSGVLVKQANHLKNWKKRFMVLRGQSL--FYYVSGAA-----SEDSYPK  152

Query  72   GSFYLSSIEPHEYVVGVMGAA--GKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVA  129
            G   L  +E     V ++  A   K F F++        Y  L +  +   D  +W+   
Sbjct  153  GLISLVGVE-----VQLVDVARFKKQFCFEL----SHPYYRPLYLMAKNEADLTQWMSCI  203

Query  130  RNA  132
            ++A
Sbjct  204  KSA  206

>PYAP_16161
Length=889

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTT  64
           EGY+ K+G   K W+ R+ V DG  L  +YY SR    P+ 
Sbjct  30  EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSKPSV  68

>SPRG_00364
Length=255

 Score = 36.6 bits (83),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 48/111 (43%), Gaps = 27/111 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEY  84
            G+V KRG   ++W+ R+ VL  + L   YY+          E  P KG  ++ SIE    
Sbjct  166  GWVEKRGAVMRTWKRRYFVLRENVL--AYYD-------INLEGQPKKGGDFVQSIET---  213

Query  85   VVGVMGAAGKPFG--FKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
                  +  KP G  FKMV      G      F ET  D  +WL +A N L
Sbjct  214  ------STIKPNGLEFKMVSGRSLLG------FTETTDDHVQWL-LAANTL  251

>PYU1_G007423
Length=928

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query  7    PEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54
            PE   A + D +   S  G++ K GH RK+W+ R+ VL+ S L+  YY
Sbjct  418  PEAPDANAFDDSFLDSMRGWLRKLGHVRKNWKSRYFVLERSVLR--YY  463

>CCI43793
Length=1117

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 72/181 (40%), Gaps = 32/181 (18%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPT-TGEASPPKGSFYLSSIEPHE  83
            GY+ K+G F KSWR RF +L      + YY S+   H T  GE S    S  L +  P  
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKE--HLTKLGEISVDDQSVLLKT--PRN  230

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGD-RNKWLEVARNALSAKRQLTRQ  142
                     G P  F  V HA +     L +F E   D  N W++  R +   + ++ R 
Sbjct  231  ---------GIPHCFT-VKHAART----LIMFTEDGEDIMNTWMD--RISRCIRLRIDRN  274

Query  143  AI--------DQSVSPNKKNLFGFSVSLSPQPALSPQKQMQT--LTKNKDDLLSDALRDI  192
            AI          SV+  +  L   + ++   P   P  + Q   L  N    L  AL  +
Sbjct  275  AITNTIMDREQSSVNSTESALILDTAAIRAHPKTHPSHKHQNVHLASNDSFRLLGALEQM  334

Query  193  E  193
            E
Sbjct  335  E  335

>HYAP_09304
Length=1144

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 36/88 (41%), Gaps = 21/88 (24%)

Query  13   TSGDKARPTS-----CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC-------  60
            TSGD     S       GY+ K+G F KSWR RF +L      ++YY S           
Sbjct  108  TSGDDVEQFSDADIITSGYLVKQGSFWKSWRRRFFILRRDCPVLSYYTSAEELAKLGEIT  167

Query  61   --HPTTGEASPPKGSFYLSSIEPHEYVV  86
                TT + +P  G       EPH + +
Sbjct  168  IDEHTTVQMTPRDG-------EPHRFTI  188

>PYVX_23432
Length=1510

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 28/60 (47%), Gaps = 4/60 (7%)

Query  53   YYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVEL  112
            ++E  A CH    E +   GS  LS+  P E     + AA   FGFK V  AP K  VE 
Sbjct  578  FFEHLAVCHTVMPERAA-DGSLRLSASSPDE---QALVAAAACFGFKFVARAPGKAMVEF  633

>H257_05175
Length=678

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 15/65 (23%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
           EG++TKR  H    W  R+ +L+GSNL+  YY+ R    PT      P+G++ L+    +
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKRG--DPT------PRGTYVLT----N  47

Query  83  EYVVG  87
           E VVG
Sbjct  48  ECVVG  52

>H310_13627
Length=678

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 20/26 (77%), Gaps = 0/26 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            G++ K+GH  K+W+ RF VLDGS L+
Sbjct  270  GWLYKQGHILKNWKRRFFVLDGSVLR  295

>PYU1_G012859
Length=1183

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 5/56 (9%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            M++++ P    + S    +P    G++ K+GH  +SW+ R+ VL G +LQ  Y+E+
Sbjct  476  MDLVKAP---PSLSPSIVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN  526

 Score = 33.9 bits (76),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (53%), Gaps = 9/57 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
            +G++ K G   K+W+ RF+VL G+ L  +YY            +SPP GS  +  +E
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADETP-------SSPPLGSLVIRQVE  244

 Score = 33.9 bits (76),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            A   +CEG++ K+GH  K W+ R+  L+   L+
Sbjct  354  ASSQTCEGWLLKQGHKSKRWKRRYFTLNNDMLE  386

 Score = 33.5 bits (75),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (47%), Gaps = 10/73 (14%)

Query  5    RVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYE--------S  56
            +V E     SG++      EG++ K+G   K+W+ R+ VL+ S L   YY+        S
Sbjct  594  QVEETNLDNSGNRLGRLGQEGWLLKKGQNFKTWKQRYFVLERSRLM--YYDDEGGELLGS  651

Query  57   RAACHPTTGEASP  69
                  + GEA P
Sbjct  652  GVVFEVSVGEARP  664

 Score = 31.6 bits (70),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 26/119 (22%), Positives = 52/119 (44%), Gaps = 24/119 (20%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLS  77
            A  ++C G++ K+G   K+W+ R+  L G+ L+    E+ +              SF +S
Sbjct  806  ADQSNCHGWLNKQGGTIKTWKRRYFSLHGTTLRYFKRETGSMLR-----------SFTIS  854

Query  78   SIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
             +E    V           G +++  + +K    L +  E+  D  +WL   + ++SA+
Sbjct  855  HVEKQPQVA---------LGLEVMTTSGRK----LMLTAESKEDYGRWLRALQASISAE  900

>H257_10847
Length=792

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 12/186 (6%)

Query  7    PEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGE  66
            P +   T+    +     G++ K+G   KS + R+  L G++  ++Y+ +     P T  
Sbjct  218  PVIAPTTATIPDKKVVASGWLRKQGQVFKSVKRRWFELTGAD-GLSYFRN-----PDT--  269

Query  67   ASPPKGSFYLSSIEPHEYVVGV-MGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKW  125
            A+ PKG   ++   P   V  + M   G+ F F +  +A  K    L V  ++  DR+ W
Sbjct  270  ATKPKGRVLVT---PASSVTRLDMRKTGERFSFSITENALDKKSRVLFVHADSQEDRSIW  326

Query  126  LEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKNKDDLL  185
            +    + +  K   +  A+   + PN     G  +  S    +SP        K+  D+L
Sbjct  327  VAALSSVILCKDGASPPALSSPLGPNGSVDDGTCIERSLSDPMSPDHDDLPRGKDDSDIL  386

Query  186  SDALRD  191
            +D  R+
Sbjct  387  ADIARE  392

>PITG_00416
Length=698

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 3/45 (7%)

Query  25   GYVTKRGH-FRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEAS  68
            G + KRG  +RK W++R++ LDG   Q+ YYE   A   TT  AS
Sbjct  79   GALEKRGFRWRKKWKLRYVELDGR--QLAYYEDSGAFSVTTATAS  121

>PPTG_16044
Length=1378

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 27/114 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            G++TK+GH  KSW+ RF VL  DG+     YY+++             KG   L+     
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKG--------RKKIKGCMQLN-----  182

Query  83   EYVVGV----MGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNA  132
            + VV V    +  AGK + F++     +KG+ +L  +  +  +   W+   R+ 
Sbjct  183  DGVVSVQHVDIRVAGKAYVFQI-----QKGFYKLLCYCCSQFEAELWVAALRSV  231

>CCA24252
Length=323

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 43/108 (40%), Gaps = 22/108 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYE---SRAACHPTTGEASP---PKGSFYLSS  78
            G++  RG     WR RF VL+GS L  T YE   S         EA P   P+    ++ 
Sbjct  87   GWLWMRGSRFGRWRHRFFVLNGSML--TSYETFPSEKVLRQALPEAFPDSQPRNVLRVAH  144

Query  79   IEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWL  126
            +E            G   GFK+ G   K     LDV   T   RN WL
Sbjct  145  VE----------EGGCRIGFKIYGTCGKI----LDVRAPTTDARNAWL  178

>PYIR_13168
Length=1353

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 51/110 (46%), Gaps = 19/110 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            G++TK+GH  K+W+ RF VL  DG+     YY+++       G      G   +  ++  
Sbjct  116  GWLTKQGHMWKTWKTRFFVLYADGT---FAYYKNKGK-KKMQGCLMLNDGIVTVKHVDVR  171

Query  83   EYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNA  132
            +         GKP+ F++     +KG+ +L  +  +  +   W+   R+A
Sbjct  172  K--------IGKPYVFQV-----EKGFYKLICYCCSQLEAELWVSALRSA  208

>SDRG_00080
Length=298

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (52%), Gaps = 9/60 (15%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            P +  GYV K+G F K+W+ R++VL    L   YY S  A        + P+G F ++ I
Sbjct  70   PPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERAT-------TKPRGFFRVTGI  120

>PYAR_26065
Length=314

 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 4/60 (7%)

Query  52   TYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVE  111
            +++E  + CH    E +P  GS  LS+  P E     + AA   FG+K    AP K +VE
Sbjct  91   SFFEHLSVCHTVMPERAP-DGSVRLSASSPDEQA---LVAAAACFGYKFSARAPGKAFVE  146

>PITG_03318
Length=1343

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 27/114 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            G++TK+GH  KSW+ RF VL  DG+     YY+++             KG   L+     
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKG--------RKKIKGCMQLN-----  182

Query  83   EYVVGV----MGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNA  132
            + VV V    +  AGK + F++     +KG+ +L  +  +  +   W+   R+ 
Sbjct  183  DGVVSVQHVDIRVAGKAYVFQI-----EKGFYKLLCYCCSQFEAELWVAALRSV  231

>PHYKE_7856
Length=346

 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYY  54
           G++TK+GH  KSW+ RF VL  DG+  +   +
Sbjct  63  GWLTKQGHMWKSWKTRFFVLFSDGTQFEAELW  94

>PYAR_18690
Length=2455

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 33/69 (48%), Gaps = 4/69 (6%)

Query  6     VPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTG  65
             V E+ A  S  +      EGY+ KRGH   S R R+ VL  + L  TYY ++        
Sbjct  1120  VDEISAVESSHETSSILMEGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQEDSR--NS  1175

Query  66    EASPPKGSF  74
             + S P GSF
Sbjct  1176  DTSQPLGSF  1184

>H310_04667
Length=680

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 37/65 (57%), Gaps = 15/65 (23%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
           EG++TKR  H    W  R+ +L+GSNL+  YY+ R    PT      P+G++ L+    +
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKRG--DPT------PRGTYVLT----N  47

Query  83  EYVVG  87
           E +VG
Sbjct  48  ECIVG  52

>PPTG_14626
Length=1055

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 49/116 (42%), Gaps = 32/116 (28%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLS----S  78
            C G++ K G   KSW+ R+  L GS L  +YY+S              KGS   S    +
Sbjct  714  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKSE-------------KGSLLRSVSVIN  758

Query  79   IEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALS  134
            +EPH  V           G  +     +K    L V  E+ G+ NKWL   + A++
Sbjct  759  VEPHPSV---------SLGLTVSTVGGRK----LIVQAESNGEFNKWLNAIQEAVA  801

>H257_06469
Length=76

 Score = 33.9 bits (76),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTY  53
           EGYV K+GH  KSW+ R+  LD S   + Y
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEY  31

>SDRG_03531
Length=255

 Score = 36.2 bits (82),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 47/111 (42%), Gaps = 27/111 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEY  84
            G+V KRG   +SW+ R+ VL  + L   YY+          E  P KG   + SIE    
Sbjct  166  GWVEKRGAVMRSWKRRYFVLRENVL--AYYD-------INLEGQPKKGGDLVQSIET---  213

Query  85   VVGVMGAAGKPFG--FKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
                  +  KP G  FKMV      G      F ET  D  +WL +A N L
Sbjct  214  ------STVKPNGLEFKMVSGRSLVG------FTETTDDHVQWL-LAANTL  251

>PYIR_13555
Length=355

 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           G+V K+G   ++W+ R++VL G   Q+TYY++ +    T       KGSF + ++E
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRGK--QLTYYDTASLTAKT-----KEKGSFQVITVE  58

>PITG_02106
Length=1015

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 63/147 (43%), Gaps = 41/147 (28%)

Query  7    PEVGAATS-----GDK--ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59
            PE  A +S     GD+  A    C G++ K G   KSW+ R+  L GS L  +YY+S   
Sbjct  653  PEYDAISSSSSEQGDQEAAAAQGCVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKSE--  708

Query  60   CHPTTGEASPPKGSFYLS----SIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVF  115
                       KGS   S    SIEPH  V           G  +  H+ +K  ++ D  
Sbjct  709  -----------KGSLLRSVSVVSIEPHPTV---------SLGLVVSTHSGRKLIMQADSN  748

Query  116  VETVGDRNKWLEVARNALSA--KRQLT  140
             E     ++WL   + A++   +R+LT
Sbjct  749  EEF----DRWLSAIQGAVAGENERKLT  771

>H257_13346
Length=587

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 22/45 (49%), Gaps = 2/45 (4%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASP  69
           G + KRGH RK+W +RF VL    L+  YY        TT    P
Sbjct  25  GILLKRGHVRKNWLMRFFVLTSGALR--YYRKPPGSRSTTWSVDP  67

>PYU1_G012274
Length=873

 Score = 37.0 bits (84),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 39/84 (46%), Gaps = 16/84 (19%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEP  81
            S EGY+ K+    +SW+  + VL+G  +   YYESR      T       G  ++ S+E 
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESREDFIMNTKLI----GRIHIQSVED  363

Query  82   HEYVVGVMGAAGKPFGFKMV--GH  103
                       GKP GF+++  GH
Sbjct  364  DH--------MGKPNGFRILTEGH  379

>SDRG_02154
Length=822

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 13/59 (22%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASP---PKGSFYLSSIE  80
            G++ K+G   K+W+ RF+VL   +L   Y+E        T + +P   PKGSF + +IE
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLH--YFE--------TDKLTPTLKPKGSFQVLAIE  176

>H310_14019
Length=683

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 61/161 (38%), Gaps = 35/161 (22%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL  76
            +A   S EG++ KRG   K+W+ R+  L+G  L+  Y E         G  + PKG    
Sbjct  166  RASMRSFEGWLLKRGQRVKNWKRRYFTLNGQELK--YME---------GPGAKPKG----  210

Query  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136
                 +  VVGV      P+    +   P +    LDV  E+  ++  W+          
Sbjct  211  -----YGMVVGVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWM----------  251

Query  137  RQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTL  177
             Q    A     +          V+LS  PA  PQ+   +L
Sbjct  252  -QRILDACGHVAATTPPPPPVLHVTLSSAPATPPQQLAASL  291

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 2/52 (4%)

Query  8    EVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59
            + G  +S D A  T+CEG++ K+G   K+W+ R+  L G  L     +S  A
Sbjct  331  DYGIQSSLDTA--TTCEGWLYKQGSLVKNWKKRWFTLLGEVLSYRDMQSSVA  380

>PYIR_14494
Length=819

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 32/52 (62%), Gaps = 4/52 (8%)

Query  6    VPEVG-AATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            VP VG    S D++ P  C G++ K G   K+W++R+  L+G+ L  +Y++S
Sbjct  699  VPYVGMGCVSLDESFP-GCSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  747

 Score = 35.4 bits (80),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (58%), Gaps = 0/33 (0%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            A    CEG++ KRG    +W+ RF  L+G  LQ
Sbjct  260  AETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ  292

 Score = 32.0 bits (71),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 37/79 (47%), Gaps = 12/79 (15%)

Query  2   NILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACH  61
           N++ V  V   +  D A      G+ +K+G   KSW+ R+ VL G  L   Y+  R+   
Sbjct  15  NVIAVSRVTKNSYCDHA------GWASKQGSIIKSWKRRYFVLKGREL--IYFAERSP--  64

Query  62  PTTGEASPPKGSFYLSSIE  80
             +G+    KG   + ++E
Sbjct  65  --SGKGIDEKGRLKIVAVE  81

 Score = 31.6 bits (70),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
            G++ K+G   KSW+ RF V++  +  +TYYE          EA  PKG+ +++ +
Sbjct  422  GWLKKQGKHMKSWKRRFFVIE--DRTITYYEQ-------LNEA--PKGNGFINQV  465

>HYAP_06101
Length=984

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 24/35 (69%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESR  57
            G++TK+GH  KSW+ RF VL  DG+     YY+++
Sbjct  143  GWLTKQGHLWKSWKTRFFVLFADGT---FAYYKNK  174

>PPTG_18989
Length=1213

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  219

>SDRG_14771
Length=549

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 51/118 (43%), Gaps = 22/118 (19%)

Query  37   WRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
            W+ R+ VL  S L + YYES  A      E S  KG     S+  H++        GKP 
Sbjct  34   WKRRYCVLQESALAIFYYESEEA----AAEGS-LKGKIPYCSV--HDW-------DGKPH  79

Query  97   GFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKN  154
            GF+      K       V+ ++  +RNKW+     A+ A+     +  D  ++P  +N
Sbjct  80   GFQFYTPTNKC----FRVYCDSDDERNKWM----TAMQAQLDNAPEVADGELAPYARN  129

>PYAP_16734
Length=1314

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 51/113 (45%), Gaps = 16/113 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEY  84
            G +TK+G +R++W+ RF +L   +  + YY+S         E     G+  +SS      
Sbjct  181  GTLTKQGSWRRNWKTRFFLLRRDHPSLCYYKSE--------EKLELLGAIAVSS---DTL  229

Query  85   VVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKR  137
            V+        P+ F++     + G   L +  ET  ++ +W++  +  + A R
Sbjct  230  VLDKSAGGHAPYRFQL-----RTGDASLLLEAETRENQQRWMDACQELVDAVR  277

>PYIR_15118
Length=1222

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 36/80 (45%), Gaps = 9/80 (11%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES--------RAACHPTTGEASPPKGSFYL  76
            GY+ K+G F K+WR R+ +L      ++YY+S              TTG    P+  F  
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAEELTKLGEITVDGTTGVRPTPREGFPF  252

Query  77   SSIEPHE-YVVGVMGAAGKP  95
              +  HE   + ++   GKP
Sbjct  253  QFVVEHEGRKLTLVAEEGKP  272

>PYAR_19291
Length=711

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 55/136 (40%), Gaps = 15/136 (11%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60
            +N L +    A+   D    + C G++ K GH RK+W++R+ VL+ S L+  YY   A  
Sbjct  189  LNGLYLDHPTASPFDDTFLDSMC-GWLRKLGHVRKNWKMRYFVLEKSVLR--YYADEAMT  245

Query  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120
                      KG   L       + V +  + G+   F +         +E D     V 
Sbjct  246  R--------LKGEVLLFHPAAQVHYVDIHLSNGRDNTFAIQVGPDYTLLLEAD----RVS  293

Query  121  DRNKWLEVARNALSAK  136
            DR  W+    +AL  +
Sbjct  294  DRENWMYCIEDALLCR  309

>PYU1_G000724
Length=189

 Score = 35.4 bits (80),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 5/36 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESRA  58
            G++TK+GH  KSW+ RF VL  DG+     YY+++ 
Sbjct  111  GWLTKQGHMWKSWKTRFFVLFADGT---FAYYKNKG  143

>H310_09363
Length=1954

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (51%), Gaps = 2/67 (3%)

Query  13   TSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKG  72
            TS    + TSC GY+ KRG    + + R+++L  + L   YY++    +        P+G
Sbjct  836  TSSQNNKRTSCAGYLMKRGEVNVTMQRRYMILQDNEL--VYYKTNPELNKGWFGKEKPRG  893

Query  73   SFYLSSI  79
            S +L ++
Sbjct  894  SLHLGNV  900

>SPRG_14955
Length=635

 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query  3   ILRVPEVGAATSGDKARP-TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACH  61
           +L   E  A+  G K +      G + KRGH RK+W  RF VL  ++L+  Y + R+  H
Sbjct  5   VLHPQESSASVGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLRY-YKKPRSPNH  63

Query  62  PTT  64
            +T
Sbjct  64  SST  66

>SPRG_00889
Length=994

 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 48/110 (44%), Gaps = 17/110 (15%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EG+V K+G +   W  R+LVLDG+ L  TYY  +             +G   L+ + P  
Sbjct  123  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDAR----SGKNLRGRMVLTYVGPD-  175

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
                    + K  GF +      KG+    +   T  +++ W+E+ + AL
Sbjct  176  ------FKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  215

>PYVX_14593
Length=964

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query  7    PEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            P+  A  S D  +   C G++ K+G    SW+ R+  L GS L+  YY+S
Sbjct  592  PDALATNSLDGGKLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKS  639

 Score = 32.0 bits (71),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (56%), Gaps = 0/34 (0%)

Query  11   AATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVL  44
            AA+ G       CEG++ KRG   K+W+ R+  L
Sbjct  242  AASEGQSRDVRYCEGWLEKRGARSKTWKSRYFFL  275

>H310_14473
Length=613

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (48%), Gaps = 2/46 (4%)

Query  9   VGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54
           +  AT G         G + KRGH RK+W  RF VL    L+  YY
Sbjct  11  MAVATPGKSKEDVLHSGILLKRGHLRKNWLTRFFVLTSGALR--YY  54

>H310_06666
Length=887

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
           EGY+ K+G   K W+ R+ V DG +L  +YY S+
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSK  55

>PHALS_07930
Length=1200

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  215

>PHYRA_81944
Length=1149

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  154

>PITG_20103
Length=1301

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 57/138 (41%), Gaps = 18/138 (13%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSS  78
            R  S EGY++K+     SW+  + VL+   L   +YE+R          S   G   L S
Sbjct  221  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETRE----DFISNSKLIGRIQLQS  274

Query  79   IEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQ  138
            IE  +         GKP GF+++       ++       T  ++ +W      A+S   +
Sbjct  275  IEDED--------MGKPNGFRVIAEGNHVNHLS----SRTTFEKEQWKRAISIAISKAPE  322

Query  139  LTRQAIDQSVSPNKKNLF  156
            +TR  +  +  P + + F
Sbjct  323  VTRPYVAFASQPLEAHKF  340

>PYAP_23744
Length=123

 Score = 34.3 bits (77),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTG  65
           EG +TKR  + K WR R+ VL G+ L    Y  RAA  P  G
Sbjct  16  EGELTKRSVWLKEWRRRYFVLKGNKL----YFCRAANEPAHG  53

>H257_02642
Length=975

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYE  55
           P   EGY+ KRG +   W    +VLDG  L+V+YY+
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYD  60

>H257_09270
Length=884

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 49/129 (38%), Gaps = 8/129 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EGY+ KR  + K W   + VL G  L     +  A  HP   +     G F  S     +
Sbjct  86   EGYLMKRSDWLKHWETYYFVLHGRVLYCYLSDEEAKLHPENSKIK--HGKFTFSDNLILD  143

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQLTRQA  143
             V+ V       F F+       KG  ++ +  +T   +  W+ +A + +     L  Q 
Sbjct  144  EVITVQSRLTYEFVFES-----DKGK-QIHLRAKTEASKQMWMHMACHGIVDTEMLRNQV  197

Query  144  IDQSVSPNK  152
            +    +P +
Sbjct  198  LHMRRTPQR  206

>CCA26890
Length=1530

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 17/112 (15%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL---SSIEP  81
            GY+ KRG   KS+R R++ L+G+ L  +YY+ + +        + P+GS  L   +S++P
Sbjct  297  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENVTSLQP  354

Query  82   HEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
             E       +  + +G  +V  +        ++  E   + ++WL+   NA+
Sbjct  355  LE-------SKTEKYGIVLVTTSRT-----WELVAENESEYHRWLKELCNAV  394

>PITG_11578
Length=2131

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR-AACHPTTGEASPPKGSF  74
             EGY+ KRGH   S R R+ VL G+ L  TYY +   + +P  G  + P G+F
Sbjct  952   EGYLMKRGHKIPSMRKRYCVLIGNEL--TYYVTHDDSKNPGGGATTNPLGNF  1001

>PHALS_06336
Length=511

 Score = 35.8 bits (81),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 8/56 (14%)

Query  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            ++I+++ E+G      +  P +  G+V K G   +SW+ RFLV  G+ L   YY++
Sbjct  118  LSIIQIREMG------REDPATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  165

>SDRG_01408
Length=916

 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 47/110 (43%), Gaps = 17/110 (15%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EG+V K+G +   W  R+LVLDG+ L  TYY  +             +G   L+ + P  
Sbjct  125  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDAR----SGKNLRGRMVLTYVGPD-  177

Query  84   YVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
                      K  GF +      KG+    +   T  +++ W+E+ + AL
Sbjct  178  ------FKGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  217

>PHYRA_94409
Length=1270

 Score = 36.2 bits (82),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 24/35 (69%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESR  57
            G++TK+GH  KSW+ RF VL  DG+     YY+++
Sbjct  113  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  144

>PHYSO_248481
Length=1283

 Score = 36.2 bits (82),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 24/35 (69%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESR  57
            G++TK+GH  KSW+ RF VL  DG+     YY+++
Sbjct  92   GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  123

>PPTG_11714
Length=2444

 Score = 36.2 bits (82),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR-AACHPTTGEASPPKGSF  74
             EGY+ KRGH   S R R+ VL G+ L  TYY +   + +P  G  + P G+F
Sbjct  1143  EGYLMKRGHKIPSMRKRYCVLIGNEL--TYYVTHDDSKNPGGGATTNPLGNF  1192

 Score = 34.3 bits (77),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 51/122 (42%), Gaps = 24/122 (20%)

Query  16    DKARPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSF  74
             D    T  +GY+  R H   S WR RF+VL+GS L V + E+   C     E   P+  F
Sbjct  2016  DNTDTTQTKGYLRVRHHNLGSIWRERFVVLEGSTLTV-FSEN---CQ--LDEEGKPR--F  2067

Query  75    YLSSIEPHEYV-----------VGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRN  123
                ++E HE V           +G  G+  K  GF+    A     V L+    T  D  
Sbjct  2068  PDLAVEKHELVGVEKWHPVFTSLGRSGSGLKGTGFR----AETSSGVYLEFIATTAEDAF  2123

Query  124   KW  125
             KW
Sbjct  2124  KW  2125

>PHALS_12503
Length=340

 Score = 35.4 bits (80),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYE  55
            G++ KRGH  K+W+ RF +L+G  + +TYY+
Sbjct  101  GWLWKRGHSFKTWKKRFFLLNG--VALTYYK  129

>SPRG_02753
Length=309

 Score = 35.4 bits (80),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (58%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           +G+V K+G   +SW+ R++VL   N Q++Y+++      T       KGSF + +IE
Sbjct  7   QGWVFKQGSLVRSWKKRYMVL--KNKQLSYFDTENVTAST-----KAKGSFAVITIE  56

 Score = 32.7 bits (73),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            C G++ K G   K+W+ RF  L G +L  TYY++
Sbjct  138  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDN  169

>H310_12448
Length=555

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 54/124 (44%), Gaps = 21/124 (17%)

Query  12   ATSGDKARPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLQVTYYESRAACHPTTGEASPP  70
            A +   A P+ C GYV  +       W+ R+ VL  ++L + +Y+S  A     GE    
Sbjct  11   AKTASTAVPSLCTGYVYNQPEKNSIIWKKRYCVLQENSLYIFHYDSAEAA--AKGEL---  65

Query  71   KGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAP-KKGYVELDVFVETVGDRNKWLEVA  129
            KG    SS+   E         GKP GF+   + P  K Y    V+ +T  ++ KW+   
Sbjct  66   KGKIPYSSVHDWE---------GKPHGFQF--YTPTNKCY---KVYTDTEDEKVKWIATM  111

Query  130  RNAL  133
            +  L
Sbjct  112  QKQL  115

>PYU1_G009249
Length=2580

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 58/124 (47%), Gaps = 14/124 (11%)

Query  25    GYVTKRGHFRKS-WRVRFLVLDGSNLQVTYYESRAACHPTTG-EASPPKGSFYLSSI-EP  81
             GYV  R HF  + WR RF+VL G++  + Y +S AA       E         L +I + 
Sbjct  2101  GYVRVRHHFLGAIWRERFMVLHGTSAYL-YPDSSAATEDDEQLERKKALEKHNLVAIAKW  2159

Query  82    HEYVVGVMGAA---GKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEV---ARNALSA  135
             H   V   G+A      +GF++   A   GY+E    V T  ++ +W++    A  ALSA
Sbjct  2160  HPTYVSTFGSAHSSSNRYGFRVENEA--GGYLE--CIVATEQEQTQWMKTISDAVTALSA  2215

Query  136   KRQL  139
               QL
Sbjct  2216  SSQL  2219

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 29/62 (47%), Gaps = 5/62 (8%)

Query  19    RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEAS-PPKGSFYLS  77
             R    EGY+ KRGH   S R R+ VL      + YY    A H  +   S  P GSF + 
Sbjct  1174  RQILLEGYLVKRGHLIPSMRKRYCVLLKRGNTLEYY----ATHEDSRNPSVAPHGSFRVD  1229

Query  78    SI  79
             ++
Sbjct  1230  TV  1231

>PHYRA_83071
Length=2300

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 5/58 (9%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQ--VTYYESRAACHPTTGEASPPKGSFYLSSI  79
             EGY+ KRGH   S R R+ VL G+ L   VT+ +S+   +P  G  + P G F ++ +
Sbjct  1132  EGYLMKRGHKIPSMRKRYCVLLGNELSYFVTHDDSK---NPGGGATTAPLGKFRVAVV  1186

 Score = 31.6 bits (70),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  24    EGYVTKRGHFRKS-WRVRFLVLDGSNLQVTYYESRAA  59
             EG +  R H   S WR RF+VL+GS L + Y E+R A
Sbjct  2058  EGQLQVRHHNLGSIWRARFVVLEGSKLSI-YSENREA  2093

>SDRG_14486
Length=308

 Score = 35.4 bits (80),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (58%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
           +G+V K+G   +SW+ R++VL   N Q++Y+++      T       KGSF + +IE
Sbjct  7   QGWVFKQGSLVRSWKKRYMVL--KNKQLSYFDTENVTAST-----KAKGSFAVITIE  56

 Score = 32.3 bits (72),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            C G++ K G   K+W+ RF  L G +L  TYY++
Sbjct  137  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDN  168

>SDRG_06288
Length=641

 Score = 35.4 bits (80),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 10/54 (19%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKG  72
            +P  C G + K+G   K+WR R+  +DG + Q++Y ++         E  PPKG
Sbjct  258  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSYSDA---------ETEPPKG  301

 Score = 35.4 bits (80),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 7/55 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79
           G+V K+G   KSW+ RFLV+ G +  V+YY+ R+   P   E    KGS  L  +
Sbjct  7   GFVFKQGSLIKSWKKRFLVVQGRH--VSYYD-RSVHEPDPRE----KGSLVLGDV  54

>PYAR_13429
Length=694

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (61%), Gaps = 5/46 (11%)

Query  33   FRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSS  78
            +RK W+ RF+ L+G  L  +YYE     H TTG A  P+ S ++++
Sbjct  124  WRKKWKPRFVELNGRVL--SYYE---VLHATTGRARAPRQSVHITA  164

>SPRG_08834
Length=825

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 32/59 (54%), Gaps = 13/59 (22%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASP---PKGSFYLSSIE  80
            G++ K+G   K+W+ RF+VL   +L   Y+E        T + +P   PKGSF +  IE
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLH--YFE--------TDKLTPTLKPKGSFQVLVIE  176

>PHYSO_529931
Length=2211

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 5/58 (9%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQ--VTYYESRAACHPTTGEASPPKGSFYLSSI  79
             EGY+ KRGH   S R R+ VL G+ L   VT+ +S+   +P  G  + P G+F +  +
Sbjct  989   EGYLMKRGHKIPSMRKRYCVLVGNELSYFVTHDDSK---NPGGGATTNPLGNFRVEVV  1043

>H257_03095
Length=1086

 Score = 35.8 bits (81),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 38/143 (27%), Positives = 57/143 (40%), Gaps = 36/143 (25%)

Query  2    NILRVPEVG----AATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            N +  P  G    AATSG        EG V K+G +   W  R+LVLDG+ L+  YY   
Sbjct  92   NFVMAPTSGRMGIAATSG-GMHAVHWEGQVRKKGDWLPRWESRYLVLDGTVLR--YYSK-  147

Query  58   AACHPTTGEASPPKGSFYLSSIEP-------HEYVVGVMGAAGKPFGFKMVGHAPKKGYV  110
               H         +G   L+ + P       H +VV  +G               K  Y+
Sbjct  148  ---HEDARMGKNLRGKMTLTHVSPEFHKKKEHTFVVETVGR--------------KVFYM  190

Query  111  ELDVFVETVGDRNKWLEVARNAL  133
              D  +E    ++ W+E+ + A+
Sbjct  191  SCDTELE----KDMWVEMMQAAI  209

>CCA19033
Length=1883

 Score = 35.8 bits (81),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 38/143 (27%), Positives = 58/143 (41%), Gaps = 29/143 (20%)

Query  9    VGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEAS  68
            V A T G +AR    EGY+TK+ H     + R+ VL G+ L          C+ T  E  
Sbjct  93   VYAETLGLEARLAIMEGYLTKKSHRFAQMQRRYCVLKGTML---------LCYLTQDE--  141

Query  69   PPKGSFYLSSIEPHEY--VVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRN--K  124
                  Y S I P +   VV V       F  + +G    + Y     F     D N  K
Sbjct  142  ------YKSHIVPRKVLEVVDVHDRGHSSFEVEQLG---GRTY-----FCTCTSDSNQAK  187

Query  125  WLEVARNALSAKRQLTRQAIDQS  147
            W+   + AL    ++ ++ I+++
Sbjct  188  WMNAMKEALEEPDRIAQEEIEEA  210

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
             EGY+ KRGH   S R R+ VL   N  + Y+E++
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETK  1054

>CCA27255
Length=1125

 Score = 35.4 bits (80),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 33/68 (49%), Gaps = 3/68 (4%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL--SSIEPH  82
            GY+ K+G +R++W+ RF +L        YY+S+   H   G     K +  L  +S E  
Sbjct  167  GYLLKQGSWRRNWKSRFFMLRQDYPSFCYYKSQHKLH-LLGHVRITKDTIVLQRTSSESG  225

Query  83   EYVVGVMG  90
            +Y   V G
Sbjct  226  KYYFQVRG  233

>CCA15513
Length=1341

 Score = 35.4 bits (80),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (45%), Gaps = 27/114 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPH  82
            G+++K+GH  K WR RF VL  DG+   + YY  R             KG      I+ +
Sbjct  86   GWLSKQGHLWKGWRSRFFVLYADGT---LAYYRRRGNV--------KMKG-----YIKLN  129

Query  83   EYVVGV----MGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNA  132
            E ++G+    +    + + F++     +KG+  L    +T  +   W+   R+A
Sbjct  130  EGIIGIQYIDVWKTSRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVNHLRSA  178

>SDRG_14070
Length=630

 Score = 35.4 bits (80),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (54%), Gaps = 3/54 (6%)

Query  3   ILRVPEVGAATSGDKARP-TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYE  55
           +L   E  A+  G K +      G + KRGH RK+W  RF VL  ++L+  YY+
Sbjct  5   VLHPQESSASMGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

>CCI10928
Length=1530

 Score = 35.4 bits (80),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 2/72 (3%)

Query  8    EVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEA  67
            E   A +  K    +  GY+ KRG   KS+R R++ L G+ L  +YY+ + +        
Sbjct  285  ETEGAKACQKGTEVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKSREENK  342

Query  68   SPPKGSFYLSSI  79
            +  +GS +L S+
Sbjct  343  TYLRGSIHLESV  354

>SPRG_09211
Length=549

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 22/118 (19%)

Query  37   WRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
            W+ R+ VL  S L + YYES  A      E S  KG     S+  H++        GKP 
Sbjct  34   WKRRYCVLQESALAIFYYESEEA----AAEGS-LKGKIPYCSV--HDW-------DGKPH  79

Query  97   GFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKN  154
            GF+      K       V+ ++  +RNKW+     ++ A+     +  D  ++P  +N
Sbjct  80   GFQFYTPTNKC----FRVYCDSDDERNKWM----TSMQAQLDNAPEVADGELAPYARN  129

>H310_06667
Length=896

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPT  63
           EGY+ K+G   K W+ R+ V DG +L  +Y+ ++A   P+
Sbjct  37  EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKADKTPS  74

>SPRG_08217
Length=687

 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+NL+  YY+ R       G+ + P+G++ L+
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDPA-PRGAYVLT  46

>SDRG_04871
Length=687

 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+NL+  YY+ R       G+ + P+G++ L+
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDPA-PRGAYVLT  46

>PHYRA_78425
Length=1532

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (47%), Gaps = 4/60 (7%)

Query  52   TYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVE  111
            +++E  A CH    E + P  S  LS+  P E     + AA   FG+K V   P K  VE
Sbjct  572  SFFEHLAVCHTVMPEKA-PDNSLRLSASSPDE---QALVAAAACFGYKFVARGPGKAMVE  627

>PHYKE_9146
Length=557

 Score = 35.0 bits (79),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 52/123 (42%), Gaps = 20/123 (16%)

Query  12   ATSGDKARPTSCEGYVTKR-GHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPP  70
            AT+ DK R     G + K+  H    W+ R+ V+    LQ+TY+ S         E    
Sbjct  17   ATAVDK-REILIAGVLYKKPEHNSLLWKKRYCVVYKDELQITYFLSLEDF-----EKRSI  70

Query  71   KGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVAR  130
            +G    SS+   +         GKP GF+   + P        V+ ET  D+ KWLEV +
Sbjct  71   RGKIPFSSVHAWD---------GKPNGFQF--YTPSN--TCFRVYTETAEDQLKWLEVMQ  117

Query  131  NAL  133
              L
Sbjct  118  KVL  120

>PHYKE_38
Length=227

 Score = 34.7 bits (78),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 50/117 (43%), Gaps = 27/117 (23%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYY-ESRAACHPTTGEAS-----PPKGSFYLSS  78
            G++ KRG   K+W+ RF +L+G  L  TYY +         G  +     P +G   ++ 
Sbjct  16   GWLWKRGQSFKTWKKRFFLLNGCAL--TYYTQCCVIASDVLGGGTQCMDLPVRGGLRVAK  73

Query  79   IEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGD---RNKWLEVARNA  132
             E  +            FG K+  ++ +  YV+        GD   R +WL+V + A
Sbjct  74   AELSDMT---------SFGLKITSYSGRVLYVQ-------AGDQDSRMQWLKVLKEA  114

>SDRG_07086
Length=656

 Score = 35.4 bits (80),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 32/135 (24%), Positives = 52/135 (39%), Gaps = 15/135 (11%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIE  80
            T  EGY+ KR  + K W   + VL G  L        A   P   +     G+F  +S  
Sbjct  33   TRWEGYLQKRSDWLKQWEAYYFVLHGCALYCYLSADEAKRQPENSKIK--HGAFSFTSHV  90

Query  81   PHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFV--ETVGDRNKWLEVARNALSAKRQ  138
              ++VV + G     F F+     P        VF+  +T   +  W+ +A   +   R 
Sbjct  91   ILQHVVSIHGHGAFDFIFETSSGKP--------VFLRAKTQAMKTLWMAMAAQGIHDTRI  142

Query  139  LTR---QAIDQSVSP  150
             +R     +D ++ P
Sbjct  143  DSRGRVGLVDTTIRP  157

>H257_01308
Length=897

 Score = 35.4 bits (80),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
           EGY+ K+G   K W+ R+ V DG +L  +YY ++
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTK  55

>PYIR_23372
Length=1415

 Score = 35.4 bits (80),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
            S EGY+ K+    +SW+  + VL+G  +   YYESR
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESR  355

>PYAR_14615
Length=517

 Score = 35.0 bits (79),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESR  57
           EG++ K+G   KSW+ R+ V DG  L  +YY SR
Sbjct  38  EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISR  69

>PHYSO_559234
Length=1544

 Score = 35.0 bits (79),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (47%), Gaps = 4/60 (7%)

Query  52   TYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVE  111
            +++E  A CH    E + P  S  LS+  P E     + AA   FG+K V   P K  VE
Sbjct  587  SFFEHLAVCHTVMPERA-PDNSLRLSASSPDE---QALVAAAACFGYKFVARGPGKAMVE  642

>PHYSO_315255
Length=1301

 Score = 35.0 bits (79),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 34/137 (25%), Positives = 58/137 (42%), Gaps = 21/137 (15%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSS  78
            R  + EGY++K+     SW+  + VL+   L   +YE+R      T       G   L  
Sbjct  221  RDIAFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNTKLI----GRIQLQG  274

Query  79   IEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQ  138
            IE HE +       GKP GF+++       ++       T  ++ +W      A+S   +
Sbjct  275  IE-HEDM-------GKPNGFRVIAEGNHINHLS----SRTAFEKEQWKRAISIAISKAPE  322

Query  139  LTRQAI---DQSVSPNK  152
            +TR  +    Q + P+K
Sbjct  323  VTRPYVAFASQPLEPHK  339

>SDRG_08383
Length=1321

 Score = 35.0 bits (79),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 27/59 (46%), Gaps = 4/59 (7%)

Query  53   YYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVE  111
            ++E  A CH    E S   GS  LS+  P E     + AA   FGFK    AP +  +E
Sbjct  507  FFEHLAVCHTVMPETSA-DGSLRLSASSPDE---QALVAAAACFGFKFFARAPGEAVIE  561

>PYAR_22485
Length=333

 Score = 34.7 bits (78),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 50/120 (42%), Gaps = 24/120 (20%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEAS---PPKGSFY  75
            R  +  G++ K+G   K+W+ RF +L+G+ L  TYY          G      P KG   
Sbjct  72   RGPTIYGWLWKKGSGFKTWKKRFFLLNGATL--TYYTQACVVDTEVGTRCFEMPAKGGLR  129

Query  76   LSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRN---KWLEVARNA  132
            +++ E  +            FG ++   + +  Y++        GDR    KWL V + A
Sbjct  130  VAAAEITDLT---------QFGLRVTSSSGRVLYLQ-------AGDRAARIKWLGVLQEA  173

>H257_08793
Length=1178

 Score = 35.0 bits (79),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (47%), Gaps = 13/113 (12%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHE  83
            EG ++KR  + + W   + V+ G+ L+   + S+ A   T  + SP +G        P  
Sbjct  157  EGVLSKRSEWLRRWEKHYYVMVGTTLK--RFASKEAFMATL-QQSPVEG-----RPPPPS  208

Query  84   YVV-GVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSA  135
            YV+ GV  A G+  GF    H  K     L +   T  +R  W+ +A+ A+++
Sbjct  209  YVIQGVKEAPGRTNGFVFSCHDGKT----LQLTAPTAIERVIWMRLAQEAMAS  257

>PYIW_18911
Length=1196

 Score = 35.0 bits (79),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (46%), Gaps = 14/70 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES--------RAACHPTTGEASPPKGSFYL  76
            GY+ K+G F K+WR R+ +L      ++YY+S          A   TT     P+  F  
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAEELTKLGEIAVDATTAVRPTPREGF--  231

Query  77   SSIEPHEYVV  86
                P ++VV
Sbjct  232  ----PFQFVV  237

>PYU1_G009508
Length=328

 Score = 34.7 bits (78),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56
            GY+ K+G + K+WR R+ +L      ++YY+S
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  197

>HYAP_11712
Length=558

 Score = 34.7 bits (78),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 37/97 (38%), Gaps = 18/97 (19%)

Query  37   WRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
            W+ R+ V+  + LQ+ Y+ S       T     P  S              V    GKP 
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERRTIRGKIPFSS--------------VHAWDGKPN  87

Query  97   GFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL  133
            GF+    A         V+ ET  D+ KWLEV +  +
Sbjct  88   GFQFYTPADHC----FRVYTETAADQLKWLEVMQKCI  120

Lambda      K        H        a         alpha
   0.314    0.129    0.367    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22974963336

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40