Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_5561601475364963834310.0
PITG_184521475385664229590.0
PHYKE_83911475377864429050.0
PHALS_064811475364462126200.0
HYAP_070951475361360225800.0
PHYSO_3489011475352648824890.0
PHYRA_508551475348948024460.0
PYAP_177619907562263423860.0
PYIR_134521475364564523600.0
PYIW_199721475360964522070.0
PYAR_135699907549448320270.0
PYVX_181701475351056120020.0
H310_085901475364065519980.0
H257_084361475364263219810.0
SPRG_141031475362864418360.0
SDRG_167201475362864418310.0
SPRG_0407412408750950010754e-139
SDRG_1440812408752850210765e-139
PYAP_21882109045024976722e-79
PHALS_08068109044974876652e-78
PYAR_17512109045335106646e-78
PYIR_17506109045094866487e-76
PHYSO_254571109044895076423e-75
PPTG_09787114284934816416e-75
SDRG_038221356704944766391e-74
SDRG_150451241574944766338e-74
PPTG_18033109045004996348e-74
PHYCA_504517114284934816321e-73
SDRG_03823114284974806312e-73
SDRG_111311368074944766285e-73
PITG_14083114284934816267e-73
PHYKE_103271090612004976588e-73
PYAP_234351008029514906519e-73
PHYSO_550665114284914816224e-72
PYIW_25301109045124856234e-72
SPRG_11769109044534766168e-72
PHYRA_72037114284934816162e-71
H257_09722114285184886165e-71
SDRG_12187109044624776115e-71
PHYRA_71927109044854946083e-70
SPRG_05609114284964796066e-70
CCA23647114284964706067e-70
H310_144471462305014896006e-69
CCI11048114284964745989e-69
PHALS_09136114284934815953e-68
H257_170371462304984845902e-67
HYAP_08763114284734655838e-67
PHYKE_6836114284934815804e-66
PITG_13427109044634755784e-66
PHYCA_7619109044624755722e-65
H310_11259114285194955762e-65
PYVX_21517109044825075331e-59
HYAP_04843109044304185003e-55
PYIR_23431114284684624962e-54
PYAR_177141008024444824863e-53
PYVX_16175114284464814487e-48
PYIR_20273124015055033874e-39
PYAP_226451707615654913932e-38
CCI10477124014944823803e-38
CCA22989124014944833752e-37
HYAP_12621124015014833558e-35
PYU1_G014259109042442453362e-34
PYVX_21248124015024973424e-33
SPRG_199431356703432763326e-33
PYU1_G001737147531331173052e-31
PHYCA_123621124014954963177e-30
PHYSO_556052124015004833178e-30
PHALS_09942124014964673161e-29
PHYKE_9680124014984403132e-29
PITG_15359124014965073133e-29
PHYRA_72215124014994413106e-29
SPRG_09825124014924973098e-29
SDRG_06945124014924973025e-28
PYAR_20075170764694842921e-26
H257_01186151564964832902e-26
PYAR_16840151565365102886e-26
PHYRA_7388315665515152886e-26
H310_00561151564974842771e-24
CCI50816151568074882801e-24
PHYCA_50444515665485152762e-24
PHYRA_47253151564814952742e-24
PYAP_19280151565124942752e-24
CCA16670151565204892752e-24
PPTG_0093815665505492734e-24
PYVX_20512151565285002716e-24
PYU1_G011605151565244942709e-24
PPTG_09121151565204982682e-23
PHALS_1202815665795262664e-23
SDRG_14446151564954822627e-23
PITG_18935150674805052582e-22
PHALS_10055151565164952573e-22
H310_02523124014944732564e-22
PYIW_19795151565194922548e-22
PYIW_251901648732061862372e-21
PYIR_1413215665135162512e-21
H257_16541124014944912502e-21
PHYCA_555180151565215152503e-21
H310_0764115665485172478e-21
HYAP_0414915665645242478e-21
PYIW_24688114282592812359e-21
PYIW_2025715665035072459e-21
PYU1_G00569915665505142442e-20
PHYSO_48941815664714732403e-20
SPRG_1205415665585642423e-20
PYVX_2349915665195392404e-20
SDRG_0506015665595602405e-20
PPTG_13000124013873452358e-20
PHYKE_2864151564864942361e-19
PHYKE_980715665575342371e-19
PYAP_1914815665355232352e-19
CCI3999315665505352291e-18
H257_0745015665673692246e-18
CCA1403015665605192211e-17
PITG_0177815664704732163e-17
PYAR_1666415665774192157e-17
PYIR_21896151565185022004e-15
PITG_19065151564163381984e-15
PHYSO_562795151564153311976e-15
HYAP_08069650262552191783e-13
SPRG_04114151563763711807e-13
PPTG_247122910367661292e-08
PITG_19802156311851651345e-08
HYAP_13613151564232371254e-06
PYIW_27568124011281201051e-04
SPRG_0423112415790521002e-04
HYAP_080686502510070930.003
SPRG_17626132408148120950.004
SPRG_186431333348563900.006
CCI409892416552136910.066
PYU1_G014369634703100870.19
PHYSO_507629634703100870.20
PHYCA_524942105671028168850.31
PYU1_G000378105671070221820.80
PHALS_10960634702164801.2
PYAP_15943241513930751.6
PYU1_G004385241656239791.7
PYAP_17256634705168791.7
PPTG_08060634725100791.7
HYAP_03065634701117782.1
CCI1094815900828893762.4
PITG_0070363470359772.8
PHYSO_317690105671057159773.0
PHYRA_7219663469159773.0
PHYRA_873287361948659763.3
PITG_2104616443319103754.2
PYVX_224912742164076754.9
PITG_02760241516530716.0
PHYSO_487184929528348736.6
SDRG_0650112817662335746.7
SPRG_1164112817662335737.4
PYVX_18330241655830738.3
SPRG_08354241655071738.3
CCI50227539470775738.5
PHALS_1230816870526107729.6
PHYRA_76113297376480739.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_556160

Length=649
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_556160                                                          1326       0.0   
PITG_18452                                                            1144       0.0   
PHYKE_8391                                                            1123       0.0   
PHALS_06481                                                           1013       0.0   
HYAP_07095                                                            998        0.0   
PHYSO_348901                                                          963        0.0   
PHYRA_50855                                                           946        0.0   
PYAP_17761                                                            923        0.0   
PYIR_13452                                                            913        0.0   
PYIW_19972                                                            854        0.0   
PYAR_13569                                                            785        0.0   
PYVX_18170                                                            775        0.0   
H310_08590                                                            774        0.0   
H257_08436                                                            767        0.0   
SPRG_14103                                                            711        0.0   
SDRG_16720                                                            709        0.0   
SPRG_04074                                                            418        4e-139
SDRG_14408                                                            419        5e-139
PYAP_21882                                                            263        2e-79 
PHALS_08068                                                           260        2e-78 
PYAR_17512                                                            260        6e-78 
PYIR_17506                                                            254        7e-76 
PHYSO_254571                                                          251        3e-75 
PPTG_09787                                                            251        6e-75 
SDRG_03822                                                            250        1e-74 
SDRG_15045                                                            248        8e-74 
PPTG_18033                                                            248        8e-74 
PHYCA_504517                                                          248        1e-73 
SDRG_03823                                                            247        2e-73 
SDRG_11131                                                            246        5e-73 
PITG_14083                                                            245        7e-73 
PHYKE_10327                                                           258        8e-73 
PYAP_23435                                                            255        9e-73 
PHYSO_550665                                                          244        4e-72 
PYIW_25301                                                            244        4e-72 
SPRG_11769                                                            241        8e-72 
PHYRA_72037                                                           241        2e-71 
H257_09722                                                            241        5e-71 
SDRG_12187                                                            239        5e-71 
PHYRA_71927                                                           238        3e-70 
SPRG_05609                                                            238        6e-70 
CCA23647                                                              238        7e-70 
H310_14447                                                            235        6e-69 
CCI11048                                                              234        9e-69 
PHALS_09136                                                           233        3e-68 
H257_17037                                                            231        2e-67 
HYAP_08763                                                            229        8e-67 
PHYKE_6836                                                            228        4e-66 
PITG_13427                                                            227        4e-66 
PHYCA_7619                                                            224        2e-65 
H310_11259                                                            226        2e-65 
PYVX_21517                                                            209        1e-59 
HYAP_04843                                                            197        3e-55 
PYIR_23431                                                            195        2e-54 
PYAR_17714                                                            191        3e-53 
PYVX_16175                                                            177        7e-48 
PYIR_20273                                                            153        4e-39 
PYAP_22645                                                            155        2e-38 
CCI10477                                                              150        3e-38 
CCA22989                                                              149        2e-37 
HYAP_12621                                                            141        8e-35 
PYU1_G014259                                                          134        2e-34 
PYVX_21248                                                            136        4e-33 
SPRG_19943                                                            132        6e-33 
PYU1_G001737                                                          122        2e-31 
PHYCA_123621                                                          126        7e-30 
PHYSO_556052                                                          126        8e-30 
PHALS_09942                                                           126        1e-29 
PHYKE_9680                                                            125        2e-29 
PITG_15359                                                            125        3e-29 
PHYRA_72215                                                           124        6e-29 
SPRG_09825                                                            123        8e-29 
SDRG_06945                                                            120        5e-28 
PYAR_20075                                                            117        1e-26 
H257_01186                                                            116        2e-26 
PYAR_16840                                                            115        6e-26 
PHYRA_73883                                                           115        6e-26 
H310_00561                                                            111        1e-24 
CCI50816                                                              112        1e-24 
PHYCA_504445                                                          110        2e-24 
PHYRA_47253                                                           110        2e-24 
PYAP_19280                                                            110        2e-24 
CCA16670                                                              110        2e-24 
PPTG_00938                                                            109        4e-24 
PYVX_20512                                                            108        6e-24 
PYU1_G011605                                                          108        9e-24 
PPTG_09121                                                            107        2e-23 
PHALS_12028                                                           107        4e-23 
SDRG_14446                                                            105        7e-23 
PITG_18935                                                            103        2e-22 
PHALS_10055                                                           103        3e-22 
H310_02523                                                            103        4e-22 
PYIW_19795                                                            102        8e-22 
PYIW_25190                                                            95.9       2e-21 
PYIR_14132                                                            101        2e-21 
H257_16541                                                            100        2e-21 
PHYCA_555180                                                          100        3e-21 
H310_07641                                                            99.8       8e-21 
HYAP_04149                                                            99.8       8e-21 
PYIW_24688                                                            95.1       9e-21 
PYIW_20257                                                            99.0       9e-21 
PYU1_G005699                                                          98.6       2e-20 
PHYSO_489418                                                          97.1       3e-20 
SPRG_12054                                                            97.8       3e-20 
PYVX_23499                                                            97.1       4e-20 
SDRG_05060                                                            97.1       5e-20 
PPTG_13000                                                            95.1       8e-20 
PHYKE_2864                                                            95.5       1e-19 
PHYKE_9807                                                            95.9       1e-19 
PYAP_19148                                                            95.1       2e-19 
CCI39993                                                              92.8       1e-18 
H257_07450                                                            90.9       6e-18 
CCA14030                                                              89.7       1e-17 
PITG_01778                                                            87.8       3e-17 
PYAR_16664                                                            87.4       7e-17 
PYIR_21896                                                            81.6       4e-15 
PITG_19065                                                            80.9       4e-15 
PHYSO_562795                                                          80.5       6e-15 
HYAP_08069                                                            73.2       3e-13 
SPRG_04114                                                            73.9       7e-13 
PPTG_24712                                                            54.3       2e-08 
PITG_19802                                                            56.2       5e-08 
HYAP_13613                                                            52.8       4e-06 
PYIW_27568                                                            45.1       1e-04 
SPRG_04231                                                            43.1       2e-04 
HYAP_08068                                                            40.4       0.003 
SPRG_17626                                                            41.2       0.004 
SPRG_18643                                                            39.3       0.006 
CCI40989                                                              39.7       0.066 
PYU1_G014369                                                          38.1       0.19  
PHYSO_507629                                                          38.1       0.20  
PHYCA_524942                                                          37.4       0.31  
PYU1_G000378                                                          36.2       0.80  
PHALS_10960                                                           35.4       1.2   
PYAP_15943                                                            33.5       1.6   
PYU1_G004385                                                          35.0       1.7   
PYAP_17256                                                            35.0       1.7   
PPTG_08060                                                            35.0       1.7   
HYAP_03065                                                            34.7       2.1   
CCI10948                                                              33.9       2.4   
PITG_00703                                                            34.3       2.8   
PHYSO_317690                                                          34.3       3.0   
PHYRA_72196                                                           34.3       3.0   
PHYRA_87328                                                           33.9       3.3   
PITG_21046                                                            33.5       4.2   
PYVX_22491                                                            33.5       4.9   
PITG_02760                                                            32.0       6.0   
PHYSO_487184                                                          32.7       6.6   
SDRG_06501                                                            33.1       6.7   
SPRG_11641                                                            32.7       7.4   
PYVX_18330                                                            32.7       8.3   
SPRG_08354                                                            32.7       8.3   
CCI50227                                                              32.7       8.5   
PHALS_12308                                                           32.3       9.6   
PHYRA_76113                                                           32.7       9.7   

>PHYCA_556160
Length=649

 Score = 1326 bits (3431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/638 (100%), Positives = 638/638 (100%), Gaps = 0/638 (0%)

Query  1    MASGVRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFED  60
            MASGVRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFED
Sbjct  1    MASGVRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFED  60

Query  61   REAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVG  120
            REAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVG
Sbjct  61   REAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVG  120

Query  121  NPQGATPNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEA  180
            NPQGATPNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEA
Sbjct  121  NPQGATPNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEA  180

Query  181  ASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNL  240
            ASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNL
Sbjct  181  ASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNL  240

Query  241  SSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPR  300
            SSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPR
Sbjct  241  SSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPR  300

Query  301  KGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECA  360
            KGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECA
Sbjct  301  KGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECA  360

Query  361  GFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLL  420
            GFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLL
Sbjct  361  GFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLL  420

Query  421  VKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIY  480
            VKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIY
Sbjct  421  VKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIY  480

Query  481  AIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSK  540
            AIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSK
Sbjct  481  AIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSK  540

Query  541  ERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEV  600
            ERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEV
Sbjct  541  ERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEV  600

Query  601  TQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  638
            TQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK
Sbjct  601  TQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  638

>PITG_18452
Length=856

 Score = 1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/642 (85%), Positives = 588/642 (92%), Gaps = 6/642 (1%)

Query  1    MASGVRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFED  60
            MASGV L +TL T+  SSVATF+IAGWK+C SFVKA EVA AMQMLYPDRV FE HPFED
Sbjct  1    MASGVNLGDTLSTALSSSVATFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFED  60

Query  61   REAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVG  120
            R AFK WLS SQD+    FG DS+ATKHVTSPFVWSS  T FVGGCD+LL +FRSG+ VG
Sbjct  61   RNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSS--TIFVGGCDELLAFFRSGIAVG  118

Query  121  NPQGATPN-GSPTEKTA---EADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLAC  176
             PQG  P+   PT  +A   E D  M + + E +STA  EE +YDYDLVVIGGGSGGLAC
Sbjct  119  KPQGVMPSEKQPTPSSALAPETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLAC  178

Query  177  SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANF  236
            SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEV+HHD A+F
Sbjct  179  SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASF  238

Query  237  GWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLEL  296
            GWN+SSG G+AP F+WKQLV+NVDGYI+ INFKYKVELRSKYVKYENFLGSF++PHTLEL
Sbjct  239  GWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLEL  298

Query  297  WHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVA  356
            WHPRKG+KQITTRDVVIAVGGRP+ELT PGGEHAISSDDIFWMK KEPGKTLVVGASYVA
Sbjct  299  WHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVA  358

Query  357  LECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLEN  416
            LECAGFLKGMGYDVKVMVRSILLRGFDQDMA+KIGEYMEVQSGIEFIRKTVPQSITKLEN
Sbjct  359  LECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLEN  418

Query  417  GQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTST  476
            GQLLVKWTSEDGESCEEAFD+VLNATGRDPD+AKL+LDKAGVKLNEK+GRIWVK+EQTST
Sbjct  419  GQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTST  478

Query  477  PNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSE  536
            PNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN+TVQMDY+KVCTAVFTPIEYGCCG+SE
Sbjct  479  PNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSE  538

Query  537  EDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPN  596
            EDS +RFG+D IEVYHTNFVPLEWSLST+TR AAESCY+KVICD+ RDKFVVGFHYLGPN
Sbjct  539  EDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPN  598

Query  597  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  638
            AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK
Sbjct  599  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  640

>PHYKE_8391
Length=778

 Score = 1123 bits (2905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/644 (84%), Positives = 582/644 (90%), Gaps = 3/644 (0%)

Query  7    LAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKH  66
            LAETL T+ +SSV TFHI+GW+TCPSF KAGEVA AMQMLYPD+V+FE H FEDR+AFK 
Sbjct  137  LAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQ  196

Query  67   WLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQGAT  126
            WLS S+D F   FG DSKA  HVTSPFVWSSNP  FVGGCDDLL +FRSGV VG+PQGA 
Sbjct  197  WLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQGAD  256

Query  127  PNGSPTEKTAEADVPMSETSVEETSTADAEE-TNYDYDLVVIGGGSGGLACSKEAASFGQ  185
            P     E  A  +V  S  +V ET     EE T+YDYDLVVIGGGSGGLACSKEAASFGQ
Sbjct  257  P-AEKAEAAASIEVAESSMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQ  315

Query  186  KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDG  245
            KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGE +HHD ANFGWN++SG+G
Sbjct  316  KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEG  375

Query  246  NAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQ  305
               TF+WKQLVSNVD YIKSINFKYKVELRSKYVKYENFLGSF++PHTLELWHPRKGTKQ
Sbjct  376  KGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQ  435

Query  306  ITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKG  365
            ITTR VV+AVGGRPK+LTCPG E+AISSDDIFWMKK  PGKTLVVGASYVALECAGFLKG
Sbjct  436  ITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKG  495

Query  366  MGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTS  425
            MGYDVKVMVRSILLRGFDQDMA+KIGEYMEVQ+GIEFIRKTVP+SITKLENGQLLVKWT+
Sbjct  496  MGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTT  555

Query  426  EDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDV  485
            ED ESCEE FDTVLNATGRDPDVAKL LDKAGVKLNEK+GRIW KNEQTSTPNI+AIGDV
Sbjct  556  EDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDV  615

Query  486  IDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGE  545
            IDAPELTPVAIQAGR LSRRLYNNSTVQMDY+KVCTAVFTPIEYGCCG+SEEDS ERFGE
Sbjct  616  IDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGE  675

Query  546  DNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMG  605
            DN+EVYH NFVPLEWSLS ++RT++ESCY+KVICD TRDKFVVGFHYLGPNAGEVTQAMG
Sbjct  676  DNVEVYHKNFVPLEWSLS-ESRTSSESCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMG  734

Query  606  LAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKssggattgggC  649
            LAMKLGFTYDQMVDTVGIHPTTAE+FTTLEVTKSSG  TTGGGC
Sbjct  735  LAMKLGFTYDQMVDTVGIHPTTAEAFTTLEVTKSSGATTTGGGC  778

>PHALS_06481
Length=644

 Score = 1013 bits (2620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/621 (77%), Positives = 543/621 (87%), Gaps = 15/621 (2%)

Query  18   SVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKHWLSESQDEFAT  77
            ++ATF++AGWKTCPSF+KA E+  AMQMLYPDR+ F++  FEDRE F+ WL  SQ +FA 
Sbjct  28   TLATFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAV  87

Query  78   SFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQGATPNGSPTEKTAE  137
            SFG  SKA KHVTSPFVWSSNPT FVGGCDDLL +FRSG+ VG PQG             
Sbjct  88   SFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQG-------------  134

Query  138  ADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSP  197
              +  S+   E +STA  E+  +DYDLVVIGGG GGLACSKEAASFGQKVCVLDYVKPSP
Sbjct  135  --MHTSDEVAEISSTAVQEKPIFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSP  192

Query  198  QGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVS  257
            QGT+WGLGGTCVNVGCIPKKL+HQSSLIGE+I HD A FGW   +     P F+WKQLV+
Sbjct  193  QGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVA  252

Query  258  NVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGG  317
            NVDGYIK+INFKYKV+LRSK VKYENFLGSFV+PHT++L HPRKGTKQITTR+VVIAVG 
Sbjct  253  NVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGS  312

Query  318  RPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  377
            RP+ELTCPGGE+A+SSDDIFWMK+KEPGKTLV+GASYVALECAGFLKGMGY+VKVMVRSI
Sbjct  313  RPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI  372

Query  378  LLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDT  437
            LLR FDQ+MADKIGEYMEVQSGI+FIRKTVPQSI++LEN QLLVKW  E G++CEEAF+T
Sbjct  373  LLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNT  432

Query  438  VLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQ  497
            VLNATGRDP+VA L LDKAGVKLNEK+GRI VKNEQTST NIYAIGDV+DAPELTPVAIQ
Sbjct  433  VLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQ  492

Query  498  AGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVP  557
            +GRLLS+RLYNNS+VQMDY+KVCT VFTPIEYGCCG+SEE SK R+GEDNIE+YHTNFVP
Sbjct  493  SGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVP  552

Query  558  LEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617
            LEWSLS++TRTA+ SCY+KV+CDK+RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQM
Sbjct  553  LEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQM  612

Query  618  VDTVGIHPTTAESFTTLEVTK  638
            V+TVGIHP TAES T LEVTK
Sbjct  613  VNTVGIHPMTAESLTILEVTK  633

>HYAP_07095
Length=613

 Score = 998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/602 (79%), Positives = 527/602 (88%), Gaps = 6/602 (1%)

Query  43   MQMLYPDRVTFELHPFEDREAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAF  102
            M ++YP RV FE H FEDR+AFK WLS S ++F T FG+DSKAT HVTSPFVW SNPT F
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60

Query  103  VGGCDDLLTYFRSGVGVGNPQGATP---NGSPTEKTAEADVPMSETSVEETSTADA---E  156
            VGGCDDLL  FRSG+ VGN Q       +G   + TA  D   S + + E+ T      +
Sbjct  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120

Query  157  ETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  216
            + +YDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180

Query  217  KLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRS  276
            KLMHQSSLIGE++HHD A+FGWN+ S +G  PTF+WKQLVSNV  YIKSI+FKYKVELRS
Sbjct  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRS  240

Query  277  KYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  336
            K VKYEN LGSFV+PHTL+LWHP+KGTK+ITTR VVIAVGGRP++L C GGE A+SSDDI
Sbjct  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300

Query  337  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEV  396
            FWMK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA KIGEYME+
Sbjct  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360

Query  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
            QSGIEFIRKTVPQSITKL++GQLLVKW +EDG+  EE FDTVLNATGRDPDVAKL LD+A
Sbjct  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420

Query  457  GVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDY  516
            GVKLNEK+GRIWV NEQT+TPN+YAIGDVIDAPELTPVAIQAGRLLSRRLYN  TVQMDY
Sbjct  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480

Query  517  EKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLK  576
            +K+CTAVFTPIEYGCCG+SEEDSKE +G+D++EVYH NFVPLEWSL+  TR AAESCY+K
Sbjct  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540

Query  577  VICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEV  636
            V+CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHPTTAE+FTTLE 
Sbjct  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFTTLET  600

Query  637  TK  638
            TK
Sbjct  601  TK  602

>PHYSO_348901
Length=526

 Score = 963 bits (2489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/488 (93%), Positives = 474/488 (97%), Gaps = 0/488 (0%)

Query  151  STADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  210
            S  D  ET+YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN
Sbjct  28   SAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  87

Query  211  VGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKY  270
            VGCIPKKLMHQSSLIGE++HHD ANFGWN++S DG+A TF+WKQLV+NVDGYI+ INFKY
Sbjct  88   VGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKY  147

Query  271  KVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  330
            KVELRSKYVKYENFLGSFV+ HTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA
Sbjct  148  KVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  207

Query  331  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKI  390
            ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMA+KI
Sbjct  208  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKI  267

Query  391  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAK  450
            GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT+EDGESCEEAFDTVLNATGRDPDVAK
Sbjct  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327

Query  451  LNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  510
            L LDKA VKLNEK+GRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS
Sbjct  328  LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387

Query  511  TVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAA  570
            T QMDY+K+CTAVFTPIEYGCCG+SEEDSKER+GEDNIEVYH NFVPLEWSLS +TRTAA
Sbjct  388  TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447

Query  571  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAES  630
            ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE+
Sbjct  448  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAET  507

Query  631  FTTLEVTK  638
            FTTLE+TK
Sbjct  508  FTTLEITK  515

>PHYRA_50855
Length=489

 Score = 946 bits (2446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/480 (94%), Positives = 471/480 (98%), Gaps = 2/480 (0%)

Query  159  NYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  218
            +YDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL
Sbjct  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60

Query  219  MHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKY  278
            MHQSSLIGEV+HHD ANFGWN++S +G+APTFNWKQLVSNVD YIKSINFKYKVELRSKY
Sbjct  61   MHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119

Query  279  VKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFW  338
            VKYENFLGSFV+PHTLELWH RKGTKQITTRDVVIAVGGRPKEL+CPGGEHAISSDDIFW
Sbjct  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179

Query  339  MKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQS  398
            MKKKEPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFDQDMA+KIGEYMEVQS
Sbjct  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239

Query  399  GIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGV  458
            GIEFIRKTVPQSIT LENGQLLVKWT+EDGESCEEAFDTVLNATGRDPDVAKL LDKAGV
Sbjct  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299

Query  459  KLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEK  518
            KLNEKSGRIWVKNEQTST NIYA+GDVIDAPELTPVAIQAGRLLSRRLYNNST QMDYEK
Sbjct  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359

Query  519  VCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI  578
            VCTAVFTPIEYGCCG+SEEDSKERFGEDN+EVYHTNFVPLEWSLS +TRT+AESCY+KVI
Sbjct  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLS-ETRTSAESCYVKVI  418

Query  579  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  638
            CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK
Sbjct  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478

>PYAP_17761
Length=622

 Score = 923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/634 (71%), Positives = 517/634 (82%), Gaps = 26/634 (4%)

Query  5    VRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAF  64
            V   +++V     + AT+++AGW TCP + KA +VA AMQ+LY D V  E   FE R+AF
Sbjct  4    VDFPQSVVPPASGAPATYYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESRDAF  63

Query  65   KHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQG  124
            K WL+ES   FA +FG DS A  H +SPFVWS N   F+GGCD  L +FRSGV      G
Sbjct  64   KAWLAESNAAFAQAFGTDSPALTHTSSPFVWS-NARGFIGGCDATLAHFRSGVAARPLAG  122

Query  125  ATPNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFG  184
              P+ SPT         M+  +V+E+ T       YDYDLVVIGGGSGGLACSKEAA +G
Sbjct  123  --PSASPT---------MTPVAVDESKT-------YDYDLVVIGGGSGGLACSKEAAKYG  164

Query  185  QKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGD  244
            +KVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKLMHQS+LIGE++H D   FGWN+    
Sbjct  165  KKVCVLDYVKPSPLGTTWGLGGTCVNVGCIPKKLMHQSALIGELMHKDAGAFGWNMGE--  222

Query  245  GNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTK  304
                 F W QLV +V+ YIK INFKYKVELR K VKYENFLGSFV+PHT+ELWH +KGTK
Sbjct  223  ---QKFTWTQLVESVNNYIKGINFKYKVELRDKKVKYENFLGSFVDPHTIELWHHKKGTK  279

Query  305  QITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLK  364
             ITTR VV+AVGGRP++L+CPGGEHAISSDDIFW +K EPGKTLVVGASYVALECAGFLK
Sbjct  280  TITTRHVVVAVGGRPRQLSCPGGEHAISSDDIFW-RKTEPGKTLVVGASYVALECAGFLK  338

Query  365  GMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT  424
            GMGY+VKVMVRSILLRGFD+DMA++IG++M+ +S IEFIR  VP+SI KLENGQLLVKW 
Sbjct  339  GMGYEVKVMVRSILLRGFDEDMANRIGDFMQDESKIEFIRGAVPKSIEKLENGQLLVKWN  398

Query  425  SEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGD  484
            S DGE+ EE FD+VLNATGRDPDV+KLNLDKAGV+LN K+GRI V NEQTSTPN++AIGD
Sbjct  399  SADGETVEEVFDSVLNATGRDPDVSKLNLDKAGVQLNPKTGRIAVTNEQTSTPNVFAIGD  458

Query  485  VIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFG  544
            VIDAPELTPVAIQAGRLL+RRLYNN T  MDY+KVCTAVFTPIEYGCCG+SEE +K+++G
Sbjct  459  VIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKVCTAVFTPIEYGCCGLSEEAAKDKYG  518

Query  545  EDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAM  604
            EDN+E+YH +F+PLEWSLS D R AA +CY+KVICDKTRDK+VVGFHYLGPNAGEVTQAM
Sbjct  519  EDNLEIYHQSFMPLEWSLSQD-RVAANTCYVKVICDKTRDKYVVGFHYLGPNAGEVTQAM  577

Query  605  GLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  638
            GLAMK+GFTYDQMV+ VGIHPTTAE FTTLEVTK
Sbjct  578  GLAMKIGFTYDQMVNVVGIHPTTAEVFTTLEVTK  611

>PYIR_13452
Length=645

 Score = 913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/645 (71%), Positives = 515/645 (80%), Gaps = 30/645 (5%)

Query  7    LAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKH  66
            + ETLV   +     +H+AGW+ C  + KA +V TAM++LYPD V FELH F DREAF+ 
Sbjct  29   IKETLVH--EGGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFRE  86

Query  67   WLSESQ--DEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQG  124
            WL+ S   +E    FG DSKA  H +SPFVW+ N   F+GGCDD L  FRSGV       
Sbjct  87   WLAASSTIEELTECFGADSKALTHKSSPFVWA-NTRGFIGGCDDTLALFRSGVSAPATLA  145

Query  125  ATPNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFG  184
            ATP                  ++   + A A++  YDYDL+VIGGGSGGLACSKEA+ +G
Sbjct  146  ATP------------------TMVAAAPAPADDAKYDYDLIVIGGGSGGLACSKEASKYG  187

Query  185  QKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGD  244
            +KVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKLMHQSSLIGE IH D   FGW +    
Sbjct  188  KKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGE--  245

Query  245  GNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTK  304
                TF+W Q++ +V+ YIKSINFKYKVELR K VKYEN LGSFV+ HTLELWHP+KGTK
Sbjct  246  ---QTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTK  302

Query  305  QITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLK  364
             +TTRDVVIAVGGRPK L+C GG+ AISSDDIFW +K+ PGKTLVVGASYVALECAGF+K
Sbjct  303  TVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW-RKEAPGKTLVVGASYVALECAGFMK  361

Query  365  GMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT  424
            GMGYDVK+MVRSILLRGFDQDMA+KIGE+ME +S IEFIR  VPQSITKLE+GQLLVKW 
Sbjct  362  GMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWV  421

Query  425  SEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGD  484
            S DGE+CEEAFDTVLNATGRDPDVAKL LDK GVKLN K+GRI V NEQTSTPNIYAIGD
Sbjct  422  SADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGD  481

Query  485  VIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFG  544
            VIDAPELTPVAIQAGRLL+RRLYNN T  MDY+KVCTAVFTPIEYGCCG+SEE S E++G
Sbjct  482  VIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYG  541

Query  545  EDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAM  604
            E+N+E+YH NF PLEWSLS+D R AA SCY+KVICD  R+K VVGFHYLGPNAGEVTQA+
Sbjct  542  EENLEIYHQNFTPLEWSLSSD-REAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAI  600

Query  605  GLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKssggattgggC  649
            GLAMKLGFTYDQMV+ VGIHPTTAE FTTLEVTKSSG +   GGC
Sbjct  601  GLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645

>PYIW_19972
Length=609

 Score = 854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/645 (69%), Positives = 499/645 (77%), Gaps = 53/645 (8%)

Query  5    VRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAF  64
            V + ETLV        T+HIAGW+ C  + KA +V  AM++LYPD V  E+H F DREAF
Sbjct  18   VNIKETLVRG--GGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREAF  75

Query  65   KHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQG  124
            + WLS S  +FA +FG DSKA  H +SPF           G D+                
Sbjct  76   RAWLSASAADFAANFGADSKAATHTSSPFF----------GKDE----------------  109

Query  125  ATPNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFG  184
                 SPT     A V      V++  T       YDYDL+VIGGGSGGLACSKEAA +G
Sbjct  110  -----SPTPTMVAAPV------VDDNVT-------YDYDLIVIGGGSGGLACSKEAAKYG  151

Query  185  QKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGD  244
            +KVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKLMHQSSLIGE IH D A FGW++    
Sbjct  152  KKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGE--  209

Query  245  GNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTK  304
                 F+W Q++ +V+ YIKSINFKYKVELR K VKYEN LGSFV+ HTLELWHP+KGTK
Sbjct  210  ---QKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTK  266

Query  305  QITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLK  364
             +TTRDVVIAVGGRPK L+C GGE AISSDDIFW +K+ PGKTLV+GASYVALECAGF+K
Sbjct  267  TVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW-RKEAPGKTLVIGASYVALECAGFMK  325

Query  365  GMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT  424
            GMGYDVK+MVRSILLRGFDQDMA KIGE+MEV+S IEFIR  VPQSITKLE+GQLLVKW 
Sbjct  326  GMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWV  385

Query  425  SEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGD  484
            S DG+ CEEAFDTVLNATGRDPDVAKLNLD  GV+LN K+GRI V NEQTS PNI+AIGD
Sbjct  386  SSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGD  445

Query  485  VIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFG  544
            VIDAPELTPVAIQAGR+L+RRLYNN T  MDY+KVCTAVFTPIEYGCCG+SEE S E+FG
Sbjct  446  VIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFG  505

Query  545  EDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAM  604
            ED +E+YH NF PLEWSLS+D R AA SCY+KVICD TR+K VVGFHYLGPNAGEVTQA+
Sbjct  506  EDKLEIYHQNFTPLEWSLSSD-RQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAI  564

Query  605  GLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKssggattgggC  649
            GLAMKLGFTYD MV+ VGIHPTTAE FTTLEVTKSSG +   GGC
Sbjct  565  GLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609

>PYAR_13569
Length=494

 Score = 785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/483 (77%), Positives = 421/483 (87%), Gaps = 7/483 (1%)

Query  156  EETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIP  215
            +E  YDYDLVVIGGGSGGLACSKEAA  G+KV VLDYVKPSP GT+WGLGGTCVNVGCIP
Sbjct  8    DEATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVGCIP  67

Query  216  KKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELR  275
            KKLMHQS+L+GE++H D   FGW        A +F W QLV++V+ YIK INFKYKVELR
Sbjct  68   KKLMHQSALLGELMHKDAPAFGWTTG-----AQSFTWTQLVASVNNYIKGINFKYKVELR  122

Query  276  SKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDD  335
             K VKYENFLGSFV+ HT+ELWH +K  K +TTR VVIAVGGRP+ LTCPGGEHAISSDD
Sbjct  123  DKKVKYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISSDD  182

Query  336  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYME  395
            IFW +K EPGKTLVVGASYVALECAGFLKGMGYDVK+MVRSILLRGFDQDMA++IG++M+
Sbjct  183  IFW-RKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDFMQ  241

Query  396  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDK  455
             +S IEFIR  VP+SI K ENG+LLVKW S DG+  EE FDTVLNATGRDPDV KLNLDK
Sbjct  242  DESRIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNLDK  301

Query  456  AGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMD  515
            AGV+LN KSGRI   NEQTSTPNI+AIGDVIDAPELTPVAIQAGRLL+RRLYNN T  MD
Sbjct  302  AGVELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMD  361

Query  516  YEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYL  575
            Y+K+CTAVFTPIEYGCCG+SEED+K ++GE+N+E+YH +F+PLEWSLS + R AA +CY+
Sbjct  362  YDKICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLS-EERVAAATCYV  420

Query  576  KVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLE  635
            KVICDKTRDK VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV+ VGIHPTTAE FTTLE
Sbjct  421  KVICDKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTTLE  480

Query  636  VTK  638
            +TK
Sbjct  481  ITK  483

>PYVX_18170
Length=510

 Score = 775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/561 (71%), Positives = 444/561 (79%), Gaps = 51/561 (9%)

Query  89   VTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQGATPNGSPTEKTAEADVPMSETSVE  148
            ++SPFVW+SNPTAFVGGCD LL  FRS       Q   PN         A  P +   VE
Sbjct  1    MSSPFVWTSNPTAFVGGCDALLDRFRS-------QVPRPNA--------ASKPQANGEVE  45

Query  149  ETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  208
                                           A+ FGQKV VLDYVKPSPQGT WGLGGTC
Sbjct  46   -------------------------------ASKFGQKVLVLDYVKPSPQGTKWGLGGTC  74

Query  209  VNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINF  268
            VNVGCIPKKLMHQS+LIGEV+H D A FGW       NAP F+W QL S+V  YIK++NF
Sbjct  75   VNVGCIPKKLMHQSALIGEVMHKDAALFGWQFE----NAPKFDWSQLASSVSTYIKTLNF  130

Query  269  KYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  328
            KYKV+LR K VKYENFLG+FV+PHT+EL +PRK +K +TTR VV+AVGGRP+ L CPGGE
Sbjct  131  KYKVDLRDKKVKYENFLGAFVDPHTIELSNPRKPSKTVTTRRVVVAVGGRPRLLPCPGGE  190

Query  329  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAD  388
             +I+SDDIFW +K  PGKTLVVGASYVALECAGFLKG GYDVKVMVRSILLRGFDQDMA+
Sbjct  191  LSITSDDIFW-RKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMAN  249

Query  389  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDV  448
            +IGEYMEV++GIEFIR+TVP SITKLE+G+LLVKWT  DG + EEAFDTVLNATGR+PDV
Sbjct  250  RIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDV  309

Query  449  AKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  508
             KL LDKAGVKLN K+GRI V NEQTSTPNI+AIGDVIDAPELTPVAIQAGRLL+RRLYN
Sbjct  310  DKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN  369

Query  509  NSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRT  568
            N T  MDYEKVCTAVFTPIEYGCCG+SEE+S ERFGEDNIEVYH NF PLEW+LS DTR 
Sbjct  370  NETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRP  429

Query  569  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  628
            +  +CYLKVICDKTRD FVVGFHYLGPNAGEVTQA+GLAMKLGFTY+QMV  VGIHPTTA
Sbjct  430  SMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPTTA  489

Query  629  ESFTTLEVTKssggattgggC  649
            E+FTTLEVTKSSG +  GG C
Sbjct  490  ETFTTLEVTKSSGASAAGGNC  510

>H310_08590
Length=640

 Score = 774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/655 (60%), Positives = 476/655 (73%), Gaps = 39/655 (6%)

Query  6    RLAETLVTSP-------DSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPF  58
            R+  ++ TSP         S   +H+ GWK CP +VKA  V ++MQ L+P +V   +H  
Sbjct  14   RVTSSVWTSPPLRRQSSKMSTINYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEH  73

Query  59   EDREAFKHWLSESQDEFATSFGVDSKATKHVTSPFVW--SSNPTAFVGGCDDLLTYFRSG  116
             ++E+F +WL+ESQ EFA  F  D++  KH +SPF +    +   FVGGCDD L +FR+ 
Sbjct  74   PNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRA-  132

Query  117  VGVGNPQGATPNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLAC  176
                  Q A   G+P+   A          V +TS++D  ET YD+DLVVIGGGSGGLAC
Sbjct  133  ----RTQSAPSTGAPSAANAH---------VSDTSSSD--ETQYDWDLVVIGGGSGGLAC  177

Query  177  SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANF  236
            SKEA+  GQKV VLDYVKPSP G++WGLGGTCVNVGCIPKKLMHQSS+IGE++H D   F
Sbjct  178  SKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQF  237

Query  237  GWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLEL  296
            GW +S+      +F+W +LVS+V  YI  +NFKY+++LR K VKYEN LG+F + HTL L
Sbjct  238  GWTVSNA-----SFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTL  292

Query  297  WH--PRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASY  354
             +   +KG   +T R  VIAVGGRPK L+CPG EHAISSDDIF  K + PGKTLVVGASY
Sbjct  293  TNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIF-SKAEAPGKTLVVGASY  351

Query  355  VALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKL  414
            VALECAGFLKG G+DV +MVRSILLRGFDQD+A +IGEYME +SGI FI+++VP SI KL
Sbjct  352  VALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKL  411

Query  415  ENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQT  474
             NGQL V  T  +G      +DTVLNATGR PDV  LNL  AGV LN KSGRI V NEQT
Sbjct  412  PNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQT  466

Query  475  STPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGM  534
            STP+IYAIGDVIDAPELTPVAIQAG+LL+RRL+ N T  MDY K+CTAVFTP+EYGCCG+
Sbjct  467  STPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGL  526

Query  535  SEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLG  594
            SEED+    G DNI+VYH NF PLEWSLS + R  A+ CY K+I D T+ K VVGFHYLG
Sbjct  527  SEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-RPLAKECYAKLIVDTTQQKRVVGFHYLG  585

Query  595  PNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKssggattgggC  649
            PNAGEVTQA+G+AMKL  TYD  V+TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  586  PNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKESGEDASASGC  640

>H257_08436
Length=642

 Score = 767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/632 (61%), Positives = 466/632 (74%), Gaps = 34/632 (5%)

Query  22   FHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKHWLSESQDEFATSFGV  81
            +H+ GWK CP +VKA  VA++MQ L+P +V   +H   ++E+F +WL+ESQ EFA  F  
Sbjct  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100

Query  82   DSKATKHVTSPFVW--SSNPTAFVGGCDDLLTYFRSGVGVGNPQGATPNGSPTEKTAEAD  139
            D++  KH +SPF +    +   FVGGCDD L +FR+                T+    A 
Sbjct  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRA---------------RTQSAPSAP  145

Query  140  VPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  199
               +     +TS AD +   YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKPSP G
Sbjct  146  ASSASIHANDTSDADVK---YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVG  202

Query  200  TSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNV  259
            ++WGLGGTCVNVGCIPKKLMHQSS+IGE++H D   FGW++S+      TF+W +LVS+V
Sbjct  203  STWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNA-----TFDWSKLVSSV  257

Query  260  DGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWH--PRKGTKQITTRDVVIAVGG  317
              YI  +NFKY+V+LR K VKYEN LG+F + HTL L +   +KG   +T R  VIAVGG
Sbjct  258  QDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGG  317

Query  318  RPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  377
            RPK L+CPG EHA+SSDDIF  K   PGKTLVVGASYVALECAGFLKG G+DV +MVRSI
Sbjct  318  RPKPLSCPGWEHALSSDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI  376

Query  378  LLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDT  437
            LLRGFDQD+A +IGEYME +SGI FI+++VP SI KLENGQ  V  T+      ++ +DT
Sbjct  377  LLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTG-----QDVYDT  431

Query  438  VLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQ  497
            +LNATGR PDV KLNLD AGV LN KSGRI V NEQTSTPNIYA+GDVIDAPELTPVAIQ
Sbjct  432  ILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQ  491

Query  498  AGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVP  557
            AG+LLSRRL+ N T  MDY K+CTAVFTP+EYGCCG+SEED+    G +N+EVYH NF P
Sbjct  492  AGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTP  551

Query  558  LEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617
            LEWSLS D R  A+ CY K+I D T+ K V+GFHYLGPNAGEVTQA+G+A+KL  TYD  
Sbjct  552  LEWSLSHD-RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDF  610

Query  618  VDTVGIHPTTAESFTTLEVTKssggattgggC  649
            ++TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  611  INTVGIHPTTAEIFTTLEITKESGVDASASGC  642

>SPRG_14103
Length=628

 Score = 711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/644 (58%), Positives = 456/644 (71%), Gaps = 35/644 (5%)

Query  10   TLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKHWLS  69
            T  +S   S   +H+ GWK+CP + +A  VA++MQ L+P +V   +H    +++F  WL 
Sbjct  16   TWRSSSTMSSVNYHVVGWKSCPYYERAANVASSMQTLFPGQVKATIHEHATKQSFNDWLE  75

Query  70   ESQDEFATSFGVDSKATKHVTSPFVWSSNP--TAFVGGCDDLLTYFRSGVGVGNPQGATP  127
             SQ  FAT F  D++AT H TSPF +  +   T FVGGCDD L +FRS       Q A  
Sbjct  76   ASQATFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS-----RTQSAAA  130

Query  128  NGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKV  187
              +P       DV    T              YD+DLVVIGGGSGGLA SKEAA +GQKV
Sbjct  131  PSAPARNVHANDVDDGAT--------------YDWDLVVIGGGSGGLAASKEAAKYGQKV  176

Query  188  CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNA  247
             VLDYVKPSPQG++WGLGGTCVNVGCIPKKLMHQS+++GE++H D   FGW + +     
Sbjct  177  LVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNA----  232

Query  248  PTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGT--KQ  305
             TF+W +LV++V  YI  +NFKY+V+LR K VKYENFLG+F + HTL L +P KG   K 
Sbjct  233  -TFDWTKLVTSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKD  291

Query  306  ITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKG  365
            +T R  +IAVGGRPK L CPG + AISSDDIF  +   PGKTLVVGASYVALECAGFLK 
Sbjct  292  VTFRRALIAVGGRPKSLDCPGADLAISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKA  350

Query  366  MGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTS  425
             G+DV VMVRSILLRGFD DMA +IG YME ++ I+FI+  VP SI +L NGQL V  T 
Sbjct  351  QGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTF  410

Query  426  EDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDV  485
             +G      +DTVLNATGR+PDV+ LNL  AGV LN K+GRI V +EQTS P+IYA+GDV
Sbjct  411  GEG-----IYDTVLNATGRNPDVSGLNLPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDV  465

Query  486  IDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGE  545
            ID PELTPVAIQAGRLL++RL++NS   M Y+KVCTAVFTPIEYGCCG+SE+ + E  G 
Sbjct  466  IDGPELTPVAIQAGRLLAKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGA  525

Query  546  DNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMG  605
            DN+ VYH +F PLEWSLS D R  A+ CY K+I D+T++  VVGFHYLGPNAGEVTQA+G
Sbjct  526  DNLGVYHQSFTPLEWSLSHD-RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVG  584

Query  606  LAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKssggattgggC  649
            +AMKL  +YD  V TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  585  IAMKLNASYDDFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628

>SDRG_16720
Length=628

 Score = 709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/644 (58%), Positives = 455/644 (71%), Gaps = 35/644 (5%)

Query  10   TLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKHWLS  69
            T  +S   S   +H+ GWK+CP + +A  VA +MQ L+P +V   +H    +++F  WL 
Sbjct  16   TWRSSSTMSSVNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLE  75

Query  70   ESQDEFATSFGVDSKATKHVTSPFVWSSNP--TAFVGGCDDLLTYFRSGVGVGNPQGATP  127
             SQ  FAT F  D++AT H TSPF +  +   T FVGGCDD L +FRS       Q A  
Sbjct  76   TSQSTFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS-----RTQSAAA  130

Query  128  NGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKV  187
              +P       DV    T              YD+DLVVIGGGSGGLA SKEAA +GQKV
Sbjct  131  PSAPARNVHANDVDDGAT--------------YDWDLVVIGGGSGGLAASKEAAKYGQKV  176

Query  188  CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNA  247
             VLDYVKPSPQG++WGLGGTCVNVGCIPKKLMHQS+++GE++H D   FGW + +     
Sbjct  177  LVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNA----  232

Query  248  PTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGT--KQ  305
             TF+W +L+++V  YI  +NFKY+V+LR K VKYENFLG+F + HTL L +P KG   K 
Sbjct  233  -TFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKD  291

Query  306  ITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKG  365
            +T R  +IAVGGRPK L CPG + AISSDDIF  +   PGKTLVVGASYVALECAGFLKG
Sbjct  292  VTFRRALIAVGGRPKSLDCPGADLAISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKG  350

Query  366  MGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTS  425
             G+DV VMVRSILLRGFD DMA +IG YME ++ I FI+  VP SI +L NGQL V  T 
Sbjct  351  QGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTF  410

Query  426  EDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDV  485
             +G      +DTVLNATGR PDV+ LNL  AGV LN K+GRI V +EQTSTP+IYA+GDV
Sbjct  411  GEG-----IYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDV  465

Query  486  IDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGE  545
            ID PELTPVAIQAGRLLS+RL++NS   M Y+KVCTAVFTPIEYGCCG+SE+ + E  G 
Sbjct  466  IDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGA  525

Query  546  DNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMG  605
            DN+ VYH +F PLEWSLS D R  A+ CY K+I D+T++  VVGFHYLGPNAGEVTQA+G
Sbjct  526  DNLGVYHQSFTPLEWSLSHD-RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVG  584

Query  606  LAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKssggattgggC  649
            +A+KL  +Y+  V TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  585  IAIKLNASYEDFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628

>SPRG_04074
Length=509

 Score = 418 bits (1075),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 244/500 (49%), Positives = 318/500 (64%), Gaps = 29/500 (6%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            +N+DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK
Sbjct  2    SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  61

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +MH S ++G  + HD A+ GW +          NW+ LV  V  ++K +NF Y+V LRS 
Sbjct  62   IMHYSGILGAGL-HDAAHLGWQVPE----KVEHNWETLVEAVQAHVKKLNFSYRVGLRSN  116

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPK-ELTCPG-GEHAISSDD  335
             V+Y N L  F +PHTL        T+ +T   ++IA GGRP      PG  E+AI+SDD
Sbjct  117  KVQYINALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDD  176

Query  336  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYME  395
            +F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + M 
Sbjct  177  LFSLSTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-  234

Query  396  VQSGIEFIRKTVPQSITKLE-NGQLLVKW-TSEDGESCEEAFDTVLNATGRDPDVAKLNL  453
            V  G++F   T+P SI K E  GQL V +  SE  E+  EAFDTVL A GR  D   + L
Sbjct  235  VAQGMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGL  294

Query  454  DKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLSRRLYN-NST  511
            +KAGVK    +G+    NE T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N T
Sbjct  295  EKAGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYT  353

Query  512  VQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAE  571
              M+Y+ + T VFTP+EYG  G+SEE++  R+G+D+I VY   F  LEW      R  AE
Sbjct  354  KTMNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAV--HRKKAE  411

Query  572  S-------------CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  618
            S             C  K++C K+ ++ V+GFH++GPNAGEVTQ   +A+ +G T +   
Sbjct  412  SAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFD  471

Query  619  DTVGIHPTTAESFTTLEVTK  638
            + +GIHPT AESF  L VTK
Sbjct  472  NVIGIHPTDAESFMALTVTK  491

>SDRG_14408
Length=528

 Score = 419 bits (1076),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 244/502 (49%), Positives = 321/502 (64%), Gaps = 33/502 (7%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            +N+DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK
Sbjct  21   SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  80

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +MH S ++G  + HD A+ GW L     +    NW+ LV  V  ++K +NF Y+V LRS 
Sbjct  81   IMHYSGILGAGL-HDAAHLGWQLPEKVEH----NWETLVETVQAHVKKLNFSYRVGLRSN  135

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGR---PKELTCPG-GEHAISS  333
             V+Y N L  F +PHTL        T+ +T   ++IA GGR   PKE+  PG GE+AI+S
Sbjct  136  KVQYINALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEI--PGVGEYAITS  193

Query  334  DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEY  393
            DD+F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + 
Sbjct  194  DDLFSLTTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDI  252

Query  394  MEVQSGIEFIRKTVPQSITKLE-NGQLLVKW-TSEDGESCEEAFDTVLNATGRDPDVAKL  451
            M V  G++F   T+P SI K +  GQL V +  SE  E+  E FDTVL A GR  D   +
Sbjct  253  M-VAQGMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFNI  311

Query  452  NLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLSRRLYN-N  509
             L+K GVK    +G+    NE T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N
Sbjct  312  GLEKVGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPN  370

Query  510  STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTA  569
             T  M+Y+ + T VFTP+EYG  G+SEE++  R+G+D++ VY   F  LEW      R  
Sbjct  371  YTKTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAV--HRQK  428

Query  570  AES-------------CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  616
            AES             C  K++C K+ ++ V+GFH++GPNAGEVTQ   +A+ +G T + 
Sbjct  429  AESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKED  488

Query  617  MVDTVGIHPTTAESFTTLEVTK  638
              + +GIHPT AESF  L VTK
Sbjct  489  FDNVIGIHPTDAESFMALTVTK  510

>PYAP_21882
Length=502

 Score = 263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 169/497 (34%), Positives = 270/497 (54%), Gaps = 35/497 (7%)

Query  150  TSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQ-KVCVLDYVKPSPQGTSWGLGGTC  208
            +++A+A +  YDY  +VIG GSGG+A S+ AA++   +V V++  +         LGGTC
Sbjct  21   SASANAGDGMYDY--LVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTC  69

Query  209  VNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGD--GNAPTFNWKQLVSNVDGYIKSI  266
            VNVGC+PKK+M+ ++ +G  +H D  ++G+  + G+   +   F+WK+L    D Y+  +
Sbjct  70   VNVGCVPKKIMYLAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRL  129

Query  267  NFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG  326
            N  Y   L +  V       +F     +E+       K+I  ++V+IAVGG+P     PG
Sbjct  130  NGIYGRNLDNSKVDLFRGTATFNAKGNVEV-----DGKEIAAKNVLIAVGGKPLIPDIPG  184

Query  327  GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQD  385
             EH I SD  F + +++P K  VVGA Y+A+E AG L G+G D  +  R   +LRGFD+ 
Sbjct  185  KEHCIDSDGFFEL-EEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDEL  243

Query  386  MADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRD  445
            +   + + M  + G+     +    + K  +G   +     DG S    FD+V+ A GR 
Sbjct  244  IRTTLHDAM-AKEGVNLRPHSSVTKVIKAADGTKTLVLA--DG-SEHSGFDSVIYAAGRV  299

Query  446  PDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTP--NIYAIGDVIDAPELTPVAIQAGRLLS  503
            P    LNL+ AG++ ++  G I +   Q +T   NI+A+GDV   P LTPVAI AGR L+
Sbjct  300  PLTESLNLEAAGIETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLA  358

Query  504  RRLYNN-STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSL  562
             RL+      +  YE + T VF+    G  G++E+ ++ +FG+D I+VY + FV + + +
Sbjct  359  DRLFGGMKDAKASYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGI  418

Query  563  STD-----TRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617
              +      +       +K++C + +D+ VVG H +G  A E+ Q  G+A+K+G T    
Sbjct  419  INEFGEDGQQKPKPMTAMKLVC-QGKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADF  477

Query  618  VDTVGIHPTTAESFTTL  634
               V IHPT AE   T+
Sbjct  478  DSCVAIHPTAAEELVTM  494

>PHALS_08068
Length=497

 Score = 260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 165/487 (34%), Positives = 261/487 (54%), Gaps = 34/487 (7%)

Query  161  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  219
            +YD +VIG GSGG+A ++ AAS+ G +V +++  +         LGGTCVNVGC+PKKLM
Sbjct  23   EYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLM  73

Query  220  HQSSLIGEVIHHDGANFGWNLSSGDGNAP---TFNWKQLVSNVDGYIKSINFKYKVELRS  276
            + ++ +   +HHD   +G+  ++  G+      FNW +L +  D Y+  +N  Y+  L +
Sbjct  74   YIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYETNLAN  133

Query  277  KYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  336
              V        F     +E+       K++  + ++IAVGGRP     PG E  I SD  
Sbjct  134  SKVDLIRGSAKFNERGNVEV-----DDKEVRAKKILIAVGGRPLIPDIPGKELCIDSDGF  188

Query  337  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMADKIGEYME  395
            F ++   P K  +VGA Y+A+E AG L  +G    V  R   +LR FD  +   + E M 
Sbjct  189  FELETL-PTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNILRTTLEEAM-  246

Query  396  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDK  455
               G+     +    + +  +G   +  T+    S    FD V+ ATGR P  + LNL+K
Sbjct  247  ANDGVHLRPNSTVARVKEAADGTKTLVLTN---GSEHRGFDVVICATGRVPLTSTLNLEK  303

Query  456  AGVKLNEKSGRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STVQ  513
            AG+  ++ +G I V   ++T+  N+YA+GDV + P LTPVAI AGR LS RL+      +
Sbjct  304  AGITTDD-NGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGGMKDAK  362

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAA---  570
            + YE + T +F+    G  G++EE +++++G++NI+VY + FV + + L  +T  A    
Sbjct  363  LSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIEATGVP  422

Query  571  ---ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  627
                   +K++C   ++K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT 
Sbjct  423  KEKPKTAMKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTA  481

Query  628  AESFTTL  634
             E   TL
Sbjct  482  GEELVTL  488

>PYAR_17512
Length=533

 Score = 260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 171/510 (34%), Positives = 269/510 (53%), Gaps = 50/510 (10%)

Query  159  NYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            + +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK
Sbjct  31   DVEYDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKK  81

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDG---NAPTFNWKQLVSNVDGYIKSINFKYKVEL  274
            +M+ ++ +G ++H D  ++G+    G G   +   F+W +L    D Y+  +N  Y+  L
Sbjct  82   IMYLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYERNL  141

Query  275  RSKYVKYENFLGSFVNPHTLEL---WHPRKGT------------------KQITTRDVVI  313
             +  V+      +F     +E+     P K                    K+I+ ++V+I
Sbjct  142  GNSKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEISAKNVLI  201

Query  314  AVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  373
            AVGG+P     PG EH I SD  F +++  P K  VVGA Y+A+E AG L G+G D  + 
Sbjct  202  AVGGKPLIPNIPGKEHCIDSDGFFELEEM-PKKVAVVGAGYIAVELAGVLHGLGSDTTIF  260

Query  374  VRSI-LLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCE  432
             R   +LRGFD+ +   + + M+ + G++    ++   +TK  +G   +    +DG    
Sbjct  261  CRKDGVLRGFDELIRSTLHDAMD-KDGLKLRPHSLVAKVTKQADGTKTLVL--QDGTE-H  316

Query  433  EAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTP--NIYAIGDVIDAPE  490
              FDTV+ A GR P    LNL+ AGV+  +  G I +   Q +T   NI+A+GDV   P 
Sbjct  317  AGFDTVIYAAGRVPLTQSLNLEGAGVE-TDAQGFIKIDEYQRTTAKKNIFAVGDVCGTPA  375

Query  491  LTPVAIQAGRLLSRRLYNN-STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIE  549
            LTPVAI AGR LS RL+      +M YE + T VF+    G  G++E++++ + G+D ++
Sbjct  376  LTPVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVK  435

Query  550  VYHTNFVPLEWSLSTDTRTAAES-----CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAM  604
            VY + FV + + +  +     +        +K++C    +K VVG H +G  A E+ Q  
Sbjct  436  VYSSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEK-VVGVHLIGMAADEILQGF  494

Query  605  GLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            G+A+K+G T       V IHPT AE   T+
Sbjct  495  GVAVKMGATKADFDSCVAIHPTAAEELVTM  524

>PYIR_17506
Length=509

 Score = 254 bits (648),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 173/486 (36%), Positives = 263/486 (54%), Gaps = 36/486 (7%)

Query  162  YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  221  QSSLIGEVIHHDGANFGWNLSSGD--GNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKY  278
             ++ +   +H D   +G+    G   G+   F+W +L    D YI  +N  Y+  L +  
Sbjct  90   LAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERNLGNSK  149

Query  279  VKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFW  338
            V       +F     +E+       K I+ R+V+IAVGG+P     PG EH I SD  F 
Sbjct  150  VDLIQGTAAFNAQGEVEV-----DGKVISARNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  204

Query  339  MKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMADKIGEYMEVQ  397
            +++  P K  VVGA Y+A+E AG L G+G D  +  R   +LR FD+ + D + + M  +
Sbjct  205  LEEL-PNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDAM-AK  262

Query  398  SGIEFIRKTVPQS-ITKLENGQLLVKWTSEDGESCEEA-FDTVLNATGRDPDVAKLNLDK  455
             GI  +R   PQS + ++E   L  K T    +  E A FDTV+ A GR P  + LN+  
Sbjct  263  DGI-VVR---PQSNVARIEK-TLDGKKTLVLADGSEHAGFDTVIYAAGRIPLTSNLNISA  317

Query  456  AGVKLNEKSGRIWVKNEQTSTP-NIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STVQ  513
            AG++  +K G I V   QT++  N++A+GDV     LTPVAI AGR LS RL+      +
Sbjct  318  AGIE-TDKHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMEDAK  376

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAES-  572
            + Y  + T VF+    G  G++E++++E++G+  I+ Y + FV + + L  +      + 
Sbjct  377  ISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNELDAEGNTK  436

Query  573  ----CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  628
                  +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V IHPT  
Sbjct  437  PKPMTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCVAIHPTAG  495

Query  629  ESFTTL  634
            E   TL
Sbjct  496  EELVTL  501

>PHYSO_254571
Length=489

 Score = 251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 174/507 (34%), Positives = 264/507 (52%), Gaps = 42/507 (8%)

Query  141  PMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQG  199
            P+ E S++  +T        +YD +VIG GSGG+A ++ AAS+ G +V V++  +     
Sbjct  3    PLEENSLQPDTT--------EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR-----  49

Query  200  TSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGW-NLSSGD--GNAPTFNWKQLV  256
                LGGTCVNVGC+PKKLM  ++ +   +HHD  ++G+ +  +G   G    F+W +L 
Sbjct  50   ----LGGTCVNVGCVPKKLMFIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLK  105

Query  257  SNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVG  316
            +  D Y+  +N  Y+  L +  V        F +   +E+       K+I  ++V+IAVG
Sbjct  106  ARRDAYVLRLNGIYERNLANSKVALIRGSAKFNDKGNVEV-----DGKEILAKNVMIAVG  160

Query  317  GRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  376
            G+P     PG E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R 
Sbjct  161  GKPLIPDIPGKELCIDSDGFFELETL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRK  219

Query  377  I-LLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAF  435
              +LR FD D+     E    + G+     +    + K ++G   +     DG S    +
Sbjct  220  EGVLRSFD-DIVRTTLEDAMAKDGVHLRPHSNIARVEKADDGTKTLVLA--DG-SEYSGY  275

Query  436  DTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKN-EQTSTPNIYAIGDVIDAPELTPV  494
            D V+ A GR P  + L LDKAGV   +K+G I V   ++TS   + A+GDV   P LTPV
Sbjct  276  DVVIYAAGRVPLTSNLQLDKAGVD-TDKNGFIQVNEFQETSNSKVLAVGDVCGTPALTPV  334

Query  495  AIQAGRLLSRRLYNN-STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHT  553
            AI AGR LS RL+      ++ YE + T VF+    G  G++EE ++ ++G+D I+VY +
Sbjct  335  AIAAGRRLSDRLFGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTS  394

Query  554  NFVPLEWSLSTDTRTAA------ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLA  607
             FV + + L  +   A           +K++C    +K VVG H +G  A E+ Q  G+A
Sbjct  395  RFVNMYYGLINEMDEATGEPKDKPKTAMKLVCAGKEEK-VVGLHMIGMAADEILQGFGVA  453

Query  608  MKLGFTYDQMVDTVGIHPTTAESFTTL  634
            +K+G T     + V IHPT  E   TL
Sbjct  454  VKMGATKADFDNCVAIHPTAGEELVTL  480

>PPTG_09787
Length=493

 Score = 251 bits (641),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 173/481 (36%), Positives = 261/481 (54%), Gaps = 19/481 (4%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+  YD +VIGGGSGG+A ++ AA+FG KV V++  +   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYMVIGGGSGGMASARRAATFGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKK  59

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +M  ++   E ++ +  ++  N +S D     F+W  + +  D YIK +N  Y+  L + 
Sbjct  60   VMFNTAAHVEHLNRN-KDYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNA  118

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  337
             V +   +   V    +E+       +  T + V++A GG P     PG EH I SD  F
Sbjct  119  KVDHVQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFF  173

Query  338  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEV  396
             +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + D + E ME 
Sbjct  174  KLEQ-QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-  231

Query  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
            ++G++F+R +    + K ENG+L    T    E     FDT++ A GR+P    L L++ 
Sbjct  232  KAGVKFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLGLEEI  291

Query  457  GVKLNEKSGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-VQ  513
            GVKL+E  G I V   E TS P +YAIGD  +   ELTPVAI AGR LS RL+       
Sbjct  292  GVKLSE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESC  573
            ++Y ++ T +F+    G  G +E ++  ++GE+NI+VY + FV L  S++   R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTAM  410

Query  574  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTT  633
             L  + +K   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T
Sbjct  411  KLVTVGEK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVT  467

Query  634  L  634
            +
Sbjct  468  M  468

>SDRG_03822
Length=494

 Score = 250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 161/476 (34%), Positives = 248/476 (52%), Gaps = 18/476 (4%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YD +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++L  E++H   A     +   D     F+W  + +  D Y+K +N  Y   +    V  
Sbjct  61   AALHAEMLHSARAYAFKGVQ--DIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  118

Query  282  ENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  341
                  FV+ HT+E+   R   K I     +IAVGG P     PG EHAISSD  F + +
Sbjct  119  VMGAAKFVDNHTVEVNGDRYAAKHI-----LIAVGGVPAMPPLPGIEHAISSDGFFAL-E  172

Query  342  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQSGI  400
             +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + D +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  401  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKL  460
             F+R++   SI K E+G L ++ T          F+TVL A GR P    L L+   + L
Sbjct  232  RFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  461  NEKSGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TVQMDYEK  518
            +          E T+ PN++A+GDV     ELTPVAI AGR L+ RL+ N     ++Y +
Sbjct  292  SPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQ  351

Query  519  VCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI  578
            + T VF+    G  G++E  +  ++G  N+  + ++F  + +++S +      +  +K++
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKVQTA--MKLV  409

Query  579  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  410  CIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_15045
Length=494

 Score = 248 bits (633),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 159/476 (33%), Positives = 250/476 (53%), Gaps = 18/476 (4%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YD +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++L  E++H   A     +S  D     F+W  + +  D Y+  +N  Y   +    V  
Sbjct  61   AALHAEMLHSARAYAFKGVS--DIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  118

Query  282  ENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  341
                  FV+ HT+E+   R      T + ++IAVGG P     PG EHAISSD  F + +
Sbjct  119  VMGAAKFVDNHTIEVNGER-----YTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-E  172

Query  342  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQSGI  400
             +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + D +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  401  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKL  460
            +F+R++   +I K  +G L ++ T          F+TVL A GR P    L L+   + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  461  NEKSGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TVQMDYEK  518
            + +        E T+ PN+YAIGDV     ELTPVAI AGR L+ RL+ N     ++Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  519  VCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI  578
            + T VF+    G  G++E  + E++G  N+  + ++F  + +++  +      +  +K++
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--MKLV  409

Query  579  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  410  CIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PPTG_18033
Length=500

 Score = 248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 176/499 (35%), Positives = 264/499 (53%), Gaps = 40/499 (8%)

Query  151  STADAEETNYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCV  209
            S + A +T YDY  +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCV
Sbjct  18   SASRAPQTEYDY--LVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCV  66

Query  210  NVGCIPKKLMHQSSLIGEVIHHDGANFGW-NLSSGD--GNAPTFNWKQLVSNVDGYIKSI  266
            NVGC+PKKLM  ++ +   + HD  ++G+ + ++G+  G    F+W +L +  D Y+  +
Sbjct  67   NVGCVPKKLMFIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRL  126

Query  267  NFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG  326
            N  Y+  L +  V+       F     +E+       K++  ++V+IAVGG+P     PG
Sbjct  127  NGIYERNLANSKVELIRGSAKFNENGNVEV-----DGKELLAKNVLIAVGGKPLIPDIPG  181

Query  327  GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQD  385
             E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD D
Sbjct  182  KELCIDSDGFFELEIL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-D  239

Query  386  MADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRD  445
            +     E   V+ G+     +    + +  +G   V  T  DG S    +D V+ A GR 
Sbjct  240  IVRTTLEDAMVKDGVHLRPHSNVARVEQAADGTKTVVLT--DG-SEYNGYDVVMYAAGRV  296

Query  446  PDVAKLNLDKAGVKLNEKSGRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  504
            P  + L LDKAGV  +E  G I V   ++TS   + A+GDV   P LTPVAI AGR LS 
Sbjct  297  PLTSNLQLDKAGVTTDEH-GFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSD  355

Query  505  RLY---NNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWS  561
            RL+   NNS V   YE + T VF+    G  G++E+ ++ ++G+D ++VY + FV + + 
Sbjct  356  RLFGGLNNSKVS--YENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYG  413

Query  562  L------STDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  615
            L      ST          +K++C    +K VVG H +G  A E+ Q  G+A+K+G T  
Sbjct  414  LINEVDESTGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKA  472

Query  616  QMVDTVGIHPTTAESFTTL  634
               + + IHPT  E   TL
Sbjct  473  DFDNCIAIHPTAGEELVTL  491

>PHYCA_504517
Length=493

 Score = 248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 171/481 (36%), Positives = 259/481 (54%), Gaps = 19/481 (4%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+  YD +VIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  59

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +M  ++   E ++ +  ++  N +  +     F+W  +    D YIK +N  Y+  L + 
Sbjct  60   VMFNTAAHVEHLNRN-KDYSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNA  118

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  337
             V +   +   V    +++     G K  T + V++A GG P     PG E+ I SD  F
Sbjct  119  NVDHVQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFF  173

Query  338  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEV  396
             +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + D + E ME 
Sbjct  174  KLEQ-QPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-  231

Query  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
            ++G++F+R      + K +NG+L    T    E     FDT+L A GR+P    L L++ 
Sbjct  232  KAGVKFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLEEV  291

Query  457  GVKLNEKSGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-VQ  513
            GVKL+E  G I V   E TS P +YAIGD  +   ELTPVAI AGR LS RL+       
Sbjct  292  GVKLSE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESC  573
            ++Y ++ T +F+    G  G +E ++ E++GE+N++VY + FV L  S++   R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTAM  410

Query  574  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTT  633
             L  + +K   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T
Sbjct  411  KLVTVGEK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVT  467

Query  634  L  634
            +
Sbjct  468  M  468

>SDRG_03823
Length=497

 Score = 247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 165/480 (34%), Positives = 254/480 (53%), Gaps = 18/480 (4%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T   YD +VIGGGSGG + ++ AA++G KV V++           G+GGTCVNVGC+PKK
Sbjct  3    TTTTYDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKK  59

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +M  +++  E++H   A    N+   D    +F+W  L    D Y+  +N  Y+  L + 
Sbjct  60   VMFNAAMHAEMLHSAHAYTFKNIQ--DVEYGSFDWAALKKKRDAYVARLNGIYERNLGNN  117

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  337
             +        FV+ HT+E+   R      T + ++IAVGG P     PG EHAISSD  F
Sbjct  118  KIPLIYGAAKFVDNHTIEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFF  172

Query  338  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEV  396
             + + +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + D +   ME 
Sbjct  173  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-  230

Query  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
             +G+ F+R++   SI K E+G L ++ T          F+TVL A GR P    L L+  
Sbjct  231  HAGVRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETT  290

Query  457  GVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TVQM  514
             + L+          E T+ PN++A+GDV     ELTPVAI AGR L+ RL+ N     +
Sbjct  291  DIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACV  350

Query  515  DYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCY  574
            +Y ++ T VF+    G  G++E  + E++G  N++VY + F  + +++S       +   
Sbjct  351  NYHQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDEK--QKTA  408

Query  575  LKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            +K++C    ++ V+G H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  409  MKLMCIG-EEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  467

>SDRG_11131
Length=494

 Score = 246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 158/476 (33%), Positives = 249/476 (52%), Gaps = 18/476 (4%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YD +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++L  E++H   A     +S  D     F+W  + +  D Y+  +N  Y   +    V  
Sbjct  61   AALHAEMLHSARAYAFKGVS--DIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  118

Query  282  ENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  341
                  FV+ HT+E+   R      T + ++IAVGG P     PG EHAISSD  F + +
Sbjct  119  VMGAAKFVDNHTIEVNGER-----YTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-E  172

Query  342  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQSGI  400
             +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + D +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  401  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKL  460
            +F+R++   +I K  +G L ++ T          F+TVL A GR P    L L+   + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  461  NEKSGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TVQMDYEK  518
            + +        E T+ PN+YAIGDV     ELTPVAI AGR L+ RL+ N     ++Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  519  VCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI  578
            + T VF+    G  G++E  +  ++G  N+  + ++F  + +++  +      +  +K++
Sbjct  352  IPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--MKLV  409

Query  579  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  410  CIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PITG_14083
Length=493

 Score = 245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 170/481 (35%), Positives = 257/481 (53%), Gaps = 19/481 (4%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+  YD +VIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  59

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +M  ++   E ++ +  ++  N +S D     F+W  + +  D YIK +N  Y+  L + 
Sbjct  60   VMFNAAAHVEHLNRN-KDYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNA  118

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  337
             V +   +   V    +E+       +  T + V++A GG P     PG EH I SD  F
Sbjct  119  KVDHVQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFF  173

Query  338  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEV  396
             +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + D + E ME 
Sbjct  174  KLEQ-QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-  231

Query  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
            ++G+ F+R +    + K +NG+L    T +  E     FD+++ A GR P    L L++ 
Sbjct  232  KAGVNFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEV  291

Query  457  GVKLNEKSGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-VQ  513
            GVKL E  G I V   E TS   +YAIGD  +   ELTPVAI AGR LS RL+       
Sbjct  292  GVKLAE-GGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESC  573
            ++Y ++ T +F+    G  G +E ++  ++GE+N++VY + FV L  S++   R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAM  410

Query  574  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTT  633
             L  + DK   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T
Sbjct  411  KLVTVGDK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVT  467

Query  634  L  634
            +
Sbjct  468  M  468

>PHYKE_10327
Length=1200

 Score = 258 bits (658),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 171/497 (34%), Positives = 270/497 (54%), Gaps = 36/497 (7%)

Query  151  STADAEETNYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCV  209
            S + A +T YDY  +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCV
Sbjct  18   SASRALQTEYDY--LVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCV  66

Query  210  NVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNA---PTFNWKQLVSNVDGYIKSI  266
            NVGC+PKKLM  ++ +G  +HHD  ++G+  ++  G+      F+W +L +  D Y+  +
Sbjct  67   NVGCVPKKLMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRL  126

Query  267  NFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG  326
            N  Y+  L +  V+      +F +   + +       K++  ++V+IAVGG+P     PG
Sbjct  127  NGIYERNLANSKVELIRGSAAFNDNGNVVV-----DGKEVRAKNVLIAVGGKPMIPDIPG  181

Query  327  GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQD  385
             E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD  
Sbjct  182  KELCIDSDGFFELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGI  240

Query  386  MADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRD  445
            +   + + M+ + G+   R +    + +  +G   +     DG S    +D V+ A GR 
Sbjct  241  VRTTLEDAMK-KDGVHLQRHSNIARVNQAADGTKTLVLA--DG-SEHSGYDVVIYAAGRV  296

Query  446  PDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  504
            P  + L LDKAG+   +K+G I V K ++TS   + A+GDV   P LTPVAI AGR LS 
Sbjct  297  PLTSTLKLDKAGIA-TDKNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSD  355

Query  505  RLYNN-STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLS  563
            RL+      ++ YE + T VF+    G  G++EE +++++G+D+I+VY + FV + + L 
Sbjct  356  RLFGGMGGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLI  415

Query  564  TDT-RTAAE-----SCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617
             +   T  E        +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T    
Sbjct  416  NEMDETTGEPKDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADF  474

Query  618  VDTVGIHPTTAESFTTL  634
             + + IHPT  E   TL
Sbjct  475  DNCMAIHPTAGEELVTL  491

>PYAP_23435
Length=951

 Score = 255 bits (651),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 175/490 (36%), Positives = 262/490 (53%), Gaps = 19/490 (4%)

Query  149  ETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  208
             ++ A +  T+  YD VVIGGGSGG+A ++ AA++G KV +++  +        GLGGTC
Sbjct  458  HSAFAASRLTDMVYDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTC  514

Query  209  VNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINF  268
            VN GC+PKK+M  ++   E +  +G ++  N +        F+W  + +  D YI  +N 
Sbjct  515  VNYGCVPKKVMFNAAAHVEHLARNG-DYSINTAPKAFEFGDFDWANMKTKRDAYILRLNG  573

Query  269  KYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  328
             Y+  + +  +     + + V+ + +E+       K  T + V++AVGG P     PG E
Sbjct  574  IYERNVGNAGIDLVQGVATLVSSNQIEV-----DGKVFTGKHVLVAVGGVPAMPAIPGIE  628

Query  329  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMA  387
            HAI SD  F ++  +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + 
Sbjct  629  HAIDSDGFFKLES-QPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVR  687

Query  388  DKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPD  447
            D + E ME + G+ F+R++  + I K  +G+L +    +  +   E FD VL A GR+P 
Sbjct  688  DLVNEEME-KHGVNFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPR  746

Query  448  VAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRR  505
               L LDKAGVKLN+  G I V   E TS P +YAIGD      ELTPVAI AGR L+ R
Sbjct  747  TRGLGLDKAGVKLND-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADR  805

Query  506  LYNNST-VQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLST  564
            L+ N     + Y ++ T VF+    G  G +E ++  +FG D ++VY + FV L  S++ 
Sbjct  806  LFGNEPDACLHYHQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMAD  865

Query  565  DTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  624
                   +  L  + D   D+ VVG H  G  A E+ Q  G+AMK+  T     + V IH
Sbjct  866  PENKGKTAMKLVCVGD---DEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIH  922

Query  625  PTTAESFTTL  634
            PT AE F T+
Sbjct  923  PTAAEEFVTM  932

>PHYSO_550665
Length=491

 Score = 244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 170/481 (35%), Positives = 255/481 (53%), Gaps = 19/481 (4%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+  YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFEGMGLGGTCVNFGCVPKK  59

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +M  ++   E +  +  ++  N ++ D     F+W  + +  D YIK +N  Y+  L + 
Sbjct  60   VMFNAAAHVEHLARN-KDYSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNA  118

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  337
             V +   +   V    +E+       K  T + V++A GG P     PG EH I SD  F
Sbjct  119  QVDHVQGIAKLVAKDKVEV-----AGKVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDGFF  173

Query  338  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEV  396
             + +++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + D + E ME 
Sbjct  174  KL-EQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-  231

Query  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
            ++G++F+R      + K  +G+L    T    E     FD +L A GR+P    L L++ 
Sbjct  232  KAGVKFVRNMRAARVEKQADGKLTFVVTINGEEHKFPDFDAILYAVGREPRTKDLGLEEV  291

Query  457  GVKLNEKSGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-VQ  513
            GVKL+E  G I V   E TS P +YAIGD  I   ELTPVAI AGR LS RL+       
Sbjct  292  GVKLSE-GGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESC  573
            ++Y ++ T +F+    G  G +E ++  ++GE+N++ Y + FV L  S++   R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMADPERKGKTAM  410

Query  574  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTT  633
             L  + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T
Sbjct  411  KLVTVGEQ---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVT  467

Query  634  L  634
            +
Sbjct  468  M  468

>PYIW_25301
Length=512

 Score = 244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 167/485 (34%), Positives = 257/485 (53%), Gaps = 34/485 (7%)

Query  162  YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            YD +VIG GSGG+A S+ AA +   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  221  QSSLIGEVIHHDGANFGWNLSSG--DGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKY  278
             ++ +  ++H D  ++G+    G   G+   F+W +L    D YI  +N  Y+  L +  
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYILRLNDIYERNLGNSK  150

Query  279  VKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFW  338
            V        F     +E+       K+I  ++++IAVGG+P     PG E  I SD  F 
Sbjct  151  VDLLTGTAVFNAHGNVEM-----DGKEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFFE  205

Query  339  MKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMADKIGEYMEVQ  397
            +++  P K  VVGA Y+A+E AG L G+G +  +  R   +LR FD+ + D + + M  +
Sbjct  206  LEQL-PKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAM-AK  263

Query  398  SGIEFIRKTVPQS-ITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
             GI  +R   PQS + ++E      K       S    FDTV+ A GR P  ++LNL  A
Sbjct  264  DGI-VVR---PQSNVARVEQTADGKKTLFLQNGSEHAGFDTVIYAAGRVPLTSELNLSAA  319

Query  457  GVKLNEKSGRIWVKNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STVQM  514
            G+   +K G I V   Q TS  N++A+GDV     LTPVAI AGR LS RL+   +  ++
Sbjct  320  GIA-TDKHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMADAKI  378

Query  515  DYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAES--  572
             Y+ + T VF+    G  G++E +++E+ G+  I+ Y + FV + + L  D      +  
Sbjct  379  SYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVDADGAAKP  438

Query  573  ---CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  629
                 +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V IHPT  E
Sbjct  439  KPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVAIHPTAGE  497

Query  630  SFTTL  634
               T+
Sbjct  498  ELVTM  502

>SPRG_11769
Length=453

 Score = 241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 164/476 (34%), Positives = 255/476 (54%), Gaps = 35/476 (7%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDLVV+GGGSGG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++ +   + HD   +G+          T +W  L    D Y+  +N  Y   L+   V +
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNT----TVDWATLKQRRDAYVTRLNGIYARNLQGSGVDF  111

Query  282  ENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  341
             + L SF +         R+G +++      +AVGG+P     PG EH ISSD  F + +
Sbjct  112  AHGLCSFGS-------DGRRGDERL------VAVGGQPVMPDIPGIEHCISSDGFFELDE  158

Query  342  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMADKIGEYMEVQSGI  400
            + P +  VVGA Y+A+E AG L+G+G D  +  R   +LR FD DM   +      + GI
Sbjct  159  R-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQSVLHDAFKRDGI  216

Query  401  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKL  460
                 +    + K++     +  T+  G+     FD VL ATGR P    L L+  G++L
Sbjct  217  TLQPHSTVARVDKVDPATGTLSLTTTAGDY-HTGFDCVLVATGRTPMTKHLGLEHRGIEL  275

Query  461  NEKSGRIWVKNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STVQMDYEK  518
            +  +G I V   Q TS P ++A+GDV++   LTPVAI AGR L+ RL+      + DY  
Sbjct  276  S-PNGFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYTS  334

Query  519  VCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI  578
            + + VF+    G  G++E+++++ + ED I+VY + FV + +SL         +  +K+I
Sbjct  335  IPSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAHEKPTTA-MKLI  393

Query  579  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            C    +K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  394  CVGPTEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>PHYRA_72037
Length=493

 Score = 241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 169/481 (35%), Positives = 255/481 (53%), Gaps = 19/481 (4%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+  YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  59

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +M  ++   E +H +  ++    ++ D     F+W  +    D YI  +N  Y+  L + 
Sbjct  60   VMFNAAAHVEHLHRN-EDYSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNA  118

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  337
             V +   + + V    +E+       K  T + V++A GG P     PG EH   SD  F
Sbjct  119  KVDHVQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFF  173

Query  338  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEV  396
             +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + D + + ME 
Sbjct  174  RLEQ-QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-  231

Query  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
            ++G++F+R T    + K ++G+L    T +  E     FD +L A GR+P    L L+K 
Sbjct  232  KAGVKFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKV  291

Query  457  GVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-VQ  513
            GVKL +  G I V   E TS P +YAIGD      ELTPVAI AGR LS RL+       
Sbjct  292  GVKLAD-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESC  573
            ++Y ++ T +F+    G  G +E ++  +FGE+N++VY + FV L  S++   R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTAM  410

Query  574  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTT  633
             L  + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T
Sbjct  411  KLVTVGEQ---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVT  467

Query  634  L  634
            +
Sbjct  468  M  468

>H257_09722
Length=518

 Score = 241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 174/488 (36%), Positives = 269/488 (55%), Gaps = 31/488 (6%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+YDY  +V+GGGSGG++ ++ AAS+G  V V++  +   QG + GLGGTCVNVGC+PKK
Sbjct  26   TSYDY--IVLGGGSGGISSARRAASYGANVLVIE--RGREQGGA-GLGGTCVNVGCVPKK  80

Query  218  LMHQSSLIGEVIHHDGA-NFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRS  276
            +M+ ++   E++H   A  F      G G   +F+W  + +  D Y+  ++  Y+  L  
Sbjct  81   VMYNAAFHAEILHSAKAYAFKGVQDVGFG---SFDWATMKTKRDSYVARLHGIYERNLAK  137

Query  277  KYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  336
              +   +   SFV+ HT+ +          T   +++AVGG P+  + PG EHAISSD  
Sbjct  138  DNITLVSGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISSDGF  192

Query  337  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMADKIGEYME  395
            F + + +P K  V+GA Y+A+E AG    +  +  V  R   +LR FD  + D + + M 
Sbjct  193  FGL-ETQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR  251

Query  396  VQSGIEFIRKTVPQSITKLENGQLLVK--WTSEDGESCE----EAFDTVLNATGRDPDVA  449
             +SG++F+  +  QSI K  +G L ++   T+EDG S        FD ++ A GR P  +
Sbjct  252  -RSGVQFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTS  310

Query  450  KLNLDKAGVKLNEKSGRIWVK-NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY  507
               ++   +  NEK G I V   E TS P +YAIGDV +   ELTPVAI AGR L+ RL+
Sbjct  311  GF-MEHTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLF  368

Query  508  NNST-VQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDT  566
                   + Y ++ T VF+    G  G +E D+  +FG  N++VY ++FV L +S+    
Sbjct  369  GGEPDACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPE  428

Query  567  RTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPT  626
                 +  +K+IC   +++ VVG H  G  A E+ Q  G+A+K+G     + + V IHPT
Sbjct  429  NKPKTA--MKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPT  485

Query  627  TAESFTTL  634
             +E F T+
Sbjct  486  ASEEFVTM  493

>SDRG_12187
Length=462

 Score = 239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 165/477 (35%), Positives = 254/477 (53%), Gaps = 28/477 (6%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDLVV+GGGSGG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++ +   + HD   +G+          T +W  L    D Y+  +N  Y   L+   V +
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNT----TVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDF  111

Query  282  ENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  341
               L SF +   +++             +V++AVGG+P     PG EH ISSD  F + +
Sbjct  112  AQGLCSFGSDGRVQI---DATPLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFELDE  168

Query  342  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMADKIGEYMEVQSGI  400
            + P +  VVGA Y+A+E AG L+G+G D  +  R   +LR FD DM   +      + GI
Sbjct  169  R-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQAVLHDAFQRDGI  226

Query  401  EFI-RKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVK  459
                  T+ +       G L V  T+ +  S    FD VL ATGR P    L L+  G++
Sbjct  227  TLQPHSTIARVDKDPTTGSLSVTTTAGEHHS---GFDCVLVATGRTPMTKDLGLEHRGIQ  283

Query  460  LNEKSGRIWVKNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STVQMDYE  517
            L+  +G I V   Q TS P ++A+GDV+D   LTPVAI AGR L+ RL+      + DY 
Sbjct  284  LS-PNGFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADYT  342

Query  518  KVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKV  577
             + + VF+    G  G++E+++++ + +D ++VY + FV + +SL         +  +K+
Sbjct  343  NIPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAHEKPTTA-MKL  401

Query  578  ICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            IC    +K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  402  ICVGPSEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>PHYRA_71927
Length=485

 Score = 238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 163/494 (33%), Positives = 255/494 (52%), Gaps = 48/494 (10%)

Query  161  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  219
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  11   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  61

Query  220  HQSSLIGEVIHHDGANFGW-NLSSGD--GNAPTFNWKQLVSNVDGYIKSINFKYKVELRS  276
              ++ +   + HD  ++G+ + ++G   G    F+W +L +  D Y+  +N  Y+  L +
Sbjct  62   FIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  121

Query  277  KYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  336
              V+  +    F     +E+       K++  ++V++AVGG+P     PG E  I SD  
Sbjct  122  SKVELIHGSAKFNEKGNVEV-----DGKELLAKNVLVAVGGKPLIPDIPGKELCIDSDGF  176

Query  337  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD-------QDMAD  388
            F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD       +D   
Sbjct  177  FELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAMA  235

Query  389  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDV  448
            K G ++   S +  + +    + T      L++   SE        +D V+ A GR P  
Sbjct  236  KDGVHLRPHSNVTRVEQVADGTKT------LVLADGSE-----HSGYDVVIYAAGRVPLT  284

Query  449  AKLNLDKAGVKLNEKSGRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY  507
            + L LD A +   +K G I V   ++TS   + A+GDV   P LTPVAI AGR LS RL+
Sbjct  285  SNLQLDNADIA-TDKHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLF  343

Query  508  NN-STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDT  566
                  ++ YE + T VF+    G  G++EE ++ ++G+DN +VY + FV + + L  + 
Sbjct  344  GGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEV  403

Query  567  RTAA------ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  620
              A           +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     + 
Sbjct  404  DEATGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNC  462

Query  621  VGIHPTTAESFTTL  634
            + IHPT  E   TL
Sbjct  463  IAIHPTAGEELVTL  476

>SPRG_05609
Length=496

 Score = 238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 166/479 (35%), Positives = 255/479 (53%), Gaps = 24/479 (5%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YD +VIGGGSGG + ++ AA++G KV +++           G+GGTCVNVGC+PKK+M  
Sbjct  6    YDYIVIGGGSGGNSSARRAAAYGAKVLLIER---GHANDGAGMGGTCVNVGCVPKKIMFN  62

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++L  E++H   A    N+   D    +F+W  L    D Y+  +N  Y+  L +  +  
Sbjct  63   AALHAEMLHSAHAYTFKNIQ--DVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNQIPL  120

Query  282  ENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  341
                  FV+ HT+E+   R      T + ++IAVGG P     PG EHAISSD  F + +
Sbjct  121  VYGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-E  174

Query  342  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQSGI  400
             +P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + D +   ME  +G+
Sbjct  175  TQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-HAGV  233

Query  401  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEA---FDTVLNATGRDPDVAKLNLDKAG  457
             F+R++   SI K  +G       S DG    ++   F+TVL A GR P    L L+   
Sbjct  234  HFVRESGITSIEKAVDGY---ADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLETTD  290

Query  458  VKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TVQMD  515
            + L+          E TS PN+YA+GDV     ELTPVAI AGR L+ RL+ N     ++
Sbjct  291  IALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACIN  350

Query  516  YEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYL  575
            Y ++ T VF+    G  G++E  +  ++G +N++VY ++F  + +++S   +   +   +
Sbjct  351  YHQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMS--EQDDKQKTAM  408

Query  576  KVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            K+IC    ++ VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  409  KLIC-IGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  466

>CCA23647
Length=496

 Score = 238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 154/470 (33%), Positives = 242/470 (51%), Gaps = 29/470 (6%)

Query  178  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHH------  231
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++   E I        
Sbjct  22   RRAATYGAKVLLIERHR---EYEGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  232  ----DGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGS  287
                   +   + S GD     F+W ++    D YI+ +N  Y   L +  +     +  
Sbjct  79   RPFASKGDTSHSFSFGD-----FDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAK  133

Query  288  FVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKT  347
             +    +++            + ++IAVGG P   + PG EHAI SD  F ++  +P K 
Sbjct  134  LIAKDRVQV----NQDSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKLET-QPKKV  188

Query  348  LVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQSGIEFIRKT  406
             VVGA Y+A+E AG    +  D  +  R   +LR FD  + D + E ME ++G+ F+RK+
Sbjct  189  AVVGAGYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKS  247

Query  407  VPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGR  466
              + I K E+ +L +     D       FD ++ A GR P    L L+  GV+LNE    
Sbjct  248  HLEKIVKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNETGHI  307

Query  467  IWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-VQMDYEKVCTAVF  524
            I    E TS P +YA+GDV     ELTPVAI AGR L+ RL+NN     + Y ++ T VF
Sbjct  308  IVDAQENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVF  367

Query  525  TPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRD  584
            +    G  G +E ++  ++GE+N++ Y + FV L +S++ D     ++C +K++C  +++
Sbjct  368  SHPPLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTC-MKLVCVGSKE  426

Query  585  KFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
              VVG H  G  A E+ Q  G+AMK+G T     + V IHPT +E   T+
Sbjct  427  T-VVGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>H310_14447
Length=501

 Score = 235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 163/489 (33%), Positives = 264/489 (54%), Gaps = 29/489 (6%)

Query  155  AEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  214
            A   N  YD +V+GGGSGG++ +  A  +G KV V++  + +      G+GGTCVNVGC+
Sbjct  2    ASLVNTSYDYIVVGGGSGGVSSASRAVEYGAKVLVIERGRVN---GGAGMGGTCVNVGCV  58

Query  215  PKKLMHQSSLIGEVIHHDGANFGW----NLSSGDGNAPTFNWKQLVSNVDGYIKSINFKY  270
            PKK+M+ + +  E++ H   ++ +    N+  G     +F+W  + +  D Y+  ++  Y
Sbjct  59   PKKIMYNAGVHAEIL-HSAKDYSFKDVVNVKFG-----SFDWAAMKAKRDAYVNWLSAAY  112

Query  271  KVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  330
            +  L  + + +      FV+ HT+E+       ++ T   ++IAVGG P+    PG EHA
Sbjct  113  EEGLGEENIDHVIGAAVFVDDHTVEV-----NGQRYTAPHILIAVGGMPQMPNIPGIEHA  167

Query  331  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADK  389
            +SSD  F +   +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + D 
Sbjct  168  VSSDGFFDL-PTQPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDL  226

Query  390  IGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEE--AFDTVLNATGRDPD  447
            + + M  ++G+ F+     +SI K  +G L V   ++ GE+  E   FD +++A GR P 
Sbjct  227  VNDEM-AKAGVAFVTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVSAIGRIPR  283

Query  448  VAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRL  506
               + LDK  V+L++    +    E T+   +YAIGDV     ELTPVAI AGR L+ RL
Sbjct  284  TQDVGLDKTHVELSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLADRL  343

Query  507  YNNST-VQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTD  565
            +   T   + Y ++ T VF+    G  G++E D+  ++G DN+ VY + F  + ++L+T 
Sbjct  344  FGKETNACIHYHQIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALATH  403

Query  566  TRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  625
            +    ++  +K++C    +  V+G H  G  A E+ Q  G+A+KLG       + V IHP
Sbjct  404  SAHKPQTA-MKLVCIGVEET-VIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIHP  461

Query  626  TTAESFTTL  634
            T AE   T+
Sbjct  462  TAAEEMVTM  470

>CCI11048
Length=496

 Score = 234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 157/474 (33%), Positives = 248/474 (52%), Gaps = 37/474 (8%)

Query  178  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGAN--  235
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++    V H + A+  
Sbjct  22   RRAATYGAKVLLIERHR---EYDGAGYGGTCVNYGCVPKKVMYNAA--AHVEHIERASDY  76

Query  236  ----------FGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFL  285
                         + S GD     F+W ++ +  D YI+ +N  Y   L +  +     +
Sbjct  77   SIRPFTSKECASHSFSFGD-----FDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGI  131

Query  286  GSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPG  345
               +    +++            + ++IAVGG P   + PG EHAI SD  F ++  +P 
Sbjct  132  AKLIAKDRVQVNQ----DSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLET-QPK  186

Query  346  KTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQSGIEFIR  404
            K  VVGA Y+A+E AG    +  D  V  R   +LR FD  + D + E ME + G+ F+R
Sbjct  187  KVAVVGAGYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEME-KDGVNFVR  245

Query  405  KTVPQSITKLENGQLLVKWTSEDGESCE--EAFDTVLNATGRDPDVAKLNLDKAGVKLNE  462
            K+  + ITK ++ +L +  T+  GE  +    FD ++ A GR P    L L++ GV LNE
Sbjct  246  KSHLEKITKAKDDKLAI--TARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALNE  303

Query  463  KSGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-VQMDYEKVC  520
                I    E TS P +YA+GDV     ELTPVAI AGR L+ RL+NN     + Y ++ 
Sbjct  304  TGHIIVDAQENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIP  363

Query  521  TAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICD  580
            T VF+    G  G +E ++  ++GE+N++ Y + FV L +S++ D     ++  +K++C 
Sbjct  364  TVVFSHPPLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTA-MKLVCV  422

Query  581  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
             +++  VVG H  G  A E+ Q  G+AMK+G T     + V IHPT +E   T+
Sbjct  423  GSKET-VVGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PHALS_09136
Length=493

 Score = 233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 165/481 (34%), Positives = 253/481 (53%), Gaps = 19/481 (4%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+  YD +VIGGGSGG+A ++ AA+ G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDMVYDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  59

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +M  +++  E ++ +  ++  N  + D     F+W  + +  D YI+ +N  Y+  L + 
Sbjct  60   VMFNTAVHVEHLNRN-KDYSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIYERNLSNA  118

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  337
             V     +   V    +++          T + V++A GG P     PG EH I SD  F
Sbjct  119  QVDVIQGIAKIVAKDKIQV-----AGHIYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFF  173

Query  338  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEV  396
             +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + D + E ME 
Sbjct  174  KLEQ-QPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-  231

Query  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
            ++G+EF+R      I K  + +L    T    E     FDT+L A GR P    L L++ 
Sbjct  232  KAGVEFVRNMSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEI  291

Query  457  GVKLNEKSGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-VQ  513
            GVKL +  G I V   E T+ P +YAIGDV +   ELTPVAI AGR L+ RL+       
Sbjct  292  GVKLAD-GGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDAC  350

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESC  573
            ++Y ++ T +F+    G  G +E ++  RFG++NI++Y + FV L  +++   R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMADPERKGKTAM  410

Query  574  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTT  633
             L  + +   ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHPT +E   T
Sbjct  411  KLVTVGE---EETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVT  467

Query  634  L  634
            +
Sbjct  468  M  468

>H257_17037
Length=498

 Score = 231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 162/484 (33%), Positives = 259/484 (54%), Gaps = 25/484 (5%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            TN  YD +VIGGGSGG++ +  A  +G KV V++  + +      G+GGTCVNVGC+PKK
Sbjct  4    TNSAYDYIVIGGGSGGVSSASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKK  60

Query  218  LMHQSSLIGEVIHHDGANFGW----NLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVE  273
            +M+ +    E++H    ++ +    N+  G     +F+W  + +  D Y+  +   Y+  
Sbjct  61   IMYNAGFHAEILH-SAKDYSFKEVVNVKFG-----SFDWAAMKAKRDAYVNWLTGAYEEG  114

Query  274  LRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISS  333
            L  + + +     +FV+ HT+E+   R      T   ++IAVGG P+  T PG EHAISS
Sbjct  115  LGEENIDHVIGAATFVDDHTVEVNGLR-----FTAPHILIAVGGVPQLPTIPGIEHAISS  169

Query  334  DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS-ILLRGFDQDMADKIGE  392
            D  F +   +P K  VVGA Y+A+E AG    +  D  V  R   +LR FD  + D + +
Sbjct  170  DGFFDLPT-QPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVND  228

Query  393  YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLN  452
             M  +SG+ F+ ++  QSI K  +G L +  T  D  +    F+ +++A GR P    + 
Sbjct  229  EM-AKSGVTFVTQSHLQSIRKEADGTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVG  287

Query  453  LDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNN-S  510
            LDK  V+L+     +    E T+ P +YAIGD  I   ELTPVAI AGR L+ RL+ + +
Sbjct  288  LDKTTVELSTDGFVVVDAQENTTVPGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEA  347

Query  511  TVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAA  570
               + Y ++ T +F+    G  G++E ++  ++G+ N+  Y ++F  L +SL        
Sbjct  348  NACIHYHQIPTVIFSHPPIGTIGLTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKP  407

Query  571  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAES  630
            ++  +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E 
Sbjct  408  QTA-MKLVCIGVEET-VVGAHVAGLGADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEE  465

Query  631  FTTL  634
              T+
Sbjct  466  MVTM  469

>HYAP_08763
Length=473

 Score = 229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 151/465 (32%), Positives = 243/465 (52%), Gaps = 21/465 (5%)

Query  174  LACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDG  233
            +A ++ AA++G KV V++  +   Q    GLGGTCVN GC+PKK+M  ++    V H + 
Sbjct  1    MASARRAATYGAKVLVIERGR---QYDGMGLGGTCVNFGCVPKKIMFNTA--AHVEHLNR  55

Query  234  ANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHT  293
            A   +++ + +     F+W ++ +  D YI  +   Y+  L +  V +   +  FV  + 
Sbjct  56   AK-DYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNK  114

Query  294  LELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGAS  353
            +++       +  T + V+IA GG P +   PG  H I SDD F +++ +P K  VVGA 
Sbjct  115  VQV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQ-QPQKVAVVGAG  168

Query  354  YVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSIT  412
            Y+A+E AG    +  D  +  R   +LR F+  + D + E ME ++G+ F+R      + 
Sbjct  169  YIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGVE  227

Query  413  KLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWV-KN  471
            K  +G+L +     + E     FDT+L A GR P    L L+  GVKL E  G I V   
Sbjct  228  KQLDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKLAE-GGFIQVDAQ  286

Query  472  EQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-VQMDYEKVCTAVFTPIEY  529
            E TS P +YAIGD  +   ELTPVAI AGR L+ RL+       ++Y ++ + +F+    
Sbjct  287  ENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPPI  346

Query  530  GCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVG  589
            G  G +E ++  ++GE+N++VY + FV L  S++        +  L  + ++   + VVG
Sbjct  347  GTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLVTVGEQ---ETVVG  403

Query  590  FHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
             H  G  A E+ Q  G+A+K+  T     + V IHPT +E   T+
Sbjct  404  VHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>PHYKE_6836
Length=493

 Score = 228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 163/481 (34%), Positives = 253/481 (53%), Gaps = 19/481 (4%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+  YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYVVIGGGSGGMASARRAATYGAKVLV---VERGRKYDGMGLGGTCVNYGCVPKK  59

Query  218  LMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSK  277
            +M  +++  E +  +  ++  N +  D     F+W  + +  D YI  +N  Y+  L+++
Sbjct  60   VMFNTAMHVEHLARN-RDYSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNLQNQ  118

Query  278  YVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  337
             V +   +   V    +++       +  T +++++A GG P     PG EH I SD  F
Sbjct  119  QVDHVQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFF  173

Query  338  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEV  396
             +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + D + E ME 
Sbjct  174  KLEQ-QPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-  231

Query  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456
            ++G++F+R +    + K  +G+L    T +  E     FDT+L A GR P    L L++ 
Sbjct  232  KAGVKFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPDFDTILYAVGRTPRTKDLGLEEI  291

Query  457  GVKLNEKSGRIWVK-NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYN-NSTVQ  513
             VKL++  G I V   E TS   +YAIGD      ELTPVAI AGR LS RL+       
Sbjct  292  NVKLSQ-DGFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESC  573
            ++Y ++ T +F+    G CG +E ++ E+FG++NI+ Y + FV L  S++   R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKTAM  410

Query  574  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTT  633
             L  + ++     V         A E+ Q  G+AMK+  T     + V IHPT AE   T
Sbjct  411  KLVCVGEEEVVVGVHVAGE---GADEMIQGFGVAMKMNATKADFDNIVAIHPTAAEELVT  467

Query  634  L  634
            +
Sbjct  468  M  468

>PITG_13427
Length=463

 Score = 227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 158/475 (33%), Positives = 244/475 (51%), Gaps = 35/475 (7%)

Query  174  LACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHD  232
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   + HD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHD  51

Query  233  GANFGWNLSSGDGNAPT---FNWKQLVSNVDGYIKSINFKY-KVELRSKYVKYENFLGSF  288
              ++G+   +  G+      F+W +L +  D Y+  +N  Y +  L +  V+    L +F
Sbjct  52   LLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATF  111

Query  289  VNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTL  348
                 +E+     G K++  ++V+IAVGG+P     PG E  I SD  F ++   P K  
Sbjct  112  NEKGNVEV-----GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFELETL-PKKVA  165

Query  349  VVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMADKIGEYMEVQSGIEFIRKTV  407
            VVGA Y+A+E AG L  +G D  +  R   +LR FD    D +   +E     E +    
Sbjct  166  VVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFD----DIVRTTLEDAMAKEGVHLRP  221

Query  408  PQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRI  467
              ++ ++E G    K       S    +D V+ A GR P  + L LDKAG+  +E  G I
Sbjct  222  HSNVARVELGADGTKTLVLTDGSKYSGYDVVIYAAGRVPLTSNLQLDKAGITTDEH-GFI  280

Query  468  WVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STVQMDYEKVCTAVFT  525
             V   ++TS   + A+GDV   P LTPVAI AGR LS RL+   +  ++ YE + T VF+
Sbjct  281  PVNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFS  340

Query  526  PIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSL------STDTRTAAESCYLKVIC  579
                G  G++EE ++ ++G+D I+VY + FV + + L      ST          +K++C
Sbjct  341  HPPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLVC  400

Query  580  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
                +K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT  E   TL
Sbjct  401  AGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTL  454

>PHYCA_7619
Length=462

 Score = 224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 161/475 (34%), Positives = 243/475 (51%), Gaps = 36/475 (8%)

Query  174  LACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHD  232
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   +HHD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHD  51

Query  233  GANFGWN--LSSGD-GNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFV  289
              ++G+   ++ G  G    F+W +L +  D Y+  +N  Y+  L +  V        F 
Sbjct  52   FLHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFN  111

Query  290  NPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLV  349
                +E+       K+I   +V+IAVGG+P     PG E  I SD  F ++   P K  V
Sbjct  112  QNGNVEV-----DGKEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFELETL-PKKVAV  165

Query  350  VGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMADKIGEYMEVQSGIEFI-RKTV  407
            VGA Y+A+E AG L  +G +  +  R   +LR FD  +   + + ME + G+       V
Sbjct  166  VGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAME-KDGVHLCPHSNV  224

Query  408  PQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRI  467
             +     +N + LV     DG S    ++ V+ A GR P    L LDKAGV   +  G I
Sbjct  225  VRVEQAADNTRTLV---LADG-SEHSGYEVVIYAAGRVPLTTSLQLDKAGVT-TDNHGFI  279

Query  468  WVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STVQMDYEKVCTAVFT  525
             V   +QTS  N++A+GD    P LTPVAI AGR LS RL+      ++ YE + T VF+
Sbjct  280  QVDEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFS  339

Query  526  PIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSL--STDTRTA----AESCYLKVIC  579
                G  G++E  ++ ++G+D I+VY + FV + + L    D  T          +K++C
Sbjct  340  HPPIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVC  399

Query  580  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
               +D+ VVG H +G  A E+ Q  G+A+K+G T     D + IHPT  E   TL
Sbjct  400  -AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>H310_11259
Length=519

 Score = 226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 169/495 (34%), Positives = 263/495 (53%), Gaps = 45/495 (9%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+YDY  +V+GGGSGG+A ++ AAS+G KV V   V+        GLGGTCVNVGC+PKK
Sbjct  27   TSYDY--IVLGGGSGGIASARRAASYGAKVLV---VERGRTLGGAGLGGTCVNVGCVPKK  81

Query  218  LMHQSSLIGEVIHH---------DGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINF  268
            +M+ ++ + E++H           G  FG           +F+W  + S  D Y+  ++ 
Sbjct  82   VMYNAAFLAEIMHSAKTYTFKGVQGVEFG-----------SFDWPAMKSKRDAYVTRLHG  130

Query  269  KYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  328
             Y+  L    +   + + +FV+ HT+ +     G K  T   +++AVGG P+  + PG E
Sbjct  131  IYERNLAKDGISLVSGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIPGIE  185

Query  329  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMA  387
             AISSD  F + + +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + 
Sbjct  186  LAISSDGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVR  244

Query  388  DKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT--SEDGESCEEAF---DTVLNAT  442
            D + + M  ++G+ F+ ++   SI K  NG L ++ T   E+G +  + F   D V+ A 
Sbjct  245  DHVNKEMR-RAGVAFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAI  303

Query  443  GRDPDVAKLNLDKAGVKLNEKSGRIWVK-NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGR  500
            GR P       D+  +  + K G I V   E T+ P +YAIGD      ELTPVAI AGR
Sbjct  304  GRTPRTTDCGFDRTDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGR  362

Query  501  LLSRRLYNNST-VQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLE  559
             L+ RL+       ++Y ++ T VF+    G  G +E D+  ++G  N++VY ++FV L 
Sbjct  363  RLADRLFGGEPDACINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLF  422

Query  560  WSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVD  619
            ++L         S  +KV+C   +++ VVG H  G  A E+ Q  G+A+K+G     + +
Sbjct  423  YTLLPPKDM--PSTAMKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDN  479

Query  620  TVGIHPTTAESFTTL  634
             + IHPT +E   T+
Sbjct  480  VIAIHPTASEELVTM  494

>PYVX_21517
Length=482

 Score = 209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 153/507 (30%), Positives = 248/507 (49%), Gaps = 78/507 (15%)

Query  153  ADAEETNYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNV  211
            A A  T  ++DL+VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNV
Sbjct  19   ARALSTAREFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNV  69

Query  212  GCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNA----PTFNWKQLVSNVDGYIKSIN  267
            GC+PKK+M+  + +   +H D  ++G+  ++  G +      F+W++L    D Y+  +N
Sbjct  70   GCVPKKIMYTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLN  129

Query  268  FKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCP--  325
              Y+  L +  V+       F     +E+        ++  + V++AVGG+P     P  
Sbjct  130  GIYERNLANSKVELLTGTARFNVDGKIEV-----DGVEVRAKKVLLAVGGKPLIPDIPVA  184

Query  326  --GGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGF  382
              G E  I SD  F +++  P K  VVGA Y+A+E AG L  +G D  +  R   +LR F
Sbjct  185  ATGKELCIDSDGFFELEQL-PRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSF  243

Query  383  DQDMADKIGEYMEVQSGIEFIRKTVPQSITK----------LENGQLLVKWTS----EDG  428
            D   +    +++   S  E +R T+  ++ +          +E  +L    T      DG
Sbjct  244  DWWNS----QFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLVLADG  299

Query  429  ESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKN-EQTSTPNIYAIGDVID  487
             S    F++V+ A GR P    L LD AGV  +E+ G I V   +QT+ P+I A+GD   
Sbjct  300  -STHTGFESVIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACG  357

Query  488  APELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDN  547
               LTP++                    YE V T VF+    G  G++E+ ++ +FG++ 
Sbjct  358  TIALTPIS--------------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQ  397

Query  548  IEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLA  607
            I++Y + FV + + +  +           ++C    +K +VG H +G  A E+ Q  G+A
Sbjct  398  IKIYKSTFVNMYYGVVNE-----------LVCAGPDEK-IVGLHVIGMGADEMLQGFGVA  445

Query  608  MKLGFTYDQMVDTVGIHPTTAESFTTL  634
            +K+G T   +   V IHPT AE   T+
Sbjct  446  VKMGATKADLDSCVAIHPTGAEELVTM  472

>HYAP_04843
Length=430

 Score = 197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 215/418 (51%), Gaps = 24/418 (6%)

Query  229  IHHDGANFGWNLSSGDGNAPT---FNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFL  285
            + HD  ++G+      G+      F+W +L +  D Y++ +N  Y+  L S  V++    
Sbjct  5    LQHDVVHYGFEKEGTGGSLGAQMHFDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGS  64

Query  286  GSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPG  345
              F     +E+       K++  ++V+IAVGG+P     PG E  I SD  F +    P 
Sbjct  65   ARFNKQGNVEV-----DGKEVLAKNVMIAVGGKPMIPDIPGKELCIDSDGFFELDTL-PK  118

Query  346  KTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMADKIGEYMEVQSGIEFIR  404
            K  V+GA Y+A+E AG L  +G +  +  R   +LR FD  +   + + M +  G+    
Sbjct  119  KVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVRTTLEDAMAID-GLHLRP  177

Query  405  KTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKS  464
             +    + +  +G   +  T  DG S    FD V+ A GR P   KL+LD AGV  N K 
Sbjct  178  NSNVARVEQAADGTNTLVLT--DG-SAHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KH  233

Query  465  GRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STVQMDYEKVCTA  522
            G I V   ++TS   ++A+GDV   P LTPVA+ AGR LS RL+ N    ++ YE + T 
Sbjct  234  GYIVVNEFQETSNSKVFAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTV  293

Query  523  VFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAA------ESCYLK  576
            VF+    G  G++E+ ++ ++G+D+I+VY ++FV + + L  +   A           +K
Sbjct  294  VFSHPPIGTIGLTEKQAQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIK  353

Query  577  VICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            ++C   ++K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT +E   TL
Sbjct  354  LVCAGKKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYIR_23431
Length=468

 Score = 195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 145/462 (31%), Positives = 218/462 (47%), Gaps = 46/462 (10%)

Query  178  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFG  237
            + AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  +S     + H   N  
Sbjct  23   RRAATYGAKVLV---VERGRKYDGMGLGGTCVNYGCVPKKVMFNAS---AHVEHLNRNAD  76

Query  238  WNLSSGDGNA---PTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTL  294
            +++++          F+W  + +  D YI  +N  Y+  L +  V     +   V  + +
Sbjct  77   YSITTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQI  136

Query  295  ELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASY  354
            E+          T + +++AVGG+P     PG EH I SD  F ++  +P K  VVGA Y
Sbjct  137  EV-----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEA-QPKKVAVVGAGY  190

Query  355  VALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITK  413
            +A+E AG    +  D  +  R   +LR FD  + D I E  E ++GI F+R +  + I K
Sbjct  191  IAIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDK  249

Query  414  LENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQ  473
              +G L +    +  E     FDT+L A GR+P    L L++ GVKL +    +    E 
Sbjct  250  QADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQEN  309

Query  474  TSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCC  532
            TS P IYAIGD  I   ELTP+                          T VF+    G  
Sbjct  310  TSVPGIYAIGDATITGWELTPIP-------------------------TVVFSHPPLGTI  344

Query  533  GMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHY  592
            G +E  + E+FG +N++VY + FV L ++++        +  L        D+ VVG H 
Sbjct  345  GYTEPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTAMKL---VTVGEDEVVVGVHV  401

Query  593  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
             G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  402  AGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>PYAR_17714
Length=444

 Score = 191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 150/482 (31%), Positives = 236/482 (49%), Gaps = 64/482 (13%)

Query  157  ETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  216
            ET YDY  +VIGGGSGG+A ++ AA  G KV +++  + +      GLGGTCVN GC+PK
Sbjct  4    ETVYDY--IVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPK  58

Query  217  KLMHQSSLIGEVIHHDGANFGWNLSSG-DGNAPTFNWKQLVSNVDGYIKSINFKYKVELR  275
            K+M  ++     + H   N  +++ SG +     F+W  + +  D YI  +N  Y+  + 
Sbjct  59   KVMWNAA---SHVEHLARNADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIG  115

Query  276  SKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDD  335
            +  +     + S      + +      T     + +++AVGG P     PG EHAI SDD
Sbjct  116  NAKIDLIEGIASLTAKDAVTV---DGKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDSDD  172

Query  336  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYM  394
             F +K  +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + D +   M
Sbjct  173  FFKLKT-QPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEM  231

Query  395  EVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLD  454
            + + G+ F+R++   +I K  +G+L V+ T +  ++    FD VL A GR+P    L L+
Sbjct  232  D-KHGVHFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLE  290

Query  455  KAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNSTV  512
              GVKL++ +G I V K E TS   +YAIGD      ELTP                   
Sbjct  291  SVGVKLSD-AGFIEVDKFENTSVDGVYAIGDATTTGYELTP-------------------  330

Query  513  QMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAES  572
                                     ++ E+FG D+++VY + FV L ++++     +  +
Sbjct  331  ------------------------PEAVEKFGADHVKVYTSTFVNLLYAMADPDHKSKTA  366

Query  573  CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFT  632
              +K++C    ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   
Sbjct  367  --MKLVCVGENEQ-VVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEELV  423

Query  633  TL  634
            T+
Sbjct  424  TM  425

>PYVX_16175
Length=446

 Score = 177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 146/481 (30%), Positives = 225/481 (47%), Gaps = 62/481 (13%)

Query  157  ETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  216
            ET YDY ++  G G   +A ++ AAS G KV +++  + +      GLGGTCVN GC+PK
Sbjct  4    ETTYDYVVLGGGSGG--VASARRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPK  58

Query  217  KLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRS  276
            K+M  ++   E ++  G      L         F+W  + +  D YI  +N  Y+  L +
Sbjct  59   KVMFNAAAHVEHLNRAGDYSVTTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGN  118

Query  277  KYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  336
              +     +   V  + LE+       K  T +++++A GG P     PG EHAI SD  
Sbjct  119  AKIDVVQGVARVVARNQLEV-----DGKVYTGKNLLLAPGGVPTLPPIPGIEHAIDSDGF  173

Query  337  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYME  395
            F +++ +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + D +   ME
Sbjct  174  FKLEQ-QPRKVAVVGAGYIAVEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME  232

Query  396  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDK  455
             ++G++F+R++    I KLE+G+L +    +        FDTVL A GR+P  A L L+ 
Sbjct  233  -KNGVQFVRRSHITRIDKLEDGKLQITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEA  291

Query  456  AGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNSTVQ  513
             GV L++K G I V   E TS   +YAIGD      ELTP                    
Sbjct  292  IGVDLDDK-GFIKVDAQENTSAAGVYAIGDATTTGWELTP--------------------  330

Query  514  MDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESC  573
                                    D+  ++G +N++VY + FV L  +++        + 
Sbjct  331  -----------------------PDAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKTAM  367

Query  574  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTT  633
             L  +  +   + VVG H  G  A E+ Q  G+A+KLG T     + V IHPT +E   T
Sbjct  368  KLVTVGAQ---ETVVGVHVAGEGADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELVT  424

Query  634  L  634
            +
Sbjct  425  M  425

>PYIR_20273
Length=505

 Score = 153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 139/503 (28%), Positives = 222/503 (44%), Gaps = 42/503 (8%)

Query  144  ETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWG  203
             +S + TS       + +YDLVVIGGG GG   + +AA  G K   ++        +   
Sbjct  16   RSSAQVTSARAFSSASTEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGS  67

Query  204  LGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYI  263
            LGGTC+NVGCIP K +  S+ +     HD A +G  +S       + N+ +++ + +  +
Sbjct  68   LGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGIEVSE-----VSMNFGKMMKSKEKAV  122

Query  264  KSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGR-----  318
            K++    +   +   V Y    G  V  + + +     G + +T ++++IA G       
Sbjct  123  KTLTGGIEQLFKKNKVTYIKGHGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLP  182

Query  319  PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSIL  378
            P  +    G+   S+  +    KK P   +VVGA  + LE     K +G   KV V   L
Sbjct  183  PVPVDNAAGKIVDSTGALEL--KKVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYL  238

Query  379  LR---GFDQDMADKIGEYMEVQS-GIEFIRKTVPQSIT----KLENGQLLVKWTSEDGES  430
             R   G D ++  +  + ++ Q  G EF  K     +      L             G +
Sbjct  239  DRVCPGLDLELGKEFTKLLKKQGLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAA  298

Query  431  CEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAP  489
                 D VL ATGR P    L L+  G++  +K GRI V +  +T  PNI+AIGDVI  P
Sbjct  299  STIECDAVLVATGRRPYTNGLGLENMGIQ-TDKFGRISVDDHFRTQIPNIFAIGDVIAGP  357

Query  490  ELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIE  549
             L   A + G   +  +       ++Y  +   ++T  E    G +EE  KE        
Sbjct  358  MLAHKAEEEGIACAETIAGKHG-HVNYNAIPGVIYTFPEVASVGKTEEQLKEEG-----V  411

Query  550  VYHTNFVPLEWSLSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAM  608
             Y+    P+    ++  R   E+   +KVI DK  DK ++G H +  NAGE+     L M
Sbjct  412  TYNVGKFPMLA--NSRARAVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGM  468

Query  609  KLGFTYDQMVDTVGIHPTTAESF  631
            + G + + +  T   HPT +E+F
Sbjct  469  EYGASSEDIARTCHAHPTLSEAF  491

>PYAP_22645
Length=1565

 Score = 155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 141/491 (29%), Positives = 227/491 (46%), Gaps = 41/491 (8%)

Query  150   TSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCV  209
             +STA +E     YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+
Sbjct  1093  SSTASSE-----YDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCL  1139

Query  210   NVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFK  269
             NVGCIP K +  ++ +     HD + +G  +S         N+  ++ + +  +K++   
Sbjct  1140  NVGCIPSKALLHATHMYHAAQHDFSKYGIEVSD-----VKMNFDGMMKSKEKAVKTLTGG  1194

Query  270   YKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGR-----PKELTC  324
              +   +   V Y    G  V+ + + +     G + +  ++++IA G       P  +  
Sbjct  1195  IEGLFKKNKVTYVKGFGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDN  1254

Query  325   PGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFD  383
               G+   S+  +    KK P   +V+G   + LE     K +G  V V+     +  G D
Sbjct  1255  AAGKIVDSTGALEL--KKVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLD  1312

Query  384   QDMADKIGEYMEVQSGIEFIRKT-VPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNAT  442
             Q++  +  + ++ Q G++F   T V  S    +   L V+  +    S  EA DTVL AT
Sbjct  1313  QELGKEFTKLLKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVAT  1370

Query  443   GRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRL  501
             GR P    L L++ G++  +K GRI V N  +T  PNI+AIGDVI  P L   A + G  
Sbjct  1371  GRRPFTKGLGLEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIA  1429

Query  502   LSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWS  561
                 +       ++Y+ +   ++T  E    G +EE  KE       E    N       
Sbjct  1430  CVENIAGLHG-HVNYDAIPGVIYTYPEVASVGKTEEQLKE-------EGVAYNVGKFPMM  1481

Query  562   LSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  620
              ++  R  AES  ++KVI DKT D+ ++G H +  NAGE+     L M+ G   + +  T
Sbjct  1482  ANSRARAVAESDGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRT  1540

Query  621   VGIHPTTAESF  631
                HPT +E+F
Sbjct  1541  CHAHPTLSEAF  1551

>CCI10477
Length=494

 Score = 150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 137/482 (28%), Positives = 220/482 (46%), Gaps = 38/482 (8%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  26   EYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKALL  77

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
             SS +     HD  + G  +S         N+ +++   +  +K +    +   +   V 
Sbjct  78   HSSHLFHTAQHDFKSIGIEVSD-----LRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVA  132

Query  281  YENFLGSFV--NPHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCP--GGEHAISSDD  335
            Y    G  V  N  ++ L    KG + IT ++++IA G     L  CP    +  I    
Sbjct  133  YIKGHGKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKIVDST  192

Query  336  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMADKIGEYM  394
               + K  P + +VVGA  + LE     + +G +V V+   + +  G D ++  +  + +
Sbjct  193  GALVLKSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAKTL  252

Query  395  EVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEA---FDTVLNATGRDPDVAKL  451
            + Q G++F   T   S TK+      V  T ED +   E     D VL ATGR P    L
Sbjct  253  QKQ-GLKFKFATRVTS-TKVNGDN--VTITMEDAKGGNETSMECDVVLVATGRRPFTNGL  308

Query  452  NLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  510
             L+  G++  +K GRI V +  +T+ P+IYAIGDVI  P L   A + G + +  +    
Sbjct  309  GLESMGIQ-TDKMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGK  366

Query  511  TVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAA  570
               ++Y  +   ++T  E  C G +EE  KE       E    N        ++  R   
Sbjct  367  HGHVNYNAIPGVIYTHPEVACVGKTEEQLKE-------EGISYNVGKFPMIANSRARAVG  419

Query  571  ES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  629
            E+  ++KV+  K  D+ ++G H +  NAGE+     L ++ G   + +  T   HPT +E
Sbjct  420  ETDGFVKVLAQKDNDR-ILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTLSE  478

Query  630  SF  631
            + 
Sbjct  479  AL  480

>CCA22989
Length=494

 Score = 149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 137/483 (28%), Positives = 219/483 (45%), Gaps = 40/483 (8%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQK-VCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  219
            +YDL+VIGGG GG   + +AA  G K VC+        +GT   LGGTC+NVGCIP K +
Sbjct  26   EYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPSKAL  76

Query  220  HQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYV  279
              SS +     HD    G   S         N+ +++   +  +K +    +   +   V
Sbjct  77   LHSSHMFHTAQHDFKAIGIEASD-----LRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKV  131

Query  280  KYENFLGSFVNPHTLELWHP--RKGTKQITTRDVVIAVGGRPKEL-TCP--GGEHAISSD  334
             Y    G+ V    + + +    KG + I  ++++IA G     L  CP    +  I   
Sbjct  132  AYIKGHGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRIVDS  191

Query  335  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMADKIGEY  393
                + K  P + +VVGA  + LE     + +G +V V+   + +  G D ++  +  + 
Sbjct  192  TGALVLKSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREFAKT  251

Query  394  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEA---FDTVLNATGRDPDVAK  450
            ++ Q G +F   T    +T  +  +  V  T ED +   E     D VL ATGR P    
Sbjct  252  LQKQ-GFKFKFAT---KVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPFTQN  307

Query  451  LNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  509
            L L+  G++  +K GRI V N  +T  PNIYAIGDVI  P L   A + G + +  +   
Sbjct  308  LGLENLGIQ-TDKLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLG  365

Query  510  STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTA  569
                ++Y  +   ++T  E  C G +EE  KE       E    N        ++  R  
Sbjct  366  KQGHVNYNAIPGVIYTFPEVACVGRTEEQLKE-------EGVSYNVGKFPMIANSRARAV  418

Query  570  AES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  628
             E+  ++KV+  K  D+ ++G H +  NAGE+     L ++ G + + +  T   HPT +
Sbjct  419  GETDGFVKVLAQKDNDR-ILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTLS  477

Query  629  ESF  631
            E+ 
Sbjct  478  EAL  480

>HYAP_12621
Length=501

 Score = 141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 132/483 (27%), Positives = 218/483 (45%), Gaps = 41/483 (8%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
             S+ +     H+  ++G      D    T N+ Q++   +  ++++    +       V 
Sbjct  86   HSTHLLHTAQHEFKSYGI-----DAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVT  140

Query  281  YENFLGSFVNPHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSD  334
            Y   +G       + +    R+G   +T +++++A G       P  +    G+   S+ 
Sbjct  141  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  200

Query  335  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMADKIGEY  393
             +   +   P   +VVGA  + LE     K +G  V V+        G D+    +  + 
Sbjct  201  ALALTRV--PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKL  258

Query  394  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DGESCEEAFDTVLNATGRDPDVAK  450
            ++ Q G+EF   T    +T  E    +V  T+E    G+      DTVL ATGR    A 
Sbjct  259  LKKQ-GLEFQFGT---KVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAG  314

Query  451  LNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  509
            L L++ G++  +K GRI V +  QT  P ++AIGDVI    L   A + G      +   
Sbjct  315  LGLEQMGIQ-TDKQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGK  373

Query  510  STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTA  569
                ++Y  +   ++T  E+   G +EE+ K    E N+  +     P+    ++  RT 
Sbjct  374  HG-HVNYGAIPNVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PMMA--NSRARTV  425

Query  570  AES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  628
            AE+   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +
Sbjct  426  AEADGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLS  484

Query  629  ESF  631
            E+F
Sbjct  485  EAF  487

 Score = 35.0 bits (79),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 64/166 (39%), Gaps = 32/166 (19%)

Query  66   HWLSESQDEFATSFGVDS---------------KATKHVTSPF--VWSSNPTAFVGGCDD  108
            H L  +Q EF  S+G+D+               KA + +T+    ++S N   ++ G   
Sbjct  89   HLLHTAQHEF-KSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKGVGK  147

Query  109  LLTYFRSGVGVGNPQGATPNGSPTEK-----TAEADVPMSETSVEET------STADAEE  157
            L    +  V + + QG   NG+ T K     T     P+    V+        ST     
Sbjct  148  LAAKGQVSVTLADRQG---NGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTGALAL  204

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWG  203
            T     LVV+G G  GL         G KV V++Y+  +  G   G
Sbjct  205  TRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKG  250

>PYU1_G014259
Length=244

 Score = 134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 131/245 (53%), Gaps = 19/245 (8%)

Query  134  KTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDY  192
            + A+     S   +  T +  +++ + +YD +VIG GSGG+A S+ AAS+   +V V++ 
Sbjct  8    QLAKRKALRSMRQISSTRSLSSQQQD-EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEK  66

Query  193  VKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGD--GNAPTF  250
             +         LGGTCVNVGC+PKK+M+ ++ +  ++H D  ++G+    G   G   +F
Sbjct  67   AR---------LGGTCVNVGCVPKKIMYLAADMNHMLHRDAFHYGFETQDGKRIGENVSF  117

Query  251  NWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRD  310
            +W +L    D Y+  +N  Y+  L +  V       +F     +E+       K++  ++
Sbjct  118  HWNKLKERRDAYVLRLNGIYERNLANSKVDLLQGTAAFNAQGNVEV-----DGKEVKAKN  172

Query  311  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDV  370
            ++IAVGG+P     PG EH I SD  F ++   P K  VVGA Y+A+E AG L G+G D 
Sbjct  173  ILIAVGGKPLIPDIPGKEHCIDSDGFFELEVL-PKKVAVVGAGYIAVELAGVLNGLGSDT  231

Query  371  KVMVR  375
             +  R
Sbjct  232  TIFCR  236

>PYVX_21248
Length=502

 Score = 136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 146/497 (29%), Positives = 236/497 (47%), Gaps = 41/497 (8%)

Query  147  VEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGG  206
            +  TS A A  ++ +YD+VVIGGG GG   + +AA  G K   ++        +   LGG
Sbjct  21   LSSTSRAFASASDPEYDVVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGG  72

Query  207  TCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTF--NWKQLVSNVDGYIK  264
            TC+NVGCIP K +  S+ +     HD A +G  +     N        ++ V+ + G I+
Sbjct  73   TCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEGVKANLGGMMKAKEKAVTTLTGGIE  132

Query  265  SINFKYKVELRSKYVKYENFLGSFVNPHTLEL-WHPRKGTKQITTRDVVIAVGGRPKEL-  322
            S+  K KV     Y+K     G  V  + + +  +  KG + +T ++++IA G  P  L 
Sbjct  133  SLFKKNKV----TYIKGH---GKIVGKNEVAVALNDDKGNQTVTAKNIMIATGSEPAPLP  185

Query  323  --TCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLR  380
                   +  I          K P   +VVGA  + LE     K +G   KV V   L R
Sbjct  186  PVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KVTVVEFLDR  243

Query  381  ---GFDQDMADKIGEYMEVQSGIEFIRKT-VPQSITKLENGQLLVKWTSEDGESCEEAFD  436
               G D +++ +  + ++ Q G+EF   T V  S  K +N  L V+  S  G +     D
Sbjct  244  ACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVE-PSAGGSAASIECD  301

Query  437  TVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVA  495
            TVL ATGR P    L L++ G++  +K GR+ V +  +T  PNIYA GDVI    L   A
Sbjct  302  TVLVATGRRPFTEGLGLEQMGIQ-TDKQGRVEVDSHFRTQIPNIYAFGDVIKGAMLAHKA  360

Query  496  IQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNF  555
             + G +    + +     ++Y+ +   ++T  E    G +EE+ K     +    Y+   
Sbjct  361  EEEG-VACAEIISGKHGHVNYDAIPGVIYTTPEVASVGKTEEELK-----NEGVTYNVGK  414

Query  556  VPLEWSLSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTY  614
             P+    ++  RT AE+  ++K++ DK  D+ ++G H +  NAGE+     L ++ G + 
Sbjct  415  FPMMA--NSRARTIAEADGFVKILADKATDR-ILGVHIIAGNAGEMVAEGVLGLEYGASS  471

Query  615  DQMVDTVGIHPTTAESF  631
            + +  T   HPT +E+F
Sbjct  472  EDIARTCHAHPTLSEAF  488

>SPRG_19943
Length=343

 Score = 132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 139/276 (50%), Gaps = 18/276 (7%)

Query  151  STADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  210
            + A+   +   YD +V+G GSGG++ +  A ++G KV V++           GLGGTCVN
Sbjct  10   TVANYARSMATYDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTCVN  66

Query  211  VGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKY  270
            VGC+PKK+M  ++L  E++H   A     +   D     F+W  + +  D Y+K +N  Y
Sbjct  67   VGCVPKKIMFNAALHAEMLHSARAYAFKGVQ--DIQFGAFDWAAMKAKRDAYVKWLNDMY  124

Query  271  KVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  330
               +    V        FV+ HT+E+   R      T + ++IAVGG P     PG EHA
Sbjct  125  GEGMLEDKVDLVMGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHA  179

Query  331  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADK  389
            ISSD  F + + +P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + D 
Sbjct  180  ISSDGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDL  238

Query  390  IGEYME------VQSGIEFIRKTVPQSITKLENGQL  419
            +   ME      VQ+ ++ +   V +++  +    L
Sbjct  239  VNSEMEHAGKEKVQTAMKLVCIGVEETVVGVHVAGL  274

 Score = 41.2 bits (95),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (2%)

Query  575  LKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  255  MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  313

>PYU1_G001737
Length=133

 Score = 122 bits (305),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 4/117 (3%)

Query  1    MASGVRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFED  60
            MAS V L +TLV +   S  T+HIAGW+ C  F KA +V +AMQ+LYPD + F +H F D
Sbjct  20   MAS-VNLQDTLVRA--GSGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFAD  76

Query  61   REAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGV  117
            R+AF+ WL  S+D+FAT FG  S A  H +SPFVW SN   FVGGCD LL   R  +
Sbjct  77   RDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVW-SNAGEFVGGCDALLATIRGSI  132

>PHYCA_123621
Length=495

 Score = 126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 142/496 (29%), Positives = 227/496 (46%), Gaps = 43/496 (9%)

Query  149  ETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  208
             TSTA A  +  DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC
Sbjct  16   RTSTARAFSSTNDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTC  67

Query  209  VNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTF--NWKQLVSNVDGYIKSI  266
            +NVGCIP K +  S+ +     HD  ++G +      N P      ++ V+ + G I+S+
Sbjct  68   LNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVTTLTGGIESL  127

Query  267  NFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGR-----PKE  321
              K KV     Y+K   F             +  KG + +  ++++IA G       P  
Sbjct  128  FKKNKV----TYIK--GFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVP  181

Query  322  LTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLR  380
            +    G+   S+  +     + P   +VVGA  + LE     K +G  V V+        
Sbjct  182  VDNAAGKIIDSTGALSLT--RVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACP  239

Query  381  GFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DGESCEEAFDT  437
            G D+    +  + ++ Q G++F   T    +T  E    +VK T+E    G++     DT
Sbjct  240  GMDKGAVKEFTKLLKKQ-GLDFKFST---KVTASEVNGDVVKLTTEPSKGGDASSIECDT  295

Query  438  VLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAI  496
            VL ATGR    A L L++ G++  +K GRI V +  +T  P I+AIGDVI    L   A 
Sbjct  296  VLVATGRRAFTAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAE  354

Query  497  QAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFV  556
            + G      +       ++Y  +   ++T  E+   G +EE+ K    E N+  +     
Sbjct  355  EEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----  408

Query  557  PLEWSLSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  615
            P+    ++  RT AE+   +KV+ DK  DK  +G H +  NAGE+     + ++ G   +
Sbjct  409  PMMA--NSRARTVAEADGLVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASE  465

Query  616  QMVDTVGIHPTTAESF  631
             +  T   HPT +E+F
Sbjct  466  DLARTCHAHPTLSEAF  481

>PHYSO_556052
Length=500

 Score = 126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 143/483 (30%), Positives = 223/483 (46%), Gaps = 41/483 (8%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  33   DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  84

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTF--NWKQLVSNVDGYIKSINFKYKVELRSKY  278
             S+ +     HD  ++G +      N P      ++ V  + G I+S+  K KV     Y
Sbjct  85   HSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVKTLTGGIESLFKKNKV----TY  140

Query  279  VKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCPGGEHA---ISSD  334
            +K   F             +  KG + +  ++++IA G     L   P    A   I S 
Sbjct  141  IK--GFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKIIDST  198

Query  335  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMADKIGEY  393
                +K+  P   +VVGA  + LE     K +G  V V+  +     G D++   +  + 
Sbjct  199  GALSLKRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKL  257

Query  394  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DGESCEEAFDTVLNATGRDPDVAK  450
            ++ Q G+EF   T    +T  E    +VK T+E    G++     DTVL ATGR    A 
Sbjct  258  LKKQ-GLEFQFGT---KVTASEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAG  313

Query  451  LNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  509
            L L++ G++  +K GRI V +  +T  P I+AIGDVI    L   A + G      +   
Sbjct  314  LGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENIAGK  372

Query  510  STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTA  569
                ++Y  +   ++T  E+   G +EE+ K     + IE Y+    P+    ++  RT 
Sbjct  373  HG-HVNYGAIPGVIYTFPEFASVGKTEEELK----AEGIE-YNVGKFPMMA--NSRARTV  424

Query  570  AES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  628
            AES   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +
Sbjct  425  AESDGLVKVLADKKTDKL-LGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLS  483

Query  629  ESF  631
            E+F
Sbjct  484  EAF  486

>PHALS_09942
Length=496

 Score = 126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 129/467 (28%), Positives = 208/467 (45%), Gaps = 45/467 (10%)

Query  179  EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGW  238
            +AA  G K   ++        +   LGGTC+NVGCIP K +  S+ +     H+  N+G 
Sbjct  47   KAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHEFKNYGI  98

Query  239  NLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLEL-W  297
                 D    T N+ Q++   D  +K++    +   +   V Y    G       + +  
Sbjct  99   -----DAPEVTANFPQMMKAKDKAVKTLTSGIESLFKKNKVTYIKGSGKISAQGEVSVAL  153

Query  298  HPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGA  352
            H  KG + +  ++++IA G       P  +    G+   S+  +    K+ P   +VVGA
Sbjct  154  HDHKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIVDSTGALEL--KRIPDHLVVVGA  211

Query  353  SYVALECAGFLKGMGYDVKVMVRSIL---LRGFDQDMADKIGEYMEVQSGIEFIRKTVPQ  409
              + LE     K +G   KV V   L     G D+       + ++ Q G+EF   T   
Sbjct  212  GVIGLELGSVYKRLG--AKVTVVEYLDDACTGMDKGSVKDFIKLLKKQ-GLEFKFGT---  265

Query  410  SITKLENGQLLVKWTSE---DGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGR  466
             +T  E    +VK T+E    G++     DTVL ATGR    A L L++ G++  +K GR
Sbjct  266  KVTASEINGDVVKLTTEPSQGGDAASIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKFGR  324

Query  467  IWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFT  525
            I V    +T  P I+AIGDVI    L   A + G +    +       ++Y  +   ++T
Sbjct  325  IEVDEAFRTQVPGIFAIGDVIKGAMLAHKAEEEG-IACAEIIAGKHGHVNYGAIPGVIYT  383

Query  526  PIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAES-CYLKVICDKTRD  584
              E+   G +EE+ K     + IE Y+    P+    ++  RT  ES   +KV+ DK  D
Sbjct  384  FPEFASVGKTEEELK----AEGIE-YNVGKFPMMA--NSRARTVGESDGMVKVLADKKTD  436

Query  585  KFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            K  +G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  437  KL-LGVHIIASNAGEMISEGVIGIEYGAASEDVARTSHAHPTLSEAF  482

>PHYKE_9680
Length=498

 Score = 125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 119/440 (27%), Positives = 204/440 (46%), Gaps = 33/440 (8%)

Query  204  LGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYI  263
            LGGTC+NVGCIP K +  S+ +     HD  ++G      D      N+ Q++   +  +
Sbjct  66   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGI-----DAPGVKANFPQMMKAKEKAV  120

Query  264  KSINFKYKVELRSKYVKYENFLGSFVNPHTLEL-WHPRKGTKQITTRDVVIAVGGR----  318
            K++    ++  +   V Y    G       + +     KG + +  ++++IA G      
Sbjct  121  KTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTPL  180

Query  319  -PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRS  376
             P  +    G+   S+  +    K+ P   +VVGA  + LE     K +G  V V+  + 
Sbjct  181  PPVPVDNEAGKIIDSTGALVL--KRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQD  238

Query  377  ILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEA--  434
                G D++   +  + ++ Q G++F   T    +T  E    +VK T+E  +  +EA  
Sbjct  239  AACPGMDKECVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEASI  294

Query  435  -FDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELT  492
              DTVL ATGR    A L L++ G++  +K GR+ V +  +T  P I+AIGDVI    L 
Sbjct  295  ECDTVLVATGRRAYTAGLGLEQMGIQ-TDKLGRVEVDDAFRTQVPGIFAIGDVIKGAMLA  353

Query  493  PVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYH  552
              A + G      +       ++Y  +   ++T  E+   G +EE+ K     + IE Y+
Sbjct  354  HKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELK----AEGIE-YN  407

Query  553  TNFVPLEWSLSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  611
                P+    ++  RT AE+   +KV+ DK  DK  +G H +  NAGE+     +A++ G
Sbjct  408  VGKFPMMA--NSRARTVAEADGLVKVLSDKKTDKM-LGVHIIASNAGEMIAEGVIALEYG  464

Query  612  FTYDQMVDTVGIHPTTAESF  631
             + + +  T   HPT +E+ 
Sbjct  465  ASSEDIARTCHAHPTLSEAL  484

>PITG_15359
Length=496

 Score = 125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 142/507 (28%), Positives = 235/507 (46%), Gaps = 43/507 (8%)

Query  138  ADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSP  197
            A +     ++  + TA A  ++ DYD+VVIGGG GG   + +AA  G K   ++      
Sbjct  6    ASLSRRSVALRSSVTARAFSSSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE------  59

Query  198  QGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTF--NWKQL  255
              +   LGGTC+NVGCIP K +  S+ +     HD  ++G +      N P    + ++ 
Sbjct  60   --SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKSKEKA  117

Query  256  VSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAV  315
            V  + G I+S+  K KV     Y+K    + +          +  KG + +  ++++IA 
Sbjct  118  VKTLTGGIESLFKKNKV----TYIKGHGKISA--QGEISVALNDNKGNETVKAKNIIIAT  171

Query  316  GGR-----PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDV  370
            G       P  +    G+  I S     +K+  P   +VVGA  + LE     K +G  V
Sbjct  172  GSEVTPLPPVPVDNAAGK-IIDSTGALELKRV-PEHLVVVGAGVIGLELGSVYKRLGAKV  229

Query  371  KVM-VRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---  426
             V+        G D++   +  + ++ Q G++F   T    +T  E    +VK T+E   
Sbjct  230  TVVEFLDAACPGSDKEAVKEFTKLLKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSK  285

Query  427  DGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDV  485
             G++     DTVL ATGR    + L L++ G++  +K GRI V +  +T  P I+AIGDV
Sbjct  286  GGDASSIECDTVLVATGRRAFTSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDV  344

Query  486  IDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGE  545
            I    L   A + G      +       ++Y  +   ++T  E+   G +EE+ K     
Sbjct  345  IKGAMLAHKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELK----A  399

Query  546  DNIEVYHTNFVPLEWSLSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAM  604
            + IE Y+    P+    ++  RT AE+   +KV+ DK  DK  +G H +  NAGE+    
Sbjct  400  EGIE-YNVGKFPMMA--NSRARTIAEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEG  455

Query  605  GLAMKLGFTYDQMVDTVGIHPTTAESF  631
             + ++ G   + +  T   HPT +E+F
Sbjct  456  VIGIEYGAASEDLARTCHAHPTLSEAF  482

>PHYRA_72215
Length=499

 Score = 124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 123/441 (28%), Positives = 203/441 (46%), Gaps = 35/441 (8%)

Query  204  LGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTF--NWKQLVSNVDG  261
            LGGTC+NVGCIP K +  S+ +     HD  ++G +      N P      ++ V+ + G
Sbjct  67   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPGVTANFPQMMKAKEKAVTTLTG  126

Query  262  YIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGR---  318
             I+S+  K KV     Y K                 +  KG + +  ++++IA G     
Sbjct  127  GIESLFKKNKVTYIKGYGKVS------AQGEVSVALNDNKGNETVKAKNIIIATGSEVTP  180

Query  319  --PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VR  375
              P  +    G+   S+  +   +   P   +VVGA  + LE     K +G  V V+  +
Sbjct  181  LPPVPVDNAAGKIIDSTGALALTRV--PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQ  238

Query  376  SILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DGESCE  432
                 G D++   +  + ++ Q G++F   T    +T  E    +VK T+E    G +  
Sbjct  239  DAACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGNAAT  294

Query  433  EAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPEL  491
               DTVL ATGR    A L L++ G++  +K GRI V +  +T  P I+AIGDVI    L
Sbjct  295  IECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAML  353

Query  492  TPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVY  551
               A + G      +       ++Y  +   ++T  E+   G +EE+ K     + IE Y
Sbjct  354  AHKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELK----AEGIE-Y  407

Query  552  HTNFVPLEWSLSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKL  610
            +    P+    ++  RT AE+   +KV+ DK  DK ++G H +  NAGE+     +A++ 
Sbjct  408  NVGKFPMMA--NSRARTVAEADGLVKVLADKKTDK-MLGVHIIASNAGEMISEGVIALEY  464

Query  611  GFTYDQMVDTVGIHPTTAESF  631
            G + + +  T   HPT +E+F
Sbjct  465  GASSEDIARTCHAHPTLSEAF  485

>SPRG_09825
Length=492

 Score = 123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 137/497 (28%), Positives = 226/497 (45%), Gaps = 53/497 (11%)

Query  153  ADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  212
            A A  T  DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVG
Sbjct  17   AAAFSTGSDYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVG  68

Query  213  CIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKV  272
            CIP K +  ++       HD  N G  +     +    ++ +L+++ D  +K +    + 
Sbjct  69   CIPSKALLSATHKYHAAQHDFKNVGIEV-----DGLRIDFAKLMASKDKSVKILTGGIEG  123

Query  273  ELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCPGGEHA-  330
              +   V Y    G  V  + + +     G K ++T++++IA G     L   P    A 
Sbjct  124  LFKKNKVDYIKGFGKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAG  183

Query  331  --ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAD  388
              I S     +K+  P   +V+G   + LE       +G  + V+           + AD
Sbjct  184  KIIDSTGALSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYAD  231

Query  389  KIGEYMEVQSGIEFIRKTVPQSI----------TKLENGQL-LVKWTSEDGESCEEAFDT  437
            KI   M+ ++G EF +    Q +          +K+E  ++ L    +  GE+     DT
Sbjct  232  KICPTMDFETGREFQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDT  291

Query  438  VLNATGRDPDVAKLNLDKAGVKLNEKSGRIWV--KNEQTSTPNIYAIGDVIDAPELTPVA  495
            VL ATGR P    L L++ G++  +K GRI V   N +T+  NI+AIGD I+   L   A
Sbjct  292  VLVATGRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKA  350

Query  496  IQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNF  555
             + G      +       ++Y  +   V+T  E    G +EE+ K      N+  Y+   
Sbjct  351  EEEGISCVESIAGGHG-HVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGK  404

Query  556  VPLEWSLSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTY  614
             P+    ++  RT  E+  ++K++  K  DK ++G H +  NAGE+     L ++ G + 
Sbjct  405  FPMMA--NSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASA  461

Query  615  DQMVDTVGIHPTTAESF  631
            + +  T   HPT +E+F
Sbjct  462  EDIGRTCHAHPTLSEAF  478

>SDRG_06945
Length=492

 Score = 120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 135/497 (27%), Positives = 224/497 (45%), Gaps = 53/497 (11%)

Query  153  ADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  212
            A A  T  DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVG
Sbjct  17   AAAFSTGSDYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVG  68

Query  213  CIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKV  272
            CIP K +  ++       HD  N G  +     +    ++ +L+++ D  +K +    + 
Sbjct  69   CIPSKALLSATHKYHAAQHDFKNVGIEV-----DGLRIDFAKLMASKDKSVKILTGGIEG  123

Query  273  ELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCPGGEHA-  330
              +   + Y    G  V  + + +     G K ++T++++IA G     L   P    A 
Sbjct  124  LFKKNKIDYIKGFGKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAG  183

Query  331  --ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAD  388
              I S     +K+  P   +V+G   + LE       +G  + V+           + AD
Sbjct  184  KIIDSTGALSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYAD  231

Query  389  KIGEYMEVQSGIEFIRKTVPQSI----------TKLENGQL-LVKWTSEDGESCEEAFDT  437
            KI   M+ ++G EF +    Q +          +K+E  ++ L    +  GE+     DT
Sbjct  232  KICPTMDFETGREFQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDT  291

Query  438  VLNATGRDPDVAKLNLDKAGVKLNEKSGRIWV--KNEQTSTPNIYAIGDVIDAPELTPVA  495
            VL ATGR P    L L++ G++  +K GRI V   N +T+  NI+AIGD I+   L   A
Sbjct  292  VLVATGRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKA  350

Query  496  IQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNF  555
             + G      +       ++Y  +   V+T  E    G +EE+ K          Y+   
Sbjct  351  EEEGISCVESIAGGHG-HVNYNAIPGVVYTFPEVASVGKTEEELKAAG-----VAYNVGK  404

Query  556  VPLEWSLSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTY  614
             P+    ++  RT  E+  ++K++  K  DK ++G H +  NAGE+     L ++ G + 
Sbjct  405  FPMMA--NSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASA  461

Query  615  DQMVDTVGIHPTTAESF  631
            + +  T   HPT +E+F
Sbjct  462  EDIGRTCHAHPTLSEAF  478

>PYAR_20075
Length=469

 Score = 117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 129/484 (27%), Positives = 210/484 (43%), Gaps = 71/484 (15%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            +YDLVV+GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  30   EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  81

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
             S+ +     HD   +G  +S         ++  ++ + +  +K++    +   +   V 
Sbjct  82   HSTHLFHTAQHDFKKYGIEVSD-----VQMDFGGMMKSKEKAVKTLTAGIESLFKKNKVT  136

Query  281  YENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMK  340
            Y    G                 K +   +V +A+          G E  + S     +K
Sbjct  137  YIKGFG-----------------KIVAANEVAVALNDN------NGNETIVDSTGALALK  173

Query  341  KKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGI  400
            K  P   +V+G   + LE     K +G  V V+           + AD++   ++++ G 
Sbjct  174  KA-PEHLVVIGGGVIGLELGSVYKRLGSKVTVV-----------EYADRVCPGLDLELGK  221

Query  401  EFIRKTVPQSI-----TKLENGQL------LVKWTSEDGESCEEAFDTVLNATGRDPDVA  449
            EF +    Q +     TK+   Q+      L    +  GE+     DTVL ATGR P   
Sbjct  222  EFAKLLKKQGLDLQFKTKVTASQVNGDKVTLTVEPAAGGEATTIEADTVLVATGRRPFTN  281

Query  450  KLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  508
             L L++ G++  +K GRI V    +T  P+IYAIGDVI  P L   A + G      +  
Sbjct  282  GLGLEQMGIQ-TDKMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIAG  340

Query  509  NSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRT  568
                 ++Y  +   ++T  E    G +EE  K    E+ I  Y+    P+    ++  R 
Sbjct  341  LHG-HVNYNAIPGVIYTHPEVASVGKTEEQLK----EEGI-AYNVGKFPMMA--NSRARA  392

Query  569  AAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  627
              E   ++KV+ DKT DK ++G H +  NAGE+     L ++ G   + +  T   HPT 
Sbjct  393  VGEGDGFVKVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHPTL  451

Query  628  AESF  631
            +E+F
Sbjct  452  SEAF  455

>H257_01186
Length=496

 Score = 116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 126/483 (26%), Positives = 210/483 (43%), Gaps = 41/483 (8%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            +YDL+VIG G  GL C+ E+A  G+ V ++D         S  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
            ++ L     +H G  +G + S             ++  V+  + S     + +L++ +V+
Sbjct  80   EAVLHLSGFNHHGF-YGKSYSR-----ERITLSDILHRVNVVVSSEMDVIRAQLKAAHVQ  133

Query  281  YENFLGSFVNPHTLELWHPRKGTKQITTR--DVVIAVGGRPKE--LTCPGGEHAISSDDI  336
                   F N + + + +     + +  R    +IA G  P    +    GE  + SD I
Sbjct  134  IIPGKARFENANEVSVENGTVHREAMIYRGKKFLIACGTYPAHSPVVPVDGEVILDSDGI  193

Query  337  FWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMADKIGEY  393
                K E P   +VVGA  + +E A  L  + G  V V+  R  +L   D ++   +   
Sbjct  194  LEASKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSALKME  253

Query  394  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAF-DTVLNATGRDPDVAKLN  452
            M    G  F+     QS+T++  G         D  S + +F + +L   GR  +   LN
Sbjct  254  MR-HKGARFLLGETIQSVTRVAKG------VRVDFASGKSSFAEALLYCVGRQANTDALN  306

Query  453  LDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS--  510
            L+  G+  N++      K  QTS P+IYA GD I AP L   +++ GRL +  ++++   
Sbjct  307  LEGVGLAKNKRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHHEDQ  366

Query  511  -TVQMDYEKVCTAVFTPIEYGCCGMSEED-SKERFGEDNIEVYHTNFVPLEWSLSTDTRT  568
             T Q+D       ++T  E    G +E+  +KE     N  V    +  L   +    + 
Sbjct  367  PTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKE---GRNYAVGMAKYSELAKGMMAGGQK  423

Query  569  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  628
             A    LK++ D    + V+G H +G  A E+     +AM +        D V  +PT A
Sbjct  424  GA----LKILFDPD-TQSVLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFNYPTLA  478

Query  629  ESF  631
            E++
Sbjct  479  EAY  481

>PYAR_16840
Length=536

 Score = 115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 128/510 (25%), Positives = 217/510 (43%), Gaps = 69/510 (14%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDLVVIG G     C+ E+A  G++V V+D        T  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  222  SSL-IGEVIHHDGANFGWNLSSGDGNAPTFNWKQLV-SNVDGYIKSINFKYKVELRSKYV  279
            + L +    HH      +++ +   +   +  K++V S VD          K +L++  +
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVD--------VIKAQLKAARI  140

Query  280  KYENFLGSFVNPHTLELW-------HPRKGTKQITTRDVVIAVGGRPKE--LTCPGGEHA  330
             Y   L  F N H + +               ++     +IA G RP    L    G+  
Sbjct  141  DYLPGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVI  200

Query  331  ISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-----VRSILLRGFD  383
            + SD I     +E P   +VVGA  + +E A  L  + G+ V V+     VR++L     
Sbjct  201  LDSDQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---S  257

Query  384  QDMA------------------DKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTS  425
            +DM+                  D+I   ++ +  ++  R  + ++I K+E     VK   
Sbjct  258  RDMSLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFL  317

Query  426  EDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDV  485
              G+    + D +L   GR      LNL+  G+  N++      K  QT  P+IYA+GD 
Sbjct  318  TSGKVT--SGDALLYTVGRQASTDGLNLEAVGLGRNKRGLLTVNKAYQTEKPHIYAVGDC  375

Query  486  IDAPELTPVAIQAGRLLSRRLYNNS---TVQMDYEKVCTAVFTPIEYGCCGMSEED-SKE  541
            I AP L   +++ GRL +  ++      T Q++       ++T  E    G +E+  + E
Sbjct  376  IGAPSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSE  435

Query  542  RFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVT  601
            +    N E+    +      L+    +      LK++ D    + V G H +G  A E+ 
Sbjct  436  KV---NYEIGLAKY----SELAKGQMSGGAFGMLKILFDPDTLR-VHGVHAIGEGATEII  487

Query  602  QAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
                +A+ +G +     D V  +PT AE++
Sbjct  488  HIGQVAIAMGCSLTYFRDAVFNYPTLAEAY  517

>PHYRA_73883
Length=551

 Score = 115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 134/515 (26%), Positives = 221/515 (43%), Gaps = 73/515 (14%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  97

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++L     H  G       +   G +  F  + ++  V     +     + +L    V+ 
Sbjct  98   AAL-----HLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQL  152

Query  282  ENFLGSFV--NPHTL-----ELWHPRKGTKQITTRDVVIAVGGRPKELTCPG--------  326
             N    F+  N + +     E +      K+ T+ D+   V    K L C G        
Sbjct  153  INGTARFLPGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKFLVCVGTRPARHPD  212

Query  327  ----GEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILL  379
                GE    SD + W K K  P + +VVGA  V +E A  +  + G DV V+  R  +L
Sbjct  213  IPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDGRKEIL  272

Query  380  RGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVL  439
               D+++++ +  Y   Q+G  F+ +   +S+ K +NG++ V    E G++     D +L
Sbjct  273  NMADKEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIFVHL--ESGKTV--VGDGLL  327

Query  440  NATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQA  498
               GR  +V  LNL+  G+   +K GRI V N  QT+ P+IYA GD+I  P L   +++ 
Sbjct  328  YTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAAPHIYAAGDIIGFPGLASTSMEQ  386

Query  499  GRLLSRRL-----YNNSTVQMDY-----EKVCT----------AVFTPIEYGCCGMSEED  538
            GRL S  +      NN  +  D      ++V T           ++T  E    G +E+ 
Sbjct  387  GRLASVHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQ  446

Query  539  -SKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFVVGFHYLGPN  596
             +KE+        Y       E  L+          +LK+I C  T    ++G H +G  
Sbjct  447  LTKEQ------TPYEVGMARYE-ELARGQMLGGVPGFLKIIFCPDTLK--ILGVHAIGEG  497

Query  597  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            A E+     + M  G   +   + V  +PT AE++
Sbjct  498  ATEIIHIGQVVMSTGGNLEYFRNAVFNYPTLAEAY  532

>H310_00561
Length=497

 Score = 111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 126/484 (26%), Positives = 210/484 (43%), Gaps = 43/484 (9%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            +YDL+VIG G  GL C+ E+A  G+ V ++D         S  +GG CV+ G IP K   
Sbjct  29   EYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSKTFR  80

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
            ++ L     +H G  +G + S           + ++  V+  + S     + +L++ +V+
Sbjct  81   EAVLHLSGFNHHGF-YGKSYSR-----ERITLRDILHRVNVVVSSEMDVIRAQLKAAHVQ  134

Query  281  YENFLGSFVNPHTLELWHPRKGTKQITTR--DVVIAVGGRPKE--LTCPGGEHAISSDDI  336
                   F N + + +     G++    R    +IA G  P    +    GE  + SD I
Sbjct  135  IIPGKARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSDGI  194

Query  337  FWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMADKIGEY  393
                K E P   +VVGA  + +E A  L  + G  V V+  R  +L   D ++   +   
Sbjct  195  LDASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDDEIVSALKME  254

Query  394  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAF-DTVLNATGRDPDVAKLN  452
            M    G  F+     QS+ ++  G         D  S + +F + +L   GR  +   LN
Sbjct  255  MR-HKGARFLLGETIQSVKRVRKG------VRVDFASGKSSFAEALLYCVGRQANTDTLN  307

Query  453  LDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS-  510
            L+  G+  N K G + V  + QT+ P+I+A GD I AP L   +++ GRL +  ++ +  
Sbjct  308  LEGVGLSKN-KRGLLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRHED  366

Query  511  --TVQMDYEKVCTAVFTPIEYGCCGMSEED-SKERFGEDNIEVYHTNFVPLEWSLSTDTR  567
              T Q+D       ++T  E    G +E+  +KE     N  V    +  L   +    +
Sbjct  367  QPTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKE---GRNYAVGVAKYSELAKGMMAGGQ  423

Query  568  TAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  627
              A    LK++ D      V+G H +G  A E+     +AM +        D V  +PT 
Sbjct  424  KGA----LKLLFDPDSHS-VLGVHAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTL  478

Query  628  AESF  631
            AE++
Sbjct  479  AEAY  482

>CCI50816
Length=807

 Score = 112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 127/488 (26%), Positives = 208/488 (43%), Gaps = 45/488 (9%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDL+VIG G     C+ +AA  G+ V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            + L      H G  +G + S             ++  V+  I+S     +V+ +S  V Y
Sbjct  82   AVLHLSGYRHHGF-YGKSYS-----MKNVTIDDILYRVNRVIQSEVDLLRVQFKSARVDY  135

Query  282  ENFLGSFVNPHTLELWHP-----RKGTKQITTRDVVIAVGGRPKE-LTCP-GGEHAISSD  334
             +    F + H + +         K TK++     ++A G RP      P  G+    SD
Sbjct  136  ISGHARFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSD  195

Query  335  DIF-WMKKKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMADKIG  391
             I  W  ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++   + 
Sbjct  196  QILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLT  255

Query  392  EYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKL  451
              M    G  F+     +S+ K   G +LV   S  G+      D +L   GR  +   L
Sbjct  256  HEMR-NHGARFLLGETIESVDKSSRG-VLVGLKS--GKKVHG--DALLYVVGRQANTDGL  309

Query  452  NLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  510
            NL+ AG+  N + G + V  + QT  P+I+A+GD I AP L   +++ GRL S  ++N  
Sbjct  310  NLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNED  368

Query  511  T-------VQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLS  563
                     Q+        ++T  E    G +E+    +  + N E+    +  L     
Sbjct  369  ESNDDSIPSQLKTGNFPYGIYTIPEISMVGHTEKQLTSQ--QINYEIGVAKYSELA---K  423

Query  564  TDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  623
                 A+    LK++ D    K + G H +G  A E+     +A+ +G T     D V  
Sbjct  424  GQMSGASADGMLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFN  482

Query  624  HPTTAESF  631
            +PT AE++
Sbjct  483  YPTLAEAY  490

>PHYCA_504445
Length=548

 Score = 110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 129/515 (25%), Positives = 221/515 (43%), Gaps = 73/515 (14%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +DL+VIG G  G  C+ ++A  G+ V ++D            +GG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKSGKSVAIID--------KRDMMGGVCVHTGTVPSKTFRE  97

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++L     H  G       +   G +  F  + ++  V     +     + +L    V+ 
Sbjct  98   AAL-----HLTGYRHKAFYNGHGGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQL  152

Query  282  ENFLGSFV--NPHTL-----ELWHPRKGTKQITTRDVVIAVGGRPKELTCPG--------  326
             N    F+  N H +     E +      ++ ++ D+   V    K L C G        
Sbjct  153  INGTARFLPGNNHMVAVLSNESYETATDAQRHSSADICKRVLTADKFLVCVGTRPARRPD  212

Query  327  ----GEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILL  379
                GE    SD + W K K  P + ++VGA  V +E A  +  + G DV V+  R  +L
Sbjct  213  IPFDGETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEIL  272

Query  380  RGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVL  439
               D+++++ +  Y   Q+G  F+     +S+ K   G++ V    E G++     D +L
Sbjct  273  NMADKEVSEALC-YSMAQTGTRFLTGETIKSVEKTAKGEVFVHL--ESGKTV--VGDGLL  327

Query  440  NATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQA  498
               GR  +V  LNL+  G++  +K GRI V N  QT+ P+IYA GD+I  P L   +++ 
Sbjct  328  YTVGRQGNVEGLNLEAVGLE-PDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQ  386

Query  499  GRLLSRRLYNNSTVQM----------DYEKVCT----------AVFTPIEYGCCGMSEED  538
            GRL S  +  + T+            D ++V T           ++T  E    G +E+ 
Sbjct  387  GRLASVHMRTSKTLNTKELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQ  446

Query  539  -SKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFVVGFHYLGPN  596
             +KE+      EV    +      L+          +LK+I C +T    ++G H +G  
Sbjct  447  LTKEQV---PYEVGKARY----EELARGQMLGGVPGFLKIIFCPETLK--ILGVHAIGEG  497

Query  597  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            A E+     + M  G   +   + V  +PT AE++
Sbjct  498  ATEIIHIGQVVMSTGGDLEYFRNAVFNYPTLAEAY  532

>PHYRA_47253
Length=481

 Score = 110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 129/495 (26%), Positives = 207/495 (42%), Gaps = 52/495 (11%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            + L      H G  +G + S       T   + ++  V   + S     + +L++  V  
Sbjct  53   AVLHLSGYRHHGF-YGKSYS-----MKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDV  106

Query  282  ENFLGSFVNPHTLELWH-----PRKGTKQITTRD---------VVIAVGGRPKE--LTCP  325
                  F + H + +        +KG    +T D          +IA G RP    L   
Sbjct  107  VPGFARFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVPI  166

Query  326  GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGF  382
             G+  I SD I      + P   +VVGA  + +E A  +  + G+ V V+  R  +L   
Sbjct  167  DGQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFC  226

Query  383  DQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNAT  442
            D+++   +   M+  +G  F+   + ++I K+E     VK   + G+    + D +L   
Sbjct  227  DREIISNLTYEMQ-SNGARFL---LGETIKKVETADNRVKVFFDSGKVL--SADALLYTV  280

Query  443  GRDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQAGRL  501
            GR      LNL+  G+  N + G I V KN QT  P+IYA GD I AP L   +++ GRL
Sbjct  281  GRQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRL  339

Query  502  LSRRLYNNS-----TVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFV  556
             S  ++        T Q++       ++T  E    G +E    ++  +D +  Y     
Sbjct  340  ASCHMWKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTE----QQLTKDCVN-YEIGVA  394

Query  557  PLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  616
                        A     LK++ D    K V G H +G  A E+     +AM +  +   
Sbjct  395  KYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLTY  453

Query  617  MVDTVGIHPTTAESF  631
              D V  +PT AE++
Sbjct  454  FRDAVFNYPTLAEAY  468

>PYAP_19280
Length=512

 Score = 110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 128/494 (26%), Positives = 215/494 (44%), Gaps = 54/494 (11%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDLVVIG G     C+ E+A  G++V V+D      +G+S  +GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE  81

Query  222  SSL-IGEVIHHDGANFGWNLSSGDGNAPTFNWKQLV-SNVDGYIKSINFKYKVELRSKYV  279
            + L +    HH      +++ +   +   +  K++V S VD          K +L++  V
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVD--------VIKAQLKAARV  133

Query  280  KYENFLGSFVNPHTLELWH------------PRKGTKQITTRDVVIAVGGRPKE--LTCP  325
             Y      F N H + +               R  T+ +     +IA G RP    L   
Sbjct  134  DYIPGFARFENDHEISIVREPTETNPEEEEPARLATR-LQADKFLIACGTRPAHSPLVPI  192

Query  326  GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGF  382
             G+    SD I     +E P   +VVGA  + +E A  L  + G+ V V+  R  +L   
Sbjct  193  DGKVVFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFC  252

Query  383  DQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNAT  442
            D ++   +   M V+ G  F+   + +SI K+E     VK     G+      D +L   
Sbjct  253  DNEVVSMLQHEMRVK-GARFL---LGESIQKVEKTAKGVKVLLNSGKVTSA--DALLYTV  306

Query  443  GRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLL  502
            GR  +   LN++  G+  N++      K+ QT   +IYA+GD I AP L   +++ GRL 
Sbjct  307  GRQANTDGLNIEAVGLSRNQRGLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLA  366

Query  503  SRRLYNN----STVQMDYEKVCTAVFTPIEYGCCGMSEED-SKERFGEDNIEVYHTNFVP  557
            +  +++     +T Q++       ++T  E    G +E+  + E+    N E+    +  
Sbjct  367  ACHMWDGNCDIATSQLENGNYPYGIYTIPEISMVGKTEQQLTAEKV---NYEIGIAKYSE  423

Query  558  LEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617
            L           + +  LK++ D    K   G H +G  A E+     +A+ +G +    
Sbjct  424  LAKG---QMGGGSHNGILKILFDPDTLKL-HGVHAIGEGATEIIHIGQVAIAMGCSLTYF  479

Query  618  VDTVGIHPTTAESF  631
             D V  +PT AE++
Sbjct  480  RDAVFNYPTLAEAY  493

>CCA16670
Length=520

 Score = 110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 126/489 (26%), Positives = 211/489 (43%), Gaps = 47/489 (10%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDL+VIG G     C+ +AA  G+ V ++D  K S       +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--KKS------SVGGVCVHTGTIPSKTFRE  81

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKS-INFKYKVELRSKYVK  280
            + L      H G  +G + S             ++  V+  I+S ++F  + + +S  + 
Sbjct  82   AVLHLSGYRHHGF-YGKSYS-----MKHVTIDDILYRVNRVIQSEVDF-LRTQFKSARID  134

Query  281  YENFLGSFVNPHTLELWHP-----RKGTKQITTRDVVIAVGGRPKE-LTCP-GGEHAISS  333
            Y +    F + H + +         K TK++     ++A G RP      P  G+    S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  334  DDIF-WMKKKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMADKI  390
            D I  W  ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++   +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  391  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAK  450
               M    G  F+   + +S+ K   G   V    + G+      D +L   GR  +   
Sbjct  255  THEMR-NHGARFLLGEIIESVEKSSRG---VSVGLKSGKKVHG--DALLYVVGRQANTDG  308

Query  451  LNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  509
            LNL+ AG+  N + G + V  + QT  P+I+A+GD I AP L   +++ GRL S  ++N 
Sbjct  309  LNLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNE  367

Query  510  STV-------QMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSL  562
            +         Q+        ++T  E    G +E++      + N E+    +  L    
Sbjct  368  NEANDDSIPSQLTTGNFPYGIYTIPEISMVGKTEKELTSL--KMNYEIGVAKYSELA---  422

Query  563  STDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  622
                  A+    LK++ D    K   G H +G  A E+     +A+ +G T     D V 
Sbjct  423  KGQMSGASADGMLKILFDPISLKL-YGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVF  481

Query  623  IHPTTAESF  631
             +PT AE++
Sbjct  482  NYPTLAEAY  490

>PPTG_00938
Length=550

 Score = 109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 139/549 (25%), Positives = 230/549 (42%), Gaps = 81/549 (15%)

Query  128  NGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKV  187
            N   TE  AE + P+++T  E  ++         +DL+VIG G  G  C+ ++A  G+ V
Sbjct  22   NAFSTEAPAE-NRPLTDTLRELRASEH-------FDLIVIGSGPAGQKCAIDSAKHGKSV  73

Query  188  CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNA  247
             ++D            LGG CV+ G +P K   +++L     H  G       +   G +
Sbjct  74   AIID--------KRDMLGGVCVHTGTVPSKTFREAAL-----HLTGYRHKAFYNGQAGPS  120

Query  248  PTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSF-------VNPHTLELWHPR  300
              F  + ++  V     +     + +L    V+  N    F       V   + E +   
Sbjct  121  KRFGVEDILQRVRKVENAETDITRHQLLRNGVQLINGTARFLPGSKNMVAVLSNESYETA  180

Query  301  KGTKQITTRDVVIAVGGRPKELTCPG------------GEHAISSDDIFWMKKKE-PGKT  347
               K+ ++ D+   V    K L C G            GE    SD++ W K K  P + 
Sbjct  181  TDAKRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDGETIFDSDELLWGKVKSVPRRL  240

Query  348  LVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMADKIGEYMEVQSGIEFIRK  405
            ++VGA  V +E A  +  + G DV V+  R  +L   D+ +++ +  Y   Q+G  F+  
Sbjct  241  IIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADKQVSEALC-YSMTQTGTRFLTG  299

Query  406  TVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSG  465
               +S+ K   G++ V    E G++     D +L   GR  +V  LNL+  G+   +K G
Sbjct  300  ETIKSVEKSPKGEVFVHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLS-PDKRG  354

Query  466  RIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQ----------M  514
            RI V N  QT+ P+IYA GD+I  P L   +++ GRL S  +  +  +            
Sbjct  355  RIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMD  414

Query  515  DYEKVCT----------AVFTPIEYGCCGMSEED-SKERFGEDNIEVYHTNFVPLEWSLS  563
            D ++V T           ++T  E    G +E+  +KE       +V +   V     L+
Sbjct  415  DPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKE-------QVPYEVGVARYEELA  467

Query  564  TDTRTAAESCYLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  622
                      +LK+I C  T   F  G H +G  A E+     + M  G T +   + V 
Sbjct  468  RGQMLGGVPGFLKIIFCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVF  525

Query  623  IHPTTAESF  631
             +PT AE++
Sbjct  526  NYPTLAEAY  534

>PYVX_20512
Length=528

 Score = 108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 128/500 (26%), Positives = 211/500 (42%), Gaps = 58/500 (12%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            DYDLVVIG G     C+ E+A  G++V ++D            +GG CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  88

Query  221  QSSL-IGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYV  279
            ++ L +    HH      +++ +   +   +  +++V++    IK+       +L++  V
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKNITIDDILYRVQRVVASEVDVIKA-------QLKAARV  141

Query  280  KYENFLGSFVNPHTLELWHPRKGT----------------KQITTRDVVIAVGGRPKE--  321
             Y     SF +PH L +      +                 ++     +IA G RP    
Sbjct  142  DYIAGTASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNP  201

Query  322  LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSIL  378
            L    G+    SD I   +  + P   +VVGA  + +E A  +  + G+ V V+  R  +
Sbjct  202  LVPVDGKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDI  261

Query  379  LRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTV  438
            L   D ++   +   M    G  F+     +SI K E G   VK     G+      D +
Sbjct  262  LSFCDTEIISNLMYEMR-SKGARFLLGETIKSIEKSERG---VKVFFNSGKVATA--DAL  315

Query  439  LNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQA  498
            L   GR      LNL+  G+  N +      KN QT   +IYA GD I AP L   +++ 
Sbjct  316  LYTVGRQASTDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQ  375

Query  499  GRLLSRRLYNN-----STVQMDYEKVCTAVFTPIEYGCCGMSEED-SKERFGEDNIEVYH  552
            GRL +  ++++     ST Q+D       ++T  E    G +E+  +KE     N EV  
Sbjct  376  GRLAACHMWDDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQQLTKEGV---NYEVGI  432

Query  553  TNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  611
              +  L     T    A     LK++ C  + + F  G H +G  A E+     +A+ +G
Sbjct  433  AKYSELAKGQMTG---AIAGGMLKILFCPDSLELF--GVHAIGEGATEIIHIGQVAIAMG  487

Query  612  FTYDQMVDTVGIHPTTAESF  631
             +     + V  +PT AE++
Sbjct  488  CSLTYFRNAVFNYPTLAEAY  507

>PYU1_G011605
Length=524

 Score = 108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 127/494 (26%), Positives = 210/494 (43%), Gaps = 51/494 (10%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            DYDLVVIG G     C+ E+A  G++V ++D      + TS  +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD------KKTS--VGGVCVHTGTIPSKTFR  91

Query  221  QSSL-IGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYV  279
            ++ L +    HH      +++ +   +   +  K++V++    IK+       +L++  V
Sbjct  92   EAVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKA-------QLKAARV  144

Query  280  KYENFLGSFVNPHTLELWH-PRKGTKQ-----------ITTRDVVIAVGGRPKE-LTCP-  325
            +Y      F N H + +   P  G  Q           +     +IA G RP      P 
Sbjct  145  EYIPGFARFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPI  204

Query  326  GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGF  382
             G+    SD I     ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L   
Sbjct  205  DGKVIFDSDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFC  264

Query  383  DQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNAT  442
            D ++   +   M    G  F+       + K  NG + V   S    S     D +L   
Sbjct  265  DNEIISNLTYEMR-SKGARFLLGETINRVEKTGNG-VTVYLNSGKVTSA----DAMLYTV  318

Query  443  GRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLL  502
            GR      LNL+   +  N +      K+ QT  P+IYA+GD I AP L   +++ GRL 
Sbjct  319  GRQASTDGLNLEAVNLSRNPRGLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLA  378

Query  503  SRRLYNNS----TVQMDYEKVCTAVFTPIEYGCCGMSEED-SKERFGEDNIEVYHTNFVP  557
            +  +++      T Q++       ++T  E    G +E+  +KE     N E+    +  
Sbjct  379  ACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGV---NFEIGIAKYSE  435

Query  558  LEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617
            L     + +        LK++ D T  K   G H +G  A E+     +A+ +G +    
Sbjct  436  LAKGQMSGSTAGG---MLKILFDPTTLKL-FGVHAIGEGATEIIHIGQVAIAMGCSVTYF  491

Query  618  VDTVGIHPTTAESF  631
             D V  +PT AE++
Sbjct  492  RDAVFNYPTLAEAY  505

>PPTG_09121
Length=520

 Score = 107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 127/498 (26%), Positives = 203/498 (41%), Gaps = 55/498 (11%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  32   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  83

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            + L      H G  +G + S       T   + ++  V   + S     + +L++  V  
Sbjct  84   AVLHLSGYRHHGF-YGKSYS-----MKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDV  137

Query  282  ENFLGSFVNPHTLELWHPRKGTK-----------------QITTRDVVIAVGGRPKE--L  322
                  F N H + +       K                 +I     +IA G RP    L
Sbjct  138  VPGFARFENEHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNPL  197

Query  323  TCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILL  379
                G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+  R  +L
Sbjct  198  IPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDIL  257

Query  380  RGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVL  439
               D ++   +   M+  +G  F+   + +++ K+E     VK     G+      D +L
Sbjct  258  SFCDSEIISNLTYEMQ-SNGARFL---LGETVKKVETTDKRVKVFFNSGKVLSA--DALL  311

Query  440  NATGRDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQA  498
               GR      LNL+  G+  N + G I V KN QT  P+IYA GD I AP L   +++ 
Sbjct  312  YTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQ  370

Query  499  GRLLSRRLYN-----NSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHT  553
            GRL S  ++N      +T Q++       ++T  E    G +E    ++  +D +  Y  
Sbjct  371  GRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQTE----QQLTKDCVN-YEI  425

Query  554  NFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  613
                           A     LK++ D    K V G H +G  A E+     +AM +  +
Sbjct  426  GIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCS  484

Query  614  YDQMVDTVGIHPTTAESF  631
                 D V  +PT AE++
Sbjct  485  LTYFRDAVFNYPTLAEAY  502

>PHALS_12028
Length=579

 Score = 107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 132/526 (25%), Positives = 222/526 (42%), Gaps = 71/526 (13%)

Query  150  TSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCV  209
            T T      +  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV
Sbjct  24   TDTLSKLRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCV  75

Query  210  NVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFK  269
            + G IP K   +++L     H  G       +   G +  F  + ++  V     +    
Sbjct  76   HTGTIPSKTFREAAL-----HLTGYRHKAFYNGQGGPSKRFGVEDILQRVKKVESAETDI  130

Query  270  YKVELRSKYVKYENFLGSFV--NPHTLELWH----------PRKGTKQITTR-----DVV  312
             + +L    V+  N    F+  + H + +             R  +  I  R       +
Sbjct  131  TRHQLLRNGVQLINGTARFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFL  190

Query  313  IAVGGRP-KELTCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GY  368
            + VG RP +    P  GE    SD + W K K  P + +VVGA  + +E A  +  + G 
Sbjct  191  LCVGTRPARRADIPFDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGT  250

Query  369  DVKVM-VRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSED  427
            DV V+  R  +L   D ++++ +   M  Q+G  F+   V +S+ K   G++ V    E 
Sbjct  251  DVTVIDARKEILNMADNEVSEALCFSM-AQTGTRFLTGEVIKSVEKSAMGEVFVHL--ES  307

Query  428  GESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVI  486
            G++     D +L   GR  +V  LNL+  G+ + +K G+I V N  QT+ P+IYA GD+I
Sbjct  308  GKTV--VGDGLLYTVGRQGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDII  364

Query  487  DAPELTPVAIQAGRLLSRRL-----YNNSTVQMDY-----EKVCT----------AVFTP  526
              P L   +++ GRL S  +      N+  +  D      ++V T           ++T 
Sbjct  365  GFPGLASTSMEQGRLASVHMRTSQPLNDQKISDDKKMDDPDRVRTRMRSGEVFPFGIYTV  424

Query  527  IEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDK  585
             E    G +E    ++  ++ +  Y       E  L+          +LK+I C  T   
Sbjct  425  PEISMVGKNE----QQLTKEGVP-YEVGVARYE-ELAKGQMLGGVPGFLKIIFCPDTLK-  477

Query  586  FVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
             V+G H +G  A E+     + M    T +   + V  +PT AE++
Sbjct  478  -VLGVHAIGEGATEIIHIGQVLMSTDGTLEYFRNAVFNYPTLAEAY  522

>SDRG_14446
Length=495

 Score = 105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 124/482 (26%), Positives = 208/482 (43%), Gaps = 41/482 (9%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            +YDLVVIG G   + C+ E+   G+ V V+D           G+GG CV+ G IP K   
Sbjct  28   EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  79

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
            +S L      H G  +G + +  +          ++  V+  +       + +L++  V 
Sbjct  80   ESVLHLSGFRHQGF-YGKSYARDN-----ITLNDILGRVNTVVSKEMDVIQAQLKAARVD  133

Query  281  YENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKE--LTCPGGEHAISSDDIF-  337
                L  F N + + +        ++  +  ++A G RP    L    G+  + SD I  
Sbjct  134  LVPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGKVILDSDQILN  193

Query  338  WMKKKEPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMADKIGEYME  395
                K P   +VVGA  + +E A  L  + G +V V+  R+ +L   D ++   +   M 
Sbjct  194  HGTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLKMEMR  253

Query  396  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDK  455
               G  F+     +S+   +NG   VK     G++     + +L   GR  +   LNL+ 
Sbjct  254  -HKGARFLLGESIKSVEHFKNG---VKVEFNSGKAMFA--EALLYCVGRQANTDGLNLEA  307

Query  456  AGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN---ST  511
             G+  N + G I V  + QTS P+IYA GD I AP L   +++ GRL +  ++++   +T
Sbjct  308  VGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTT  366

Query  512  VQMDYEKVCTAVFTPIEYGCCGMSEED-SKERFGEDNIEVYHTNFVPL-EWSLSTDTRTA  569
             Q++       ++T  E    G +E+  +KE     N  V    F  L +  +S D    
Sbjct  367  SQLESGNYPYGIYTIPEISMVGKTEQQLTKE---GANYAVGLAKFSELAKGQMSGDIEG-  422

Query  570  AESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  629
                 LK++ D    +  +G H +G  A E+     +AM +        D V  +PT AE
Sbjct  423  ----ILKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTLAE  477

Query  630  SF  631
             +
Sbjct  478  GY  479

>PITG_18935
Length=480

 Score = 103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 135/505 (27%), Positives = 229/505 (45%), Gaps = 55/505 (11%)

Query  138  ADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSP  197
            A +     ++  + TA A  ++ DYD+VVIGGG GG   + +AA  G K   ++      
Sbjct  6    ASLSRRSVALRSSVTARALSSSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE------  59

Query  198  QGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVS  257
              +   LGGTC+NVGCIP K +  S+ +     HD  ++G      D      N+ Q++ 
Sbjct  60   --SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGI-----DAPEVKANFPQMMK  112

Query  258  NVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLEL-WHPRKGTKQITTRDVVIAVG  316
            + +  +K++    ++  +   V Y    G       + +  +  KG + +  ++++IA G
Sbjct  113  SKEKAVKTLTGGIELLFKKNKVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATG  172

Query  317  GR-----PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVK  371
                   P  +    G+  I S     +K+  P   +VVGA    +E   FL        
Sbjct  173  SEVTPLPPVPVDNAAGK-IIDSTGALELKRV-PEHLVVVGAGVTVVE---FLDAA-----  222

Query  372  VMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DG  428
                     G D++   +  + ++ Q G++F   T    +T  E    +VK T+E    G
Sbjct  223  -------CPGSDKEAVKEFTKLLKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGG  271

Query  429  ESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVID  487
            ++     DTVL ATGR    + L L++ G++  +K GRI V +  +T  P I+AIGDVI 
Sbjct  272  DASSIECDTVLVATGRRAFTSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIK  330

Query  488  APELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDN  547
               L   A + G      +       ++Y  +   ++T  E+   G +EE+ K     + 
Sbjct  331  GAMLAHKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELK----AEG  385

Query  548  IEVYHTNFVPLEWSLSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGL  606
            IE Y+    P+    ++  RT AE+   +KV+ DK  DK  +G H +  NAGE+     +
Sbjct  386  IE-YNVGKFPMMA--NSRARTIAEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVI  441

Query  607  AMKLGFTYDQMVDTVGIHPTTAESF  631
             ++ G   + +  T   HPT +E+F
Sbjct  442  GIEYGAASEDLARTCHAHPTLSEAF  466

>PHALS_10055
Length=516

 Score = 103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 125/495 (25%), Positives = 204/495 (41%), Gaps = 51/495 (10%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            +YDL+VIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
            ++ L      H G  +G + S       T   + ++  V   + S     + +L++  V 
Sbjct  83   EAVLHLSGYRHHGF-YGKSYS-----MKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVD  136

Query  281  YENFLGSFVNPHTLELWHP--RKGTKQITTRDV-----------VIAVGGRPKE--LTCP  325
                   F N H + +      +  K+I+   V           +IA G RP    L   
Sbjct  137  VIPGFARFENEHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIPI  196

Query  326  GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGF  382
             G+  I SD I        P   +V+GA  + +E A  +  + G+ V V+  R  +L   
Sbjct  197  DGKVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPFC  256

Query  383  DQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNAT  442
            D ++   +   M+  +G  F+   + +++ K+E  +  VK     G+      D +L   
Sbjct  257  DLEIISNLTYEMQ-SNGARFL---LGETVKKVETTKNQVKVFFNSGKVLSA--DALLYTV  310

Query  443  GRDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQAGRL  501
            GR      LNL+  G+  N + G I V KN QT  P+IYA GD I AP L   +++ GRL
Sbjct  311  GRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGRL  369

Query  502  LSRRLYN-----NSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFV  556
             S  ++       +T Q++       ++T  E    G +E+   +     N   Y     
Sbjct  370  ASCHMWKPNEELAATSQLESGNYPYGIYTIPEISMVGQTEQQLTK-----NCINYEIGIA  424

Query  557  PLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  616
                        A     LK++ D      ++G H +G  A E      +AM +G +   
Sbjct  425  KYSELAKGQMMGAMAGGTLKILFDP-ETLSLLGVHAIGEGATETIHIGQVAMAMGCSLTY  483

Query  617  MVDTVGIHPTTAESF  631
              D V  +PT AE++
Sbjct  484  FRDAVFNYPTLAEAY  498

>H310_02523
Length=494

 Score = 103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 123/473 (26%), Positives = 208/473 (44%), Gaps = 57/473 (12%)

Query  179  EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGW  238
            +AA  G K   ++      +GT   LGGTC+NVGCIP K +   + +     HD  + G 
Sbjct  45   KAAQLGLKTACVE-----ARGT---LGGTCLNVGCIPSKALLHGTHLYHAAQHDFKSVGI  96

Query  239  NLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWH  298
             + +      + ++ QL+ + +  +K +    +   +   V Y    G  V    L +  
Sbjct  97   KVDN-----VSIDFNQLMKSKEKTVKILTGGIEGLFKKNKVDYVKGFGKIVAKGQLSVAL  151

Query  299  PRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGAS  353
               G + + T++++IA G       P  +   GG+   S+  +    K+ P   +VVG  
Sbjct  152  NGGGNQTLHTKNILIATGSEVTPLPPVPVDNEGGKIVDSTGALSL--KRIPNHLVVVGGG  209

Query  354  YVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITK  413
             + LE       +G  + V+           + ADKI   M+ +   EF +    Q +T 
Sbjct  210  VIGLEMGSVYGRLGSKITVV-----------EYADKICPTMDHELTKEFQKLLTKQGMT-  257

Query  414  LENGQLL---------VKWTSE---DGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLN  461
             + GQ +         V  T E    G++     D VL ATGR P  A L L+  G++  
Sbjct  258  FKLGQKVTASKVDGDTVTLTVEPAAGGDATTIEADCVLVATGRRPYTAGLGLEDMGIQ-T  316

Query  462  EKSGRIWVK--NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKV  519
            ++ GRI V   N QT+   IYAIGDVI+   L   A + G  +   +       ++Y+ +
Sbjct  317  DRFGRIKVNLSNFQTNVDGIYAIGDVIEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAI  375

Query  520  CTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAES-CYLKVI  578
               ++T  E    G +EE+ K      N+  Y+    P+    ++  R   E+  ++KV+
Sbjct  376  PGVIYTFPEVASVGKTEEELKAA----NV-AYNVGKFPMMA--NSRARAVGETDGFVKVL  428

Query  579  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
              K  DK ++G H +  NAGE+     L ++ G + + +  T   HPT +E+F
Sbjct  429  AAKDDDK-ILGIHIIASNAGEMISEGVLGIEYGASAEDIGRTCHAHPTLSEAF  480

>PYIW_19795
Length=519

 Score = 102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 120/492 (24%), Positives = 206/492 (42%), Gaps = 50/492 (10%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDLVVIG G     C+ E+A  G++V V+D            +GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFRE  88

Query  222  SSL-IGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
            + L +    HH      +++ +   +   +  K++V++    IK+       +L++  V+
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKA-------QLKAARVE  141

Query  281  YENFLGSFVNPHTLELWHPRKGTK-----------QITTRDVVIAVGGRPKE--LTCPGG  327
            Y   L  F   H + +       +           ++     +IA G RP    L    G
Sbjct  142  YIPGLARFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDG  201

Query  328  EHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQ  384
            +    SD I     +E P   +VVGA  + +E A  L  + G+ V V+  R  +L   D 
Sbjct  202  KVIFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDN  261

Query  385  DMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGR  444
            ++   +   M    G  F+     + + K E+G + V + S    +     D +L   GR
Sbjct  262  EIISNLTYEMR-SKGARFLLGETIKQVEKTEDG-VTVHFNSGKTATA----DALLYTVGR  315

Query  445  DPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  504
                  LNL+   +  N +       + QT+  +IYA GD I AP L   +++ GRL + 
Sbjct  316  QASTDGLNLEAVNLARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAAC  375

Query  505  RLYNNS----TVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVY-HTNFVPLE  559
             +++      T Q++       ++T  E    G +E+   +      I +  ++     +
Sbjct  376  HMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGANYEIGIAKYSELAKGQ  435

Query  560  WSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVD  619
             S ST          LK++ D T  K  +G H +G  A E+     +AM +G +     D
Sbjct  436  MSGST------AGGMLKILFDPTTLKL-LGVHAIGEGATEIIHIGQVAMAMGCSVTYFRD  488

Query  620  TVGIHPTTAESF  631
             V  +PT AE++
Sbjct  489  AVFNYPTLAEAY  500

>PYIW_25190
Length=206

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 93/186 (50%), Gaps = 5/186 (3%)

Query  451  LNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNN  509
            L L+  GVKLN+    +    E TS   IYAIGD  I   ELTPVAI AGR L+ RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  510  ST-VQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRT  568
                 + Y ++ T VF+    G  G +E  + E+FG  N++ Y + FV L  +++     
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMADPDHK  121

Query  569  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  628
               +  L        D+ VVG H  G  A E+ Q  G+AMK+  T     + V IHPT +
Sbjct  122  GKTAMKL---VTVGEDEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAS  178

Query  629  ESFTTL  634
            E   T+
Sbjct  179  EELVTM  184

>PYIR_14132
Length=513

 Score = 101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 130/516 (25%), Positives = 217/516 (42%), Gaps = 75/516 (15%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTVPSKTFRE  62

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPT--FNWKQLVSNVDGYIKSINFKYKVELRSKYV  279
            ++L      H  A    +   G  N PT  F  + ++  V     +     + +L    +
Sbjct  63   ATL------HLTAYRHRSFYDGQSN-PTKRFGIEDILQRVKKVEHAETDITRHQLLRNNI  115

Query  280  KYENFLGSFV-------------NPHTLELWHPRKGTKQITTR-----DVVIAVGGRP-K  320
            +  N    F+             + +T      R  +  I  R       +IAVG RP +
Sbjct  116  ELINGTARFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLIAVGTRPAR  175

Query  321  ELTCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RS  376
                P  G+    SD + W   K  P + +VVGA  + +E A  +  + G +V ++  R 
Sbjct  176  RPDIPFDGQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRK  235

Query  377  ILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFD  436
             +L   D+++++ +   M  Q+G  F  +   +S+ K +NG+++V   S  G++     D
Sbjct  236  EILDMADREVSEALCYSMR-QTGARFFVEETIKSVEKADNGEVIVHLNS--GKTL--VGD  290

Query  437  TVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVA  495
             +L   GR  +   LNL   G++  +K G I V ++ QT  P+IYA GD I  P L   +
Sbjct  291  GLLYTLGRQGNTEGLNLAAVGLE-ADKRGLIQVDDDFQTDVPHIYAAGDCIGFPALASTS  349

Query  496  IQAGRLLSRRLYNNS---------TVQMDYEKVCT----------AVFTPIEYGCCGMSE  536
            ++ GRL S  +  +          T   D + + T           ++T  E    G +E
Sbjct  350  MEQGRLASVHMRTSKPTNKKGESETESTDPQYMRTRMRSGEVFPFGIYTVPEISMVGKNE  409

Query  537  EDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFVVGFHYLGP  595
                ++    NI  Y       E  L+          +LK+I C KT    V+G H +G 
Sbjct  410  ----QQLTSQNIP-YEVGVARYE-ELAKGQMLGGVPGFLKIIFCPKTLQ--VLGVHAIGE  461

Query  596  NAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
             A E+     + M  G T +   + V  +PT AE++
Sbjct  462  GATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  497

>H257_16541
Length=494

 Score = 100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 131/491 (27%), Positives = 220/491 (45%), Gaps = 57/491 (12%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            +YD+VV+GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  27   EYDVVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  78

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
              + +     H+  + G  + +      + ++ QL+ + D  +K +    +   +   V 
Sbjct  79   HGTHLYHSAQHNFKSVGIKVDN-----VSIDFDQLMKSKDKTVKILTGGIEGLFKKNKVD  133

Query  281  YENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSDD  335
            Y    G  V    + +     G + + T++++IA G       P  +   GG+  I S  
Sbjct  134  YIKGYGKVVAKGQVSVALNAGGNQTVNTKNILIATGSEVTPLPPVPVDNEGGK-IIDSTG  192

Query  336  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYME  395
               +K+  P   +VVG   + LE       +G  + V+           + ADKI   M+
Sbjct  193  ALALKRV-PKHLVVVGGGVIGLEMGSVYGRLGSKITVV-----------EYADKICPTMD  240

Query  396  VQSGIEFIRKTVPQSITKLENGQL---------LVKWTSE---DGESCEEAFDTVLNATG  443
             +   EF +    Q +T  + GQ          +V  T E    GE+     D VL ATG
Sbjct  241  HEVTKEFQKLLTKQGMT-FKLGQKVTASKVDGDVVTLTVEPAAGGEATTIEADCVLVATG  299

Query  444  RDPDVAKLNLDKAGVKLNEKSGRIWVK--NEQTSTPNIYAIGDVIDAPELTPVAIQAGRL  501
            R P  A L L++ G++  +K GRI V   N QT+   I+AIGDVI+   L   A + G  
Sbjct  300  RRPFTAGLGLEEMGIQ-TDKFGRIKVNLSNFQTNVDGIFAIGDVIEGAMLAHKAEEEGIA  358

Query  502  LSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWS  561
            +   +       ++Y+ +   ++T  E    G +EE+ K      N+  Y+    P+   
Sbjct  359  VVETIAGKHG-HVNYDAIPGVIYTFPEVASVGKTEEELKTA----NV-AYNVGKFPMMA-  411

Query  562  LSTDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  620
             ++  R   E+  ++KV+  K  DK ++G H +  NAGE+     L ++ G + + +  T
Sbjct  412  -NSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEGVLGIEYGASAEDIGRT  469

Query  621  VGIHPTTAESF  631
               HPT +E+F
Sbjct  470  CHAHPTLSEAF  480

>PHYCA_555180
Length=521

 Score = 100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 129/515 (25%), Positives = 216/515 (42%), Gaps = 65/515 (13%)

Query  151  STADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  210
            S+A  +     YDLVVIG G     C+ E+A  G++V ++D            LGG CV+
Sbjct  20   SSATLKHQVAAYDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVH  71

Query  211  VGCIPKKLMHQSSL-IGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFK  269
             G IP K   ++ L +    HH      +++ +       +  +++VS+ +  +++    
Sbjct  72   TGTIPSKTFREAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKA  131

Query  270  YKVELRSKYVKYEN----------------------FLGSFVNPHTLELWHPRKGTKQIT  307
             +V++   + ++EN                        GS  N  +L   H  K      
Sbjct  132  ARVDVIPGFARFENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADK------  185

Query  308  TRDVVIAVGGRPKE--LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLK  364
                +IA G RP    L    G+  I SD I      + P   +V+GA  + +E A  + 
Sbjct  186  ---FLIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVN  242

Query  365  GM-GYDVKVMV-RSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVK  422
             + G+ V V+  R  +L   D+++   +   M+  +G  F+   + +++ K+E     VK
Sbjct  243  VVPGHSVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVEVTDR-VK  297

Query  423  WTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYA  481
               + G+      D +L   GR      LNL+  G+  N + G I V KN QT  P+IYA
Sbjct  298  VFFDSGKVLSA--DALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYA  354

Query  482  IGDVIDAPELTPVAIQAGRLLSRRLYNNS-----TVQMDYEKVCTAVFTPIEYGCCGMSE  536
             GD I AP L   +++ GRL S  ++N       T Q++       ++T  E    G +E
Sbjct  355  AGDCIGAPALASTSMEQGRLASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTE  414

Query  537  EDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPN  596
            +   +     N E+    +  L          A     LK++ D    K V G H +G  
Sbjct  415  QQLTK--ACINYEIGVAKYSELAKG---QMMGAMAGGTLKILFDPDTLK-VFGVHAIGEG  468

Query  597  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            A E+     +AM +  +     D V  +PT AE++
Sbjct  469  ATEIIHIGQVAMAMDCSLTYFRDAVFNYPTLAEAY  503

>H310_07641
Length=548

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 133/517 (26%), Positives = 216/517 (42%), Gaps = 75/517 (15%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K   +
Sbjct  41   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  92

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            + L   +  H    F  N  +        + ++++  V    ++     + +L    +  
Sbjct  93   AVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEEAETDLTRNQLTRNGIIL  150

Query  282  ENFLGSFV---NPHTLELWHPRKGT--------------KQITTRD-VVIAVGGRPKELT  323
             N    F+   +  T+ +      T              K++ T D V+IAVG RP    
Sbjct  151  INGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPAR--  208

Query  324  CPG----GEHAISSDDIFWMKKK-EPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RS  376
             P     G     SD + W      P + +VVGA  + +E A  +  + G  V V+  R 
Sbjct  209  HPDLEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRK  268

Query  377  ILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLE---NGQLLVKWTSEDGESCEE  433
             +L   D++++D +  YM  Q G  F+ +   +SI K+E   + +++V  TS  G+    
Sbjct  269  EILDMADKEVSDALCYYMR-QRGSRFLTE---ESILKVETKDDSEVVVHLTS--GKVI--  320

Query  434  AFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELT  492
              D +L   GR  +VA L+L+  G+  N K G + V N  QT+ P+IYA GD I  P L 
Sbjct  321  MGDALLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALA  379

Query  493  PVAIQAGRLLSRRLYNN------------------STVQMDYEKVCTAVFTPIEYGCCGM  534
              +++ GRL S  +  +                   T     E     ++T  E    G 
Sbjct  380  STSMEQGRLASVHMRTSEPTNKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMVGK  439

Query  535  SEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLG  594
            SE    ++  ++NI  Y       E  L+          +LK+I   T  K  +G H +G
Sbjct  440  SE----QQLSKENIP-YEVGIARYE-ELAKGQMLGGMPGFLKLIFCPTTLKL-LGVHAIG  492

Query  595  PNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
              A E+     + M  G T +   + V  +PT AE++
Sbjct  493  EGATEIIHIGQVVMSTGGTMEYFRNAVFNYPTLAEAY  529

>HYAP_04149
Length=564

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 130/524 (25%), Positives = 219/524 (42%), Gaps = 82/524 (16%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +DL+VIG G  G  C+ ++A  G  V ++D            LGG CV+ G +P K   +
Sbjct  53   FDLIVIGSGPAGQKCAIDSAKHGYSVAIVD--------KRDMLGGVCVHTGTVPSKTFRE  104

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++L     H  G       +   G +     + ++  V+   K+     + +L    V+ 
Sbjct  105  AAL-----HLTGYRHRAFYNGQAGPSKRVGVEDILQRVNKVEKAETDITRHQLMRNGVQL  159

Query  282  ENFLGSFV--NPHTLELWH----------PRKGTKQITTR-----DVVIAVGGRP-KELT  323
                  F+  N H + +             R  +  I  R     + ++ VG RP +   
Sbjct  160  ITGTARFMPGNSHMIAVLSNESYETATDAKRHSSANICKRVLTADNFLVCVGTRPARRAD  219

Query  324  CP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILL  379
             P  GE    SD + W K K  P + +VVGA  V +E A  +  + G DV V+  R  +L
Sbjct  220  IPFDGETIFDSDQLLWGKVKAVPRRLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKEIL  279

Query  380  RGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVL  439
               D+++++ +  Y   Q+G  F+   V +S+ K   G++ V    E G++     D +L
Sbjct  280  EMADKEVSEALC-YSMAQTGTRFLVDEVIKSVEKSAKGEVGVHL--ESGKTV--VGDGLL  334

Query  440  NATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYA---------IGDVIDAP  489
               GR  +V  LNL+  G+   +K GRI V N  QT+ P++YA          GD+I  P
Sbjct  335  YTVGRQGNVEGLNLEAVGLA-PDKRGRIIVDNNFQTAVPHMYAQSRLIADQNAGDIIGFP  393

Query  490  ELTPVAIQAGRLLSRRLYNNSTVQM----------DYEKVCT----------AVFTPIEY  529
             L   +++ GRL S  +  + +             D ++V T           ++T  E 
Sbjct  394  ALASTSMEQGRLASVHMRTSKSFYTKEISDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEI  453

Query  530  GCCGMSEED-SKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFV  587
               G +E+  ++E+        Y       E  L+          +LK+I C KT    +
Sbjct  454  SMVGKNEQQLTREQVP------YEVGIARYE-ELAKGQMLGGVPGFLKIIFCPKTLK--L  504

Query  588  VGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            +G H +G  A E+     + M    T +   + V  +PT AE++
Sbjct  505  LGVHAIGEGATEIIHIGQVVMSTDGTLEYFRNAVFNYPTLAEAY  548

>PYIW_24688
Length=259

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 86/281 (31%), Positives = 131/281 (47%), Gaps = 35/281 (12%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YD + IGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCV+ GC+PKK+M  
Sbjct  7    YDYISIGGGSGGMASARRAATFGAKVLV---VERGRKYGGAGLGGTCVHYGCVPKKIMFN  63

Query  222  SSLIGEVIHHDG-----ANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRS  276
            ++   E ++         N       GD     F+W  + +  D YI  +N  Y+  L +
Sbjct  64   AATHVEHLNRAADYSITTNGAHKYQFGD-----FDWANMKTKRDAYILRLNGIYERNLGN  118

Query  277  KYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  336
              V     +   V  + +E+          T + +++AVGG+P               D 
Sbjct  119  AQVDLVEGVAKLVAKNQVEV-----DGVVYTGKHILVAVGGKP---------------DG  158

Query  337  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMADKIGEYME  395
            F+  + +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + D I E  E
Sbjct  159  FFKLEAQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE  218

Query  396  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFD  436
             ++GI F+R +  + I K  +G L +       E     FD
Sbjct  219  -KAGINFVRNSRIERIEKQADGSLTITAKVNGEEQVLAGFD  258

>PYIW_20257
Length=503

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 128/507 (25%), Positives = 204/507 (40%), Gaps = 106/507 (21%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDHAKHGKTVAVID--------KRDMLGGVCIHTGTVPSKTFRE  101

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            ++L      H     G +       A  F  + ++  V    K ++ ++  +   +    
Sbjct  102  ATLHLTAYRHRSFYEGQSTP-----AKRFGIEDILQRV----KKLHDRHGRQTPLERRHL  152

Query  282  ENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRP-KELTCP-GGEHAISSDDIFWM  339
            + FL                           IAVG RP +    P  GE    SD + W 
Sbjct  153  QAFL---------------------------IAVGTRPARRPDIPFDGETIFDSDQLLWG  185

Query  340  KKKE-PGKTLVVGASYVALECAGFLK---GMGYDVKVMVRSILLRGFDQDMADK-IGE--  392
              K  P + +VVGA  + +E A  +    GM   +    R IL      DMAD+ + E  
Sbjct  186  GVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREIL------DMADREVSEAL  239

Query  393  -YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKL  451
             Y   Q+G  F  +   +S+ K +NG+++V   S  G++     D +L   GR  +   L
Sbjct  240  CYSMRQTGARFFVEETIKSVEKADNGEVIVHLNS--GKTL--VGDGLLYTLGRQGNTEGL  295

Query  452  NLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLS--RRLYN  508
            NL+  G+K  +K G I V ++ QT+ P+IYA GD I  P L   +++ GRL S   R   
Sbjct  296  NLEAIGLK-ADKRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRTAK  354

Query  509  NSTVQMDYEKVCT-----------------AVFTPIEYGCCGMSEEDSKERFGEDNIEVY  551
             +  + D E   T                  ++T  E    G +E+              
Sbjct  355  PTNKKGDSETESTDPAFMRTRMRSGEVFPFGIYTVPEISMVGKNEQQ------------L  402

Query  552  HTNFVPLEWSLSTDTRTAAESC------YLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAM  604
             +  +P E  ++     A          +LK+I C  T    V+G H +G  A E+    
Sbjct  403  TSQCIPYEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLQ--VLGVHAIGEGATEIIHIG  460

Query  605  GLAMKLGFTYDQMVDTVGIHPTTAESF  631
             + M  G T +   + V  +PT AE++
Sbjct  461  QVVMSTGGTIEYFRNAVFNYPTLAEAY  487

>PYU1_G005699
Length=550

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 132/514 (26%), Positives = 216/514 (42%), Gaps = 74/514 (14%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +DL+VIG G  G  C+ ++A  G+ V ++D             GG CV+ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDMH--------GGVCVHTGTVPSKTFRE  101

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSIN----FKYKVELRSK  277
            ++L      H   +F    SS        +  Q V  V+     I      +  VEL + 
Sbjct  102  ATLHLTAYRHR--SFYDGQSSPTKRFGIEDILQRVKKVEHAETDITRHQLLRNGVELING  159

Query  278  YVKY-----ENFLGSFVN-PHTLELWHPRKGTKQITTR-----DVVIAVGGRP-KELTCP  325
              ++     +N +    N  +T      R  +  I  R       +IAVG RP +    P
Sbjct  160  TARFLPDANKNMIAVLSNDSYTTATDAKRHASADICKRVLTADKFLIAVGTRPARRPDIP  219

Query  326  -GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM--VRSILLR  380
              G+    SD + W   K  P + +VVGA  + +E A  +  + G +V ++   + IL  
Sbjct  220  FDGQAVFDSDQLLWGGVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEIL--  277

Query  381  GFDQDMADK-IGE---YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFD  436
                DMAD+ + E   Y   Q+G  F  +   +S+ K+ NG+++V   S  G++     D
Sbjct  278  ----DMADREVSEALCYSMRQTGARFFVEETIKSVEKV-NGEVIVHLNS--GKTL--VGD  328

Query  437  TVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVA  495
             +L   GR  +   LNL   G++  +K G I V +N QT+ P+IYA GD I  P L   +
Sbjct  329  GLLYTLGRQGNTDGLNLPAVGLE-ADKRGLIQVDENFQTAVPHIYAAGDCIGFPALASTS  387

Query  496  IQAGRLLSRRLYNNSTVQMDYEKVCT-----------------AVFTPIEYGCCGMSEED  538
            ++ GRL S  +          +   T                  ++T  E    G +E  
Sbjct  388  MEQGRLASVHMRTEKPTNKTGDSESTDPQFMRTRMRSGDVFPFGIYTVPEISMVGKNE--  445

Query  539  SKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFVVGFHYLGPNA  597
              ++  ++N+  Y       E  L+          +LK+I C KT    ++G H +G  A
Sbjct  446  --QQLTKENVP-YEVGLARYE-ELAKGQMLGGVPGFLKIIFCPKTLQ--LLGVHAIGEGA  499

Query  598  GEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
             E+     + M  G T +   + V  +PT AE++
Sbjct  500  TEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  533

>PHYSO_489418
Length=471

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 122/473 (26%), Positives = 201/473 (42%), Gaps = 65/473 (14%)

Query  204  LGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYI  263
            +GG CV+ G +P K   +++L     H  G       +   G +  F  + ++  V    
Sbjct  2    MGGVCVHTGTVPSKTFREAAL-----HLTGYRHKAFYNGQAGPSKRFGVEDILQRVKKVE  56

Query  264  KSINFKYKVELRSKYVKYENFLGSFV--NPHTL-----ELWHPRKGTKQITTRDVVIAVG  316
             +     + +L    V+  N    F+  N H +     E +      K+ T+ D+   V 
Sbjct  57   DAETDITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAKRHTSADICKRVL  116

Query  317  GRPKELTCPG------------GEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFL  363
               K L C G            GE    SD + W K K  P + +VVGA  V +E A  +
Sbjct  117  TADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMM  176

Query  364  KGM-GYDVKVM-VRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLV  421
              + G DV V+  R  +L   D+++++ +  Y   Q+G  F+     +S+ K   G++ V
Sbjct  177  TIIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLVGETIKSVEKTPKGEVFV  235

Query  422  KWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIY  480
                E G++     D +L   GR  +V  LNL+  G+ + +K GRI V N  QT+ P+IY
Sbjct  236  HL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGL-VPDKRGRIKVDNNFQTAVPHIY  290

Query  481  AIGDVIDAPELTPVAIQAGRLLSRRL-----YNNSTVQMDY-----EKVCT---------  521
            A GD+I  P L   +++ GRL S  +      NN  +  D      ++V T         
Sbjct  291  AAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSGEVFP  350

Query  522  -AVFTPIEYGCCGMSEED-SKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-  578
              ++T  E    G +E+  +KE+        Y       E  L+          +LK+I 
Sbjct  351  FGIYTVPEISMVGKNEQQLTKEQVP------YEVGMARYE-ELARGQMLGGLPGFLKIIF  403

Query  579  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            C +T    ++G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  404  CPETLK--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>SPRG_12054
Length=558

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 137/564 (24%), Positives = 229/564 (41%), Gaps = 108/564 (19%)

Query  129  GSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVC  188
            G  TE  A+AD   S T++     A        +DLVVIG G  G  C+ ++A  G+KV 
Sbjct  21   GLSTEAEAKADDASSFTNILRNLRASEH-----FDLVVIGSGPSGQKCAIDSAKHGKKVA  75

Query  189  VLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAP  248
            ++D             GG CV+ G IP K   ++ L      H G         G+  + 
Sbjct  76   IIDKKDMH--------GGVCVHTGTIPSKTFREAVLHLTAHRHKGF-------YGNAYSA  120

Query  249  TFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGT-----  303
            T   +  + ++   ++ +        R++ ++   +L   +N     L    K T     
Sbjct  121  TSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGIYL---INGTARFLPDADKKTVAVLS  177

Query  304  -------------------KQITTRD-VVIAVGGRPKELTCPG----GEHAISSDDIFW-  338
                               K++ T D  +I+VG RP     P     GE    SD + W 
Sbjct  178  NDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPAR--HPNMDFDGELIFDSDQLLWG  235

Query  339  MKKKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMADKI------  390
                 P + +VVGA  + +E A  +  + G  V V+  R  +L   D++++D +      
Sbjct  236  ALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEILEMADKEVSDALCYSMRQ  295

Query  391  -GEYMEVQSGIEFIRKTVPQS--ITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPD  447
             G     +  I+F+ K + +   +  L++G+++V              D +L   GR  +
Sbjct  296  RGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG-------------DALLYTQGRQGN  342

Query  448  VAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  506
            V  L+L+  G++ N + G + V N  QTS P+IYA GD I  P L  V+++ GRL S  +
Sbjct  343  VTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYPALASVSMEQGRLASVHM  401

Query  507  Y-----NNSTVQMD-YEK------------VCTAVFTPIEYGCCGMSEEDSKERFGEDNI  548
                  N +   +D YE                 ++T  E    G SE    ++  ++N+
Sbjct  402  RTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISMVGKSE----QQLTKENV  457

Query  549  EVYHTNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLA  607
              Y       E  L+          +LK+I C  T    ++G H +G  A E+     + 
Sbjct  458  P-YEVGVARYE-ELAKGQMLGGTPGFLKIIFCPSTLK--LLGVHAIGEGATEIIHIGQVV  513

Query  608  MKLGFTYDQMVDTVGIHPTTAESF  631
            M  G T +   + V  +PT AE++
Sbjct  514  MSTGGTLEYFRNAVFNYPTLAEAY  537

>PYVX_23499
Length=519

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 136/539 (25%), Positives = 220/539 (41%), Gaps = 84/539 (16%)

Query  141  PMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGT  200
            P+SET  E  ++         +DL+V+G G  G  C+ ++A  G+ V ++D         
Sbjct  1    PLSETLRELKASEH-------FDLIVVGSGPAGQKCAIDSAKHGKSVAIID--------K  45

Query  201  SWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVD  260
               LGG CV+ G +P K   +++L      H    F  + S         +  Q V  V+
Sbjct  46   RDMLGGVCVHTGTVPSKTFREATLHLTGYRHRA--FYDSASVSSRRLEIDDILQRVHKVE  103

Query  261  GYIKSIN----FKYKVELRSKYVKY-----ENFLGSFVNPHTLELWHPRKGT-----KQI  306
            G    I      +  VEL     ++      N +    N         ++ T     K++
Sbjct  104  GAETDITRHQLMRNNVELIHGTARFLPDEKRNMVAVLSNAKYDTPTDAKRHTSADICKRV  163

Query  307  TTRD-VVIAVGGRP--KELTCPGGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGF  362
             T D  +I VG RP  +E     G+    SD + W   K  P + +VVGA  + +E A  
Sbjct  164  LTADKFLICVGTRPARREDIPFDGKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASM  223

Query  363  LKGM-GYDVKVM--VRSILLRGFDQDMADK-IGE---YMEVQSGIEFIRKTVPQSITKLE  415
            +  + G +V V+   + IL      DMADK + E   Y   Q+G  F  +   + + K E
Sbjct  224  MSIIPGTEVTVIDGRKEIL------DMADKEVSESLCYSMRQTGTRFYTEESIKKVEKRE  277

Query  416  NGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QT  474
            NG+++    S  G+      D +L   GR  +   LNL   G++  +K G + V ++ QT
Sbjct  278  NGEVVAHLNS--GKVI--VGDGLLYTLGRQGNTDGLNLQAVGLE-TDKRGFLNVNDDFQT  332

Query  475  STPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCT-------------  521
              P+IYA GD I  P L   +++ GRL S  +   S      E+                
Sbjct  333  EVPHIYAAGDCIGYPALASTSMEQGRLASVHMRTESPTNKVGEEASDELGGDANRIRWRM  392

Query  522  --------AVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESC  573
                     ++T  E    G +E    ++  ++N+  Y       E  L+          
Sbjct  393  RSGEVFPFGIYTIPEISMVGKNE----QQLTKENVP-YEVGLARYE-ELAKGQMLGGVPG  446

Query  574  YLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            +LK+I C  T    V+G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  447  FLKIIFCPDTLK--VLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  503

>SDRG_05060
Length=559

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 134/560 (24%), Positives = 229/560 (41%), Gaps = 102/560 (18%)

Query  130  SPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCV  189
            + TE  A+AD   S T++     A        +DLVVIG G  G  C+ ++A  G+KV +
Sbjct  23   TETEAKAKADDACSFTNILRNLRASEH-----FDLVVIGSGPSGQKCAIDSAKHGKKVAI  77

Query  190  LDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPT  249
            +D             GG CV+ G IP K   ++ L      H G         G+  + T
Sbjct  78   IDKKDMH--------GGVCVHTGTIPSKTFREAVLHLTAHRHKGF-------YGNAYSAT  122

Query  250  FNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFL----------------GSFVNPHT  293
               +  + ++   ++ +        R++ ++   +L                    N   
Sbjct  123  SGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGIYLINGTARFLPDADKKTVAVLSNDSY  182

Query  294  LELWHPRKGT-----KQITTRD-VVIAVGGRPKELTCPG----GEHAISSDDIFW-MKKK  342
             E    ++ +     K++ T D  +I+VG RP     P     GE    SD + W     
Sbjct  183  TEATDGQRHSDANICKRVLTADKFLISVGTRPAR--HPNMDFDGELIFDSDQLLWGALTN  240

Query  343  EPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMADKI-------GEY  393
             P + +VVGA  + +E A  +  + G  V V+  R  +L   D++++D +       G  
Sbjct  241  VPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEILEMADKEVSDALCYSMRQRGTR  300

Query  394  MEVQSGIEFIRKTVPQS--ITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKL  451
               +  I+F+ K + +   +  L++G+++V              D +L   GR  +V  L
Sbjct  301  FLTEETIDFVEKRLDEKEVVVHLKSGKIIVG-------------DALLYTQGRQGNVTGL  347

Query  452  NLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY---  507
            +L+  G++ N + G + V N  QTS P+IYA GD I  P L  V+++ GRL S  +    
Sbjct  348  DLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYPALASVSMEQGRLASVHMRTSE  406

Query  508  --NNSTVQMD-YEK------------VCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYH  552
              N +   +D YE                 ++T  E    G SE    ++  ++N+  Y 
Sbjct  407  PTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISMVGKSE----QQLTKENVP-YE  461

Query  553  TNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  611
                  E  L+          +LK+I C  T    ++G H +G  A E+     + M  G
Sbjct  462  VGVARYE-ELAKGQMLGGTPGFLKIIFCPSTLK--LLGVHAIGEGATEIIHIGQVVMSTG  518

Query  612  FTYDQMVDTVGIHPTTAESF  631
             T +   + V  +PT AE++
Sbjct  519  GTLEYFRNAVFNYPTLAEAY  538

>PPTG_13000
Length=387

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 99/345 (29%), Positives = 161/345 (47%), Gaps = 25/345 (7%)

Query  297  WHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA----ISSDDIFWMKKKEPGKTLVVGA  352
             +  KG + +  ++++IA G     L     ++A    I S     +K+  P   +VVGA
Sbjct  44   LNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALELKRV-PEHLVVVGA  102

Query  353  SYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSI  411
              + LE     K +G  V V+        G D++   +  + ++ Q G++F   T    +
Sbjct  103  GVIGLELGSVYKRLGAKVTVVEFLDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KV  158

Query  412  TKLENGQLLVKWTSE---DGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIW  468
            T  E    +VK T+E    G++     DTVL ATGR    A L L++ G++  +K GRI 
Sbjct  159  TSSEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIE  217

Query  469  VKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPI  527
            V +  +T  P I+AIGDVI    L   A + G      +       ++Y  V   ++T  
Sbjct  218  VDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG-HVNYGAVPGVIYTFP  276

Query  528  EYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAES-CYLKVICDKTRDKF  586
            E+   G +EE+ K     + IE Y+    P+  +  +  RT AES   +KV+ DK  DK 
Sbjct  277  EFASVGKTEEELKA----EGIE-YNVGKFPMMAN--SRARTVAESDGLVKVLADKKTDKL  329

Query  587  VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            + G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  330  L-GVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  373

>PHYKE_2864
Length=486

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 120/494 (24%), Positives = 192/494 (39%), Gaps = 83/494 (17%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDLVVIG G     C+ E+A  G++V ++D      + TS  LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD------KKTS--LGGVCVHTGTIPSKTFRE  85

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            + L      H G  +G + S       T   + ++  V   + S     + +L++  V  
Sbjct  86   AVLHLSGYRHHGF-YGKSYS-----MKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDV  139

Query  282  ENFLGSFVNPHTLELWHPRK---------------GTKQITTRDVVIAVGGRPKE--LTC  324
                  F N H + +                       ++     +IA G RP    L  
Sbjct  140  IPGFARFENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLVP  199

Query  325  PGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFD  383
              G+  I SD I      + P   +VVGA  + +E A  +              ++ G  
Sbjct  200  IDGKVIIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVN-------------VVPGHS  246

Query  384  QDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATG  443
              + D   +  + +  + F             +G++L             + D +L   G
Sbjct  247  VTVVDGRPDTTDKRVKVFF------------NSGKVL-------------SADALLYTVG  281

Query  444  RDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLL  502
            R      LNL+  G+  N + G I V KN QT  P+IYA GD I AP L   +++ GRL 
Sbjct  282  RQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLA  340

Query  503  SRRLYN-----NSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVP  557
            S  ++N      +T Q++       ++T  E    G +E    ++  +D +  Y      
Sbjct  341  SCHMWNPDEELAATSQLESGNYPYGIYTIPEISMVGQTE----QQLTKDCVN-YEIGIAK  395

Query  558  LEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617
                       A     LK++ D    K V G H +G  A E+     +AM +G +    
Sbjct  396  YSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMGCSLTYF  454

Query  618  VDTVGIHPTTAESF  631
             D V  +PT AE++
Sbjct  455  RDAVFNYPTLAEAY  468

>PHYKE_9807
Length=557

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 132/534 (25%), Positives = 223/534 (42%), Gaps = 71/534 (13%)

Query  143  SETSVEETSTADAEE---TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  199
            +E  VE++   D       +  +DL+VIG G  G  C+ ++A  G+ V ++D        
Sbjct  34   TEAPVEKSVLVDTLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIVD--------  85

Query  200  TSWGLGGTCVNVGCIPKKL-MHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSN  258
                LGG CV+ G   ++  MH +       H    N    +S   G        + V  
Sbjct  86   KRDMLGGVCVHTGTTFREAAMHLTGYR----HRAFYNGHGGISKRIGVEDILQRVKKVEA  141

Query  259  VDGYIKSINFKYK-VELRSKYVKY----ENFLGSFVNPHTLELWHPRKGT-----KQITT  308
             +  I     +   V+L S   ++     + L    N         ++ T     K++ T
Sbjct  142  AETDITRHQLQRNGVQLISGTARFLAGDSHMLAVLSNEEYETATDAKRHTEADICKRVLT  201

Query  309  RD-VVIAVGGRP-KELTCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLK  364
             D  ++ VG RP +    P  GE    SD + W K K  P + ++VG   V +E A  + 
Sbjct  202  ADKFLVCVGTRPARHPDIPFDGETIFDSDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMT  261

Query  365  GM-GYDVKVM-VRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVK  422
             + G DV V+  R  +L   D+++++ +  Y   Q+G  F+     + + K   G++LV+
Sbjct  262  IIPGTDVTVIDGRKEILNMADKEVSEALC-YSMAQTGTRFLVGETIKKVEKNSKGEVLVR  320

Query  423  WTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYA  481
              S  G++     D +L   GR  +V  L+L+  G+   +K GRI V N  QT  P+IYA
Sbjct  321  LDS--GKTV--VGDGLLYTVGRQGNVEGLHLESVGIH-PDKRGRIKVDNNFQTEVPHIYA  375

Query  482  IGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQM-------------DYEKVCT-------  521
             GD+I  P L   +++ GRL S  +   S V               D +++ T       
Sbjct  376  AGDIIGFPGLASTSMEQGRLASVHMRTASPVATKPSKELPDDKLMDDPDRMRTRMRSGEV  435

Query  522  ---AVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI  578
                ++T  E    G +E    ++  ++ +  Y       E  L+          +LK+I
Sbjct  436  FPFGIYTVPEISMVGKNE----QQLTQEQVP-YEVGMARYE-ELARGQMLGGVPGFLKII  489

Query  579  -CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
             C  T    ++G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  490  FCPNTLQ--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVMNYPTLAEAY  541

>PYAP_19148
Length=535

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 131/523 (25%), Positives = 215/523 (41%), Gaps = 79/523 (15%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +DL+VIG G  G  C+ + A  G+ V ++D             GG CV+ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTVPSKTFRE  62

Query  222  SSLIGEVIHH----DGAN-----FG-----WNLSSGDGNAPTFNWKQLVSNVDGYIKSIN  267
            + L      H    DGA+     FG       +   +         QL+ N    I+ IN
Sbjct  63   AILHLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDITRHQLLRN---GIELIN  119

Query  268  --FKYKVELRSKYV------KYENFLGSFVNPHTLELWHPRKGTKQ-------ITTRDVV  312
               ++  +   K V       YE    +    HT      R G          +T    +
Sbjct  120  GTARFLPDPSKKMVAVLSNDSYET--ATDTKRHTSADICKRTGADSSILLISVLTADKFL  177

Query  313  IAVGGRP-KELTCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GY  368
            +AVG RP +    P  G+    SD I W      P + +VVGA  + +E A  +  + G 
Sbjct  178  VAVGTRPARRADIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGS  237

Query  369  DVKVMV-RSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSED  427
            +V V+  R  +L   D+++A+ + +Y   Q+G  F       ++ K  NG+++VK  S  
Sbjct  238  EVTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVIVKLNS--  294

Query  428  GESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVID  487
            G++     D +L   GR  +   LNL   G++ +++       N +TS P+IYA GD I 
Sbjct  295  GKTI--VGDGLLYTVGRQGNTDGLNLAAVGLEADKRGLLKVDDNFRTSVPHIYAAGDCIG  352

Query  488  APELTPVAIQAGRLLS----------RRLYNNSTVQMDYEKVCT--------AVFTPIEY  529
             P L   +++ GRL S          ++  +N      Y++            ++T  E 
Sbjct  353  YPALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYTVPEI  412

Query  530  GCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFVV  588
               G SE    ++   +NI  Y       E  L+          +LK++ C K+    V+
Sbjct  413  SMVGKSE----QQLTRENIP-YEVGVARYE-ELAKGQMLGGVPGFLKIVFCPKSLQ--VL  464

Query  589  GFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  465  GVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  507

>CCI39993
Length=550

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 128/535 (24%), Positives = 221/535 (41%), Gaps = 72/535 (13%)

Query  140  VPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  199
            +P  +T+       D + + + YDL+VIG G  G  C+ ++A  G+ V ++D  +     
Sbjct  24   IPSPKTTALTDMLRDLKASEH-YDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKNEMH---  79

Query  200  TSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNV  259
                 GG CV+ G +P K   ++ L   +  H   NF   LSS       F  + +++ V
Sbjct  80   -----GGVCVHTGTVPSKTFREAIL--HLTAHRHRNFYTGLSSPKKR---FGIEDILTRV  129

Query  260  DGYIKSINFKYKVELRSKYVKYENFLGSFV-NPHTLELWHPRKGTKQ-------------  305
                 +     + +L    V+  N    F+ +P    L++     KQ             
Sbjct  130  RKVENAETDITRHQLVRNNVELINGTARFLPDPSKKMLYYQIAHLKQQRMEIAIFELIFV  189

Query  306  ----ITTRDVVIAVGGRP--KELTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALE  358
                +T    +IAVG RP  ++     G+    SD I W   K  P + +VVGA  + +E
Sbjct  190  NGKILTADKFLIAVGTRPARRDDIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGME  249

Query  359  CAGFLKGM-GYDVKVM-VRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLEN  416
             A  +  + G  V V+  R  +L   D+++ + +  Y   Q+G  F  +   + +     
Sbjct  250  YASMMSIIPGAQVTVIDGRKEILEMADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNK  308

Query  417  GQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTS  475
             ++++   S  G++     D +L   GR  +   L+L   G++  +K G I V +N QTS
Sbjct  309  DEVIIHLNS--GKTI--VGDGLLYTVGRQGNTEGLDLSAIGLQ-TDKRGLIKVNENFQTS  363

Query  476  TPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQ-------MDYEKVCT-------  521
             P+IYA GD    P L   +++ GRL S  +  +            D + + T       
Sbjct  364  VPHIYAAGDCTGFPALASTSMEQGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGDF  423

Query  522  ---AVFTPIEYGCCGMSE-EDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKV  577
                ++T  E    G +E + +KE         Y       E  L+          +LK+
Sbjct  424  FPFGIYTVPEISMVGKNEYQLTKEGIA------YEVGVARYE-ELAKGQMLGGVPGFLKI  476

Query  578  I-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            I C  T +  ++G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  477  IFCPTTLN--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  529

>H257_07450
Length=567

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 103/369 (28%), Positives = 163/369 (44%), Gaps = 46/369 (12%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K   +
Sbjct  39   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  90

Query  222  SSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKY  281
            + L   +  H    F  N  +        + ++++  V     +     + +L    +  
Sbjct  91   AVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEDAETDLTRNQLTRNGIIL  148

Query  282  ENFLGSFV---NPHTLELWHPRKGT--------------KQITTRD-VVIAVGGRPKELT  323
             N    F+   +  T+ +      T              K++ T D V+IAVG RP    
Sbjct  149  INGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPARRP  208

Query  324  CPG--GEHAISSDDIFWMKKK-EPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSIL  378
                 G     SD + W      P + +VVGA  + +E A  +  + G  V V+  R  +
Sbjct  209  DLDYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEI  268

Query  379  LRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLE---NGQLLVKWTSEDGESCEEAF  435
            L   D++++D +  YM  + G  F+ +   +SI K+E   N ++LV  TS  G+      
Sbjct  269  LDMADKEVSDALCYYMR-KRGSRFLTE---ESIVKVETKDNSEVLVYLTS--GKVI--VG  320

Query  436  DTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPV  494
            D +L   GR  +VA L+L+  G+  N K G + V N  QT  P+IYA GD I  P L   
Sbjct  321  DALLYTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDVPHIYAAGDCIGYPALAST  379

Query  495  AIQAGRLLS  503
            +++ GRL S
Sbjct  380  SMEQGRLAS  388

>CCA14030
Length=560

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 132/519 (25%), Positives = 214/519 (41%), Gaps = 83/519 (16%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            YDL+V+G G  G  C+ ++A  G+ V ++D  +          GG CV+ G +P K   +
Sbjct  55   YDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTVPSKTFRE  106

Query  222  SSLIGEVIHHDGANFGWNLSSGD---GNAPTFNWKQLVSNVDGYIKSINF-KYKVELRSK  277
            + L   +  H   NF   +SS     G        + V N +  I      +  VEL + 
Sbjct  107  AIL--HLTAHRHRNFYTGMSSPKKRFGIEDILTRVRKVENAETDITRHQLVRNNVELING  164

Query  278  YVKY-----ENFLGSFVNPH----TLELWHPRKGTKQ--ITTRDVVIAVGGRP--KELTC  324
              ++     +N +    N      T    H R    Q  +T    +IAVG RP  ++   
Sbjct  165  TARFLPDPSKNMVAVLSNSSYETATDGNRHFRANICQRILTADKFLIAVGTRPARRDDVV  224

Query  325  PGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRG  381
              G+    SD I W   K  P + +VVGA  + +E A  +  + G  V V+  R  +L  
Sbjct  225  FDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEILEM  284

Query  382  FDQDMADKIGEYMEVQSGIEF-IRKTVP--------QSITKLENGQLLVKWTSEDGESCE  432
             D+++ + +  Y   Q+G  F + +T+         + IT L +G+ +V           
Sbjct  285  ADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNKDEVITHLNSGKTVVG----------  333

Query  433  EAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAPEL  491
               D +L   GR  +   L+L   G++  +K G I V +N QTS P+IYA GD    P L
Sbjct  334  ---DGLLYTVGRQGNTEGLDLSAIGLE-TDKRGLIKVNENFQTSVPHIYAAGDCTGFPAL  389

Query  492  TPVAIQAGRLLSRRLY----NNSTVQ---MDYEKVCT----------AVFTPIEYGCCGM  534
               +++ GRL S  +      N+T      D + + T           ++T  E    G 
Sbjct  390  ASTSMEQGRLASVHMRTSMPTNTTGHAEPTDPQHMRTRMRSGDFFPFGIYTVPEISMVGK  449

Query  535  SEED-SKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-CDKTRDKFVVGFHY  592
            +E   +KE         Y       E  L+          +LK+I C  T +  ++G H 
Sbjct  450  NEHQLTKEGIA------YEVGVARYE-ELAKGQMLGGVPGFLKIIFCPTTLN--ILGVHA  500

Query  593  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  501  IGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  539

>PITG_01778
Length=470

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 117/473 (25%), Positives = 194/473 (41%), Gaps = 65/473 (14%)

Query  204  LGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYI  263
            LGG CV+ G +P K   +++L     H  G       +   G +  F  + ++  V    
Sbjct  2    LGGVCVHTGTVPSKTFREAAL-----HLTGYRHKAFYNGQAGPSRRFGVEDILQRVRKVE  56

Query  264  KSINFKYKVELRSKYVKYENFLGSFVNPH-------TLELWHPRKGTKQITTRDVVIAVG  316
             +     + +L    V+  N    F+  +       + E +      K+ T+ D+   V 
Sbjct  57   DAETDITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETATDAKRHTSADICKRVL  116

Query  317  GRPKELTCPG------------GEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFL  363
               K L C G            GE    SD + W   K  P + ++VGA  V +E A  +
Sbjct  117  TADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMM  176

Query  364  KGM-GYDVKVM-VRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLV  421
              + G DV V+  R  +L   D+ +++ +  Y   Q+G  F+     +S+ K   G++  
Sbjct  177  TIIPGTDVTVIDGRQEILNMADKQVSEALC-YSMAQTGTRFLTGETIKSVEKSPKGEVFA  235

Query  422  KWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIY  480
                E G++     D +L   GR  +V  LNL+  G+   +K GRI V N  QT+ P+IY
Sbjct  236  HL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAVPHIY  290

Query  481  AIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQ----------MDYEKVCT---------  521
            A GD+I  P L   +++ GRL S  +  +  +            D ++V T         
Sbjct  291  AAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFP  350

Query  522  -AVFTPIEYGCCGMSEED-SKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVI-  578
              ++T  E    G +E+  +KE       +V +   V     L+          +LK+I 
Sbjct  351  FGIYTVPEISMVGKNEQQLTKE-------QVPYEVGVARYEELARGQMLGGVPGFLKIIF  403

Query  579  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            C  T   F  G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  404  CPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>PYAR_16664
Length=577

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 182/419 (43%), Gaps = 67/419 (16%)

Query  130  SPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCV  189
            SP   +A    P+SE         D + + + +DL+VIG G  G  C+ + A  G+ V +
Sbjct  39   SPAADSAATRKPLSEL------LQDLKASEH-FDLIVIGSGPAGQKCAIDHAKHGKSVAI  91

Query  190  LDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHH----DG-----ANFG---  237
            +D            +GG C++ G +P K   ++ L      H    DG       FG   
Sbjct  92   ID--------KRDMVGGVCIHTGTVPSKTFREAILHLTAHRHRSFYDGESEPKKRFGIED  143

Query  238  --WNLSSGDGNAPTFNWKQLVSN----VDGYIKSINF---KYKVELRSKYVKYENFLGSF  288
                +   +         QL+ N    ++G  +       +  + LR+  ++  N    F
Sbjct  144  VLQRVRKVESAETDITRHQLLRNGIELINGTARFXXXXCDRALILLRNG-IELINGTARF  202

Query  289  VNPHTLEL--------WHPRKGTKQITTRDV----------VIAVGGRP--KELTCPGGE  328
            +   ++++        +     TK+ T+ D+          +IAVG RP  +E     G+
Sbjct  203  LPDPSMKMVAVLSNDSYDTPTDTKRHTSADICKRVLTADKFLIAVGTRPARREDIPFDGK  262

Query  329  HAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQD  385
                SD I W      P + +VVGA  + +E A  +  + G +V V+  R  +L   D++
Sbjct  263  TIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGSEVTVIDGRKEILDMADKE  322

Query  386  MADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRD  445
            +A+ + +Y   QSG  F      +S+ K  NG+++VK  S  G++     D +L   GR 
Sbjct  323  VAEAL-KYAMRQSGTRFYTDETIKSVEKAANGEVIVKLNS--GKTI--IGDGLLYTVGRQ  377

Query  446  PDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  503
                 LNL   G++  +K G + V  N +TS P+IYA GD I  P L   +++ GRL S
Sbjct  378  GSTDGLNLAAVGLE-TDKRGLLQVDDNFRTSVPHIYAAGDCIGYPALASTSMEQGRLAS  435

>PYIR_21896
Length=518

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 123/502 (25%), Positives = 202/502 (40%), Gaps = 70/502 (14%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            +YDLVVIG G     C+ E+A  G++V V+D            +GG CV+ G IP K   
Sbjct  37   NYDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFR  88

Query  221  QSSL-IGEVIHHDGANFGWNLSSGDGNAPTFNWKQLV-SNVDGYIKSINFKYKVELRSKY  278
            ++ L +    HH      +++ +   +   +  K++V S VD  I          +R   
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDISI----------VRDTP  138

Query  279  VKYENFLGSFVNPHTLELWHPRKGT-KQITTRDVVIAVGGRPKE--LTCPGGEHAISSDD  335
                   G        +  H    T  ++     +IA G RP    L    G+    SD 
Sbjct  139  DAAGGDAG--------DSDHDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKVIFDSDQ  190

Query  336  IFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMADKIGE  392
            I     +E P   +VVGA  + +E A  +  + G+ V V+  RS +L   D ++   +  
Sbjct  191  ILSGDIRELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIISNLTY  250

Query  393  YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLN  452
             M    G  F+     + + K E+G + V + S    S     D +L   GR      LN
Sbjct  251  EMR-SKGARFLLGETIKHVEKTESG-VTVHFNSGKITSA----DALLYTVGRQAATDGLN  304

Query  453  LDKAGVKLNEKSGRIWVKNEQTSTPNI------------------YAIGDVIDAPELTPV  494
            L+   +  N +      K+ QT+ P++                  YA GD I AP L   
Sbjct  305  LEAVDLSRNPRGLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSLAST  364

Query  495  AIQAGRLLSRRLYNNS----TVQMDYEKVCTAVFTPIEYGCCGMSEED-SKERFGEDNIE  549
            +++ GRL +  +++      T Q++       ++T  E    G +E+  +KE     N E
Sbjct  365  SMEQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGL---NFE  421

Query  550  VYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMK  609
            +    +  L     + +        LK++ D T  K   G H +G  A E+     +AM 
Sbjct  422  IGIAKYSELAKGQMSGSTAGG---MLKILFDPTTLKLF-GVHAIGEGATEIIHIGQVAMA  477

Query  610  LGFTYDQMVDTVGIHPTTAESF  631
            +G +     D V  +PT AE++
Sbjct  478  MGCSITYFRDAVFNYPTLAEAY  499

>PITG_19065
Length=416

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 91/338 (27%), Positives = 149/338 (44%), Gaps = 24/338 (7%)

Query  305  QITTRDVVIAVGGRPKE--LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAG  361
            +I     +IA G RP    L    G+  I SD I      + P   +V+GA  + +E A 
Sbjct  74   RIKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYAS  133

Query  362  FLKGM-GYDVKVMV-RSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQL  419
             +  + G+ V V+  R  +L   D+++   +   M+  +G  F+   + +++ K+E    
Sbjct  134  MVNVVPGHTVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVETTDK  189

Query  420  LVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPN  478
             VK     G++   + D +L   GR      LNL+  G+  N + G I V KN QT  P+
Sbjct  190  RVKVFFNSGKAL--SADALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPH  246

Query  479  IYAIGDVIDAPELTPVAIQAGRLLSRRLYN-----NSTVQMDYEKVCTAVFTPIEYGCCG  533
            IYA GD I AP L   +++ GRL S  ++N      +T Q++       ++T  E    G
Sbjct  247  IYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVG  306

Query  534  MSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYL  593
             +E    ++  +D +  Y                 A     LK++ D    K V G H +
Sbjct  307  QTE----QQLTKDCVN-YEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAI  360

Query  594  GPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            G  A E+     +AM +G +     D V  +PT AE++
Sbjct  361  GEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  398

>PHYSO_562795
Length=415

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 89/331 (27%), Positives = 146/331 (44%), Gaps = 24/331 (7%)

Query  312  VIAVGGRPKE--LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-G  367
            +IA G RP    L    G+  I SD I      + P   +V+GA  + +E A  +  + G
Sbjct  80   LIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPG  139

Query  368  YDVKVMV-RSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE  426
            + V V+  R  +L   D+++   +   M+  +G  F+   + +++ K+E  +  VK   +
Sbjct  140  HSVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVETTENRVKVFFD  195

Query  427  DGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWV-KNEQTSTPNIYAIGDV  485
             G+    + D +L   GR      LNL+  G+  N + G I V +N QT  P+IYA GD 
Sbjct  196  SGKVL--SADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNQNYQTDQPHIYAAGDC  252

Query  486  IDAPELTPVAIQAGRLLSRRLYN-----NSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSK  540
            I AP L   +++ GRL S  ++N       T Q+D       ++T  E    G +E    
Sbjct  253  IGAPALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYGIYTIPEISMVGQTE----  308

Query  541  ERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEV  600
            ++  +D +  Y                 A     LK++ D    K   G H +G  A E+
Sbjct  309  QQLTKDCVN-YEVGIAKYSELAKGQMMGAMAGGTLKILFDPDTLKL-FGVHAIGEGATEI  366

Query  601  TQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
                 +AM +G +     D V  +PT AE++
Sbjct  367  IHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  397

>HYAP_08069
Length=255

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 97/219 (44%), Gaps = 21/219 (10%)

Query  161  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  220
            DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  221  QSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVK  280
             S+ +     H+  ++G      D    T N+ Q++   +  ++++    +       V 
Sbjct  86   HSTHLLHTAQHEFKSYGI-----DAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVT  140

Query  281  YENFLGSFVNPHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSD  334
            Y   +G       + +    R+G   +T +++++A G       P  +    G+   S+ 
Sbjct  141  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  200

Query  335  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  373
             +     + P   +VVGA  + LE     K +G  V V+
Sbjct  201  ALALT--RVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  237

 Score = 35.4 bits (80),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 64/166 (39%), Gaps = 32/166 (19%)

Query  66   HWLSESQDEFATSFGVDS---------------KATKHVTSPF--VWSSNPTAFVGGCDD  108
            H L  +Q EF  S+G+D+               KA + +T+    ++S N   ++ G   
Sbjct  89   HLLHTAQHEF-KSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKGVGK  147

Query  109  LLTYFRSGVGVGNPQGATPNGSPTEK-----TAEADVPMSETSVEET------STADAEE  157
            L    +  V + + QG   NG+ T K     T     P+    V+        ST     
Sbjct  148  LAAKGQVSVTLADRQG---NGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTGALAL  204

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWG  203
            T     LVV+G G  GL         G KV V++Y+  +  G   G
Sbjct  205  TRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKG  250

>SPRG_04114
Length=376

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 93/371 (25%), Positives = 160/371 (43%), Gaps = 25/371 (7%)

Query  271  KVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKE--LTCPGGE  328
            + +L++  V     L  F N + + +        ++  +  ++A G RP    L    G+
Sbjct  5    QAQLKAARVDLVPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGK  64

Query  329  HAISSDDIFWMKK-KEPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQD  385
              + SD I      K P   +VVGA  + +E A  L  + G +V V+  R+ +L   D +
Sbjct  65   IILDSDQILNHDTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDE  124

Query  386  MADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRD  445
            +   +   M    G  F+     +S+   +NG   VK     G++     + +L   GR 
Sbjct  125  IVSSLKMEMR-HKGARFLLGESIKSVEHFKNG---VKVEFNSGKAM--FAEALLYCVGRQ  178

Query  446  PDVAKLNLDKAGVKLNEKSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  504
             +   LNL+  G+  N + G I V  + QTS P+IYA GD I AP L   +++ GRL + 
Sbjct  179  ANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAAC  237

Query  505  RLYNN---STVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPL-EW  560
             ++++   +T Q++       ++T  E    G +E+   +     N  V    F  L + 
Sbjct  238  DMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYAVGLAKFSELAKG  295

Query  561  SLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  620
             +S D         LK++ D    +  +G H +G  A E+     +AM +        D 
Sbjct  296  QMSGDIEG-----ILKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKITYFRDA  349

Query  621  VGIHPTTAESF  631
            V  +PT AE +
Sbjct  350  VFNYPTLAEGY  360

>PPTG_24712
Length=67

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 3/66 (5%)

Query  158  TNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  217
            T+  YD +VIGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYMVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  59

Query  218  LMHQSS  223
            +M  ++
Sbjct  60   VMFNTA  65

>PITG_19802
Length=185

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 77/165 (47%), Gaps = 10/165 (6%)

Query  468  WVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPI  527
            W      S P I+AIGDVI    L   A + G      +       ++Y  +   ++T  
Sbjct  16   WPLERIKSVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFP  74

Query  528  EYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYL-KVICDKTRDKF  586
            E+   G +EE+ K     + IE Y+    P+    ++  RT AE+  L KV+ DK  DK 
Sbjct  75   EFASVGKTEEELKA----EGIE-YNVGKFPM--MANSRARTIAEADGLVKVLADKKTDK-  126

Query  587  VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            ++G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  127  LLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  171

>HYAP_13613
Length=423

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 101/237 (43%), Gaps = 21/237 (9%)

Query  150  TSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCV  209
            TST         YDLVVIG G     C+ ++A  G++V ++D            LGG CV
Sbjct  21   TSTQSQLSPVSSYDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCV  72

Query  210  NVGCIPKKLMHQSSL-IGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINF  268
            + G IP K   ++ L +    HH      +++ +       +  +++VS+ +  +++   
Sbjct  73   HTGTIPSKTFREAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLK  132

Query  269  KYKVELRSKYVKYENFLGSFV--------NPHTLELWHPRKGTKQITTRDVVIAVGGRPK  320
              +V++   + ++E+     +           T +  +      ++     ++A G RP 
Sbjct  133  AARVDVIPGFARFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPA  192

Query  321  E--LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  373
               L    G+  I SD I     ++ P   +VVGA  + +E A  +  + G+ V V+
Sbjct  193  HNPLVPIDGKIVIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMINVVPGHSVTVV  249

 Score = 37.7 bits (86),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 63/153 (41%), Gaps = 11/153 (7%)

Query  484  DVIDAPELTPVAIQAGRLLSRRLY-----NNSTVQMDYEKVCTAVFTPIEYGCCGMSEED  538
            D I AP L   +++ GRL S  ++     +  T Q++       ++T  E    G +E+ 
Sbjct  259  DCIGAPALASTSMEQGRLASCHMWEVDEEHAGTSQLENGNYPYGIYTIPEISMVGQTEQ-  317

Query  539  SKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAG  598
               +  +D +  Y                 A     LK++ D    K V+G H +G  A 
Sbjct  318  ---QLTKDCVN-YEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VLGVHAIGEGAT  372

Query  599  EVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
            E+     +AM +G +     D V  +PT AE++
Sbjct  373  EIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  405

>PYIW_27568
Length=128

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 9/120 (8%)

Query  513  QMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAES  572
             ++Y  +   ++T  E    G +EE  KE         Y+    P+    ++  R   E+
Sbjct  3    HVNYNAIPGVIYTFPEVASVGKTEEQLKEEG-----VAYNVGKFPM--MANSRARAVGEA  55

Query  573  CYL-KVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
              L KVI DK  DK ++G H +  NAGE+     L M+ G   + +  T   HPT +E+F
Sbjct  56   DGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHPTLSEAF  114

>SPRG_04231
Length=90

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (56%), Gaps = 0/52 (0%)

Query  583  RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  634
            +DK VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  60

>HYAP_08068
Length=100

 Score = 40.4 bits (93),  Expect = 0.003, Method: Composition-based stats.
 Identities = 23/70 (33%), Positives = 39/70 (56%), Gaps = 2/70 (3%)

Query  563  STDTRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  621
            ++  RT AE+   +KV+ DK  DK ++G H +  NAGE+     + ++ G   + +  T 
Sbjct  3    NSRARTVAEADGMVKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTC  61

Query  622  GIHPTTAESF  631
              HPT +E+F
Sbjct  62   HAHPTLSEAF  71

>SPRG_17626
Length=148

 Score = 41.2 bits (95),  Expect = 0.004, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 59/120 (49%), Gaps = 9/120 (8%)

Query  513  QMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAES  572
             ++Y  +   V+T  E    G +EE+ K      N+  Y+    P+    ++  RT  E+
Sbjct  23   HVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGKFPM--MANSRARTVGET  75

Query  573  -CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  631
              ++K++  K  DK ++G H +  NAGE+     L ++ G + + +  T   HPT +E+F
Sbjct  76   DGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEAF  134

>SPRG_18643
Length=85

 Score = 39.3 bits (90),  Expect = 0.006, Method: Composition-based stats.
 Identities = 23/63 (37%), Positives = 33/63 (52%), Gaps = 5/63 (8%)

Query  129  GSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVC  188
            G  TE  A+AD   S T++     A        +DLVVIG G  G  C+ ++A  G+KV 
Sbjct  21   GLSTEAEAKADDASSFTNILRNLRASEH-----FDLVVIGSGPSGQKCAIDSAKHGKKVA  75

Query  189  VLD  191
            ++D
Sbjct  76   IID  78

>CCI40989
Length=552

 Score = 39.7 bits (91),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 61/136 (45%), Gaps = 20/136 (15%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  221
            +D V+IGGG  GL  +   A  G++VCVL+            +GG  V     P  L  +
Sbjct  14   WDAVIIGGGHNGLVAAAYLAKAGKQVCVLE--------KRHVIGGAAVTEEIFPGFLFSR  65

Query  222  SSLIGEVIHHDGANF------GWNLSSGDGNA--PTFNWKQLV--SNVDGYIKSINFKYK  271
            +S +  +   D   +      G ++ S D  +  PT N K L+  S+++   +SI    K
Sbjct  66   ASYVFSLFRPDIIEYLELKRRGLHIYSRDPGSFTPTLNQKSLLLWSDMEKTQQSIGQFSK  125

Query  272  VE--LRSKYVKYENFL  285
             +  +  KY+K   FL
Sbjct  126  ADALMYPKYIKDLEFL  141

>PYU1_G014369
Length=703

 Score = 38.1 bits (87),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 9/100 (9%)

Query  311  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP-GKTL-VVGASYVALECAGFLKGMGY  368
            VVIA G  P++L  PGG+H+     I  +K K P GK + V+GA  +  + + FL  +G 
Sbjct  462  VVIATGVLPRDLKIPGGDHSKVLSYIDVLKHKAPVGKRVAVIGAGGIGFDVSEFLTHIGK  521

Query  369  DVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVP  408
               + V ++  + +  D ++       V+ G++ +++ VP
Sbjct  522  SASLDV-NLFAKEWGIDTSN------SVRGGVQGVKQEVP  554

>PHYSO_507629
Length=703

 Score = 38.1 bits (87),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 9/100 (9%)

Query  311  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  368
            VVIA G  P+EL  PG +H      I  +K K P   K  V+GA  +  + A F+  +G 
Sbjct  462  VVIATGVLPRELKIPGADHPKVLSYIDVLKNKAPVGKKVAVIGAGGIGFDVAEFITHVGE  521

Query  369  DVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVP  408
                 V +   R +  DM +       V+ G+  I+ ++P
Sbjct  522  STSSSVDA-FAREWGIDMTN------SVRGGVAGIKPSIP  554

>PHYCA_524942
Length=1028

 Score = 37.4 bits (85),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 13/168 (8%)

Query  351  GASYVALECAGFLKGMGYDVKVMVRSI------LLRGFDQDMADKIGEYMEVQSGIEFI-  403
            G     +E AG  K + +D+ V VR I      + R  D D A  +   +  + GI+ + 
Sbjct  148  GEKQAKIEAAGAAKAV-HDLNVSVRIINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLY  206

Query  404  RKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEK  463
             K+  + I   ENG   V++T  +GE  ++    ++ ATG  P     +   +G++L  +
Sbjct  207  EKSTQEIIGSQENGVEAVQFT--NGERFDDIC-MIIFATGIKPRDELAH--SSGLELGNR  261

Query  464  SGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNST  511
             G +     + S P++YA+G+ I   +LT   +  G  ++  L  N T
Sbjct  262  GGILINDFLECSVPDVYALGECISHRDLTYGLVAPGYEMADVLAKNFT  309

>PYU1_G000378
Length=1070

 Score = 36.2 bits (82),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 98/221 (44%), Gaps = 18/221 (8%)

Query  348  LVVGASYVALECAGFLKGMGYDVKVMVR--SILLRGFDQDMADKIGEYMEVQSGIEFIRK  405
            LV+G   + LE A  +  +   V+++ R   ++ R  D   A  +   +  + GIE +  
Sbjct  160  LVIGGGLLGLEAAKAIHDLQLSVRIVNRGSRLMSRQLDDAGAKVLHNEIVSKFGIEVLY-  218

Query  406  TVPQSITKLENGQLLVKWTS-EDGESCEEAFDTVLNATGRDP--DVAKLNLDKAGVKLNE  462
                  TK  +G  +V+     DGES ++ F  V  ATG  P  D+ +     +G+ + +
Sbjct  219  ---HKTTKYIHGTTVVEGVDFTDGESYDDVFMIVF-ATGIKPRDDLGR----DSGLDVAQ  270

Query  463  KSGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCT  521
            + G I V +  +TS  ++YAIG+ +   ++T   +  G  ++  L  N T   D + + T
Sbjct  271  RGGGILVNDLLETSHKDVYAIGECVSHRDVTYGLVAPGYEMADNLAKNFTANGDEKVLFT  330

Query  522  AVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFV---PLE  559
               +  +    GM        F E+++   +   V   PLE
Sbjct  331  GSDSSTKLKLMGMEVAAFGAYFPEEHLNEPYEELVYNNPLE  371

>PHALS_10960
Length=702

 Score = 35.4 bits (80),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 36/164 (22%), Positives = 72/164 (44%), Gaps = 18/164 (11%)

Query  311  VVIAVGGRPKELTCPGGEH--AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGY  368
            VV+A G  P+ L  PG +H   +S  D+   K K   +  ++GA  +  + A FL  +G 
Sbjct  462  VVMASGVLPRPLKIPGADHPMVLSYMDVLKKKSKVGQRVAIIGAGGIGFDVAEFLTHVGE  521

Query  369  DVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDG  428
                 V  +  R +  D  +       V+ G+  I+ +VP    ++    L+ + +++ G
Sbjct  522  STSSSV-EVFAREWGIDTTN------SVRGGVAGIKSSVPPPAREI---YLMQRKSTKHG  571

Query  429  ESCEEAFDTVLNATGRDPDVAKL------NLDKAGVKLNEKSGR  466
            +   +    +   + +  +V  +       +D AG+   +KSG+
Sbjct  572  KDLGKTTGWIHRLSLKHRNVKMIGGVSYDKVDDAGLHYTDKSGK  615

>PYAP_15943
Length=139

 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLD  191
            +D VV+GGG  GL  +   A  G++VCVL+
Sbjct  14   WDAVVVGGGHNGLVAAAYLAKAGKRVCVLE  43

>PYU1_G004385
Length=562

 Score = 35.0 bits (79),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  153  ADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  191
            A A  T   +D +V+GGG  GL  +   A  G++VCVL+
Sbjct  4    ARAALTRKKWDAIVVGGGHNGLVAAAYLAKAGKQVCVLE  42

>PYAP_17256
Length=705

 Score = 35.0 bits (79),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 38/168 (23%), Positives = 75/168 (45%), Gaps = 26/168 (15%)

Query  311  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMG-  367
            V++A G  P++L  PG +H      I  +K K P   K  V+GA  +  + + ++   G 
Sbjct  464  VIVATGVLPRDLKIPGADHPKVVSYIDVLKHKVPVGKKVAVIGAGGIGFDVSEYVTHHGK  523

Query  368  ---YDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT  424
                DV +  +     GFD   +        V+ GI  ++  +P+S  ++    LL + +
Sbjct  524  SPSLDVNLFAKEW---GFDVTNS--------VRGGIAGVKPEIPESPREV---YLLQRKS  569

Query  425  SEDGESCEEAFDTVLNATGRDPDVAKL------NLDKAGVKLNEKSGR  466
            ++ G+   +    +  A+ +  DV  +       +D AG+ + +K G+
Sbjct  570  TKHGKDLGKTTGWIHRASLKARDVKMIGGVKYDKVDDAGLHITDKKGQ  617

>PPTG_08060
Length=725

 Score = 35.0 bits (79),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 9/100 (9%)

Query  311  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  368
            VVIA G  P+ L  PG +H      I  +K K P   K  ++GA  +  + A FL  +G 
Sbjct  484  VVIATGVLPRTLKIPGADHPKVLSYIDVLKHKAPVGKKVAIIGAGGIGFDVAEFLSHVGE  543

Query  369  DVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVP  408
                 V  +  R +  D  +       V+ G+  I+ ++P
Sbjct  544  STSSSV-DVFAREWGIDTTN------SVRGGVAGIKPSIP  576

>HYAP_03065
Length=701

 Score = 34.7 bits (78),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 16/117 (14%)

Query  250  FNWKQLVSNVDGYIKSIN-FKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITT  308
            FN  ++V   + + +++  F+ +++LR   VK    LG     H +E      G      
Sbjct  411  FNMAKIVPGKEEFYETLRYFEKQLKLRGVNVK----LG-----HRVEAAELMSGAFD---  458

Query  309  RDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFL  363
              VVIA G  P+ LT PG +H      I  +K + P   K  ++GA  +  + A FL
Sbjct  459  -KVVIATGVVPRSLTIPGADHPKVLSYIDVLKNEAPVGQKVAIIGAGGIGFDVAEFL  514

>CCI10948
Length=288

 Score = 33.9 bits (76),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 24/93 (26%), Positives = 40/93 (43%), Gaps = 9/93 (10%)

Query  259  VDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHT-LELWHPRKGTKQITTRDVVIAVGG  317
            VDG+ ++    Y+ +   +   YE F+  FV P    E+W  R     +T  +   A   
Sbjct  3    VDGHERTDVVAYRTQFLERMKIYEPFMPQFVGPEMESEIWPARDAIILVTHDESTFAAHV  62

Query  318  RPKELTCPGGEHAISSDDIFWMKKKEPGKTLVV  350
              K+L  P GE          ++KK  G+++ V
Sbjct  63   GQKKLWFPDGEQP--------LRKKGAGRSIHV  87

>PITG_00703
Length=703

 Score = 34.3 bits (77),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query  311  VVIAVGGRPKELTCPGGEH--AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMG  367
            VVIA G  P+ L  PG +H   +S  D+   K     K  ++GA  +  + A FL  +G
Sbjct  462  VVIATGVLPRALKIPGADHPKVLSYLDVLKNKAPVGNKVAIIGAGGIGFDVAEFLAHVG  520

>PHYSO_317690
Length=1057

 Score = 34.3 bits (77),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 38/159 (24%), Positives = 75/159 (47%), Gaps = 12/159 (8%)

Query  368  YDVKVMVRSI------LLRGFDQDMADKIGEYMEVQSGIEFIR-KTVPQSITKLENGQLL  420
            +D+KV VR I      + R  D D A  +   +  + GI+ +  K+  + +   ENG   
Sbjct  192  HDLKVAVRVINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLYDKSTQEILGSEENGVEA  251

Query  421  VKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIY  480
            V++T  +GE  ++    ++ ATG  P     +   +G++L ++ G +     + S P++Y
Sbjct  252  VQFT--NGERFDDVC-MIIFATGIKPRDELAH--SSGLELAKRGGILINDYLECSAPSVY  306

Query  481  AIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKV  519
            A+G+ I     T   +  G  ++  L  N T +   +++
Sbjct  307  ALGECISHRNFTYGLVAPGYEMADTLAKNFTCRSPEDRI  345

>PHYRA_72196
Length=691

 Score = 34.3 bits (77),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 30/59 (51%), Gaps = 2/59 (3%)

Query  311  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMG  367
            VVI+ G  P+ L  PG +H      I  +KKK P   K  ++GA  +  + A F+  +G
Sbjct  462  VVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKVAIIGAGGIGFDVAEFITHVG  520

>PHYRA_87328
Length=486

 Score = 33.9 bits (76),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 30/59 (51%), Gaps = 2/59 (3%)

Query  311  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMG  367
            VVI+ G  P+ L  PG +H      I  +KKK P   K  ++GA  +  + A F+  +G
Sbjct  245  VVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKVAIIGAGGIGFDVAEFITHVG  303

>PITG_21046
Length=319

 Score = 33.5 bits (75),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (47%), Gaps = 17/103 (17%)

Query  256  VSNVDGYIKSINFKYKVEL--RSKYV-----------KYENFLGSFVNPHTLELWHPRKG  302
            V ++DG +   +F+  ++L  +S+Y            K  + LGS   P   +LW+  + 
Sbjct  159  VVDIDGNVNPQDFQRGMQLAAKSEYTLVVLGEPNYAEKTGDLLGSMALPAG-QLWYLEEL  217

Query  303  TKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPG  345
            TK  +T+ +V+ V GRP+ L    G H  +   I  M   E G
Sbjct  218  TKLNSTKVIVVLVSGRPRLLE---GAHNHADAVILSMLPCEQG  257

>PYVX_22491
Length=1640

 Score = 33.5 bits (75),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 35/76 (46%), Gaps = 5/76 (7%)

Query  486  IDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGE  545
            + AP   P ++ A +   R L + + ++ + E VC AVF    +     S ED+ +R G 
Sbjct  774  LRAPPSEPPSMYALQTTPRDLPSQALLRKEVESVCAAVFASASHRAAVESAEDADDRDGS  833

Query  546  -----DNIEVYHTNFV  556
                 DN E+  T  V
Sbjct  834  HLLFLDNAEILLTFVV  849

>PITG_02760
Length=165

 Score = 32.0 bits (71),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLD  191
            +D +V+GGG  GL  +   A  G+ VCVL+
Sbjct  12   WDAIVVGGGHNGLVAASYLAKAGKSVCVLE  41

>PHYSO_487184
Length=283

 Score = 32.7 bits (73),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 0/48 (0%)

Query  11   LVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPF  58
            L  +P S V    +A W++ PSFV    +  A   +  DR+  + +PF
Sbjct  92   LYAAPPSRVQVVALANWESAPSFVLDDHLGKAFPRVSSDRLLNKCNPF  139

>SDRG_06501
Length=623

 Score = 33.1 bits (74),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 22/35 (63%), Gaps = 0/35 (0%)

Query  157  ETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  191
            E N D D+++IGGG+ G A +   A  G+KV V +
Sbjct  120  EANRDADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

>SPRG_11641
Length=623

 Score = 32.7 bits (73),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 22/35 (63%), Gaps = 0/35 (0%)

Query  157  ETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  191
            E N D D+++IGGG+ G A +   A  G+KV V +
Sbjct  120  EANRDADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

>PYVX_18330
Length=558

 Score = 32.7 bits (73),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  162  YDLVVIGGGSGGLACSKEAASFGQKVCVLD  191
            +D +V+GGG  GL  +   A  G++VCVL+
Sbjct  13   WDAIVVGGGHNGLVAASYLAKAGKQVCVLE  42

>SPRG_08354
Length=550

 Score = 32.7 bits (73),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 31/71 (44%), Gaps = 8/71 (11%)

Query  155  AEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  214
            A+     +D V++GGG  GL  +   A  G+ VCVL+            LGG  V    I
Sbjct  8    AQHLARKWDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEII  59

Query  215  PKKLMHQSSLI  225
            P     ++S +
Sbjct  60   PNFHFSRASYV  70

>CCI50227
Length=707

 Score = 32.7 bits (73),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query  323  TCPGGEHAISSDD-IFWMKKKEPGKTLVVGASYVALECAGF---LKGMGYDVKVMVRSIL  378
            +   GE   S DD I  M++ +PG   V G S  A+E + F   LK  GY+V  MV +I 
Sbjct  445  STKSGEEMTSLDDYISRMQENQPGIYYVTGESKKAVENSPFLEKLKKKGYEVIYMVEAI-  503

Query  379  LRGFDQDMADKIGEY  393
                D+    ++ EY
Sbjct  504  ----DEYAVQQLKEY  514

>PHALS_12308
Length=526

 Score = 32.3 bits (72),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 49/107 (46%), Gaps = 5/107 (5%)

Query  429  ESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDA  488
            E+CE+ F T  N  GR  D+  L  D  G  +    G  W+K  + ++  ++++  + D 
Sbjct  106  EACEDVFKTQFNVFGRGDDLVDLQHDIFGEGVAGVDGEKWIKQRRIAS-RMFSMKMLRDV  164

Query  489  PE--LTPVAIQAGRLLSRRLYNNSTVQMD--YEKVCTAVFTPIEYGC  531
             E  +   +++   +L++   +   V M     K  + VFT + +G 
Sbjct  165  MEDVIIEKSVRFRDVLAQCAKDRRIVPMRSLLGKFSSDVFTKVGFGV  211

>PHYRA_76113
Length=764

 Score = 32.7 bits (73),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 41/80 (51%), Gaps = 14/80 (18%)

Query  256  VSNVDGYIKSINFKYKVEL--RSKYV-----------KYENFLGSFVNPHTLELWHPRKG  302
            V ++DG +   +F+  ++L  +S+Y            K  + LGS   P   +LW+  + 
Sbjct  440  VVDIDGNVSPHDFQRGLQLAAKSEYTIVALGEPNYAEKTGDLLGSMALPAG-QLWYLEEL  498

Query  303  TKQITTRDVVIAVGGRPKEL  322
            TK  +T+ +V+ V GRP+ L
Sbjct  499  TKLNSTKVIVVVVSGRPRLL  518

Lambda      K        H        a         alpha
   0.316    0.133    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 50899872873

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40