Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_537323449662002009725e-135
PPTG_17123147532011799092e-125
PHYRA_81105534612011798589e-118
PITG_18452147538561809033e-116
PHYSO_353401534611461467002e-94
HYAP_07096534612511817032e-93
PYVX_18173449665001756974e-89
PYU1_G001739932032661645298e-67
PHYKE_8390534611301094977e-64
PYU1_G001738534612261574892e-61
PYIW_18788932032441654531e-55
PYU1_G001740147522061604456e-55
PYIR_25089854042621714436e-54
PPTG_10635528561991654371e-53
PYU1_G001742932042131604311e-52
PYU1_G001744568762131604301e-52
PHYRA_85631109792281594303e-52
PYU1_G001741854041991624256e-52
PHYRA_84190720132061694241e-51
PHYSO_536424606911971754231e-51
PHYSO_507031586531971754231e-51
PHYCA_14369109792481654262e-51
PHYSO_341599109791851654202e-51
PPTG_10636109792461654235e-51
PPTG_10634720132081594189e-51
PHYCA_102624720131951594134e-50
PHYCA_102852242061951594109e-50
PPTG_10048213141901644063e-49
PHYCA_102550457052681654133e-49
PHYSO_477820568762021664056e-49
PHYKE_8388568762051634031e-48
PHALS_00498109791991714004e-48
PHYRA_82864231281931593978e-48
PHYRA_81107568762021633962e-47
PYIR_26626147522121763953e-47
PHYKE_8389147522041633943e-47
PPTG_10643457052501593975e-47
PPTG_15264231281941633918e-47
PPTG_17366239131941633918e-47
PPTG_17121568762021633919e-47
PHYCA_129425147522041633892e-46
PHYCA_511409568762041633865e-46
PHYRA_81106147522021633856e-46
PHYKE_7718109792201593842e-45
PHYSO_284086147522041633822e-45
PYIW_18791854041941653813e-45
PHYKE_3446231281991593803e-45
PPTG_17122147522041633735e-44
PHALS_03284309411881593701e-43
PYAP_22273932032681403647e-42
PYVX_18174854042041643562e-41
PYIR_26546866052391793573e-41
PYAR_24096932032271393563e-41
PYVX_18176568762011633501e-40
PITG_18450147522031633458e-40
PYAP_22279854042231713391e-38
PHALS_0648053461159743191e-36
PHYCA_510817445761881383203e-36
PYAP_22278932042891713274e-36
PPTG_14254445761881383152e-35
PPTG_0882086622501643183e-35
PHYSO_499978231281741383123e-35
PHYSO_501575820771741383123e-35
PPTG_14255469372681383176e-35
PHYSO_343376532371721173002e-33
PHYKE_9185445762811383072e-33
PITG_13520109791711282993e-33
PHYSO_417649445761851382993e-33
PITG_1049986623231603069e-33
PHYSO_262732469371881212933e-32
PHYCA_53693413059831383091e-31
PHYSO_254168462841701532821e-30
PHYSO_340369526762001402762e-29
PHYSO_341596528562311142721e-28
PHYSO_527908600641741262654e-28
PYAP_18131991722261192432e-24
PHYCA_14368528562191672283e-22
PHYSO_342364529831941262177e-21
PHYRA_74651699693441322231e-20
PHYRA_73607194343431322212e-20
PYAP_246891014392521342139e-20
PYAP_18711943562101272101e-19
PHYCA_534473423310501322191e-19
PPTG_04622696962731322113e-19
PHYRA_7358442332871382113e-19
H310_0636217301971352064e-19
PYIR_1643542333041222105e-19
PHYSO_484051571982851292052e-18
PHYKE_2937571983661292073e-18
PHYRA_73606571983661292054e-18
PPTG_04647194343271292045e-18
PYVX_14662510865401322058e-18
PHYSO_533903604652081271942e-17
PHYCA_531163194343141321983e-17
PITG_0494842342321261943e-17
PHYCA_13036542352661261954e-17
PHYKE_10578778802391061928e-17
PHYRA_86016727462361121902e-16
PHYCA_534296526713091321922e-16
PHYRA_77971705552301121892e-16
PHYRA_85794726192301121892e-16
PHYKE_600144782891281912e-16
PHYRA_86752732363001121912e-16
PITG_0527144782781241912e-16
PHYKE_2809752822911221912e-16
PPTG_0461842353261271922e-16
PHYRA_83499204334731121942e-16
SDRG_173181339462411351882e-16
PYU1_G01469042342951241903e-16
PHYSO_48395542353201261903e-16
H257_1355017302661331884e-16
SPRG_199171339462411411874e-16
PHYSO_340333526712841261884e-16
PPTG_0461942342761261885e-16
PYU1_G005323943552511181875e-16
PITG_0494942353371271895e-16
PYIR_24743851643571541896e-16
PHYSO_34033244782951261878e-16
PHYCA_98479819502761061869e-16
SDRG_081371363342821411869e-16
PYU1_G007476539131951231821e-15
SDRG_081291363312181411831e-15
SDRG_075651244122781261851e-15
PYAP_19707995792411061831e-15
PYIR_16375823732621201842e-15
PHYCA_1961197755311281882e-15
PHYSO_48552442342781331842e-15
PYAP_18709943552351181822e-15
PHYCA_12942213313531011852e-15
PYIW_27477823991801191782e-15
PHYCA_1865738072951121833e-15
PPTG_07521450302811061833e-15
PHYRA_78175764333191231843e-15
PHYRA_7868968382961321833e-15
PPTG_07509718142991121824e-15
PYAR_18165995792611011814e-15
PHALS_0539242353671301844e-15
PPTG_0750738072991121824e-15
PYIR_1644442341821201775e-15
PHYSO_459106194342231291785e-15
PHALS_03179308833721271836e-15
PYIW_19151831912481671796e-15
PHYSO_533747604512061261768e-15
PYVX_16138786195591261838e-15
PYAR_14256943551991211769e-15
PHYSO_438103557212381321779e-15
PHYKE_391342343211221801e-14
PYVX_20789539132901991791e-14
PYU1_G007364851643161041801e-14
PPTG_0313997753201231791e-14
PHYKE_6077188563221281791e-14
PYIR_16443823992751201781e-14
PHYRA_84947539132651341771e-14
PHYRA_78176597733121281781e-14
PHYCA_97965401872881061782e-14
PHYCA_12943369712871061772e-14
PYVX_1817514752147411702e-14
PHYRA_7358342346301261802e-14
PHYCA_12727044782791321772e-14
PHYSO_533682604462781311762e-14
PHALS_0317644782071261732e-14
SPRG_19916161733051421772e-14
PYVX_1817953461147411683e-14
PYAP_18138991732681181744e-14
PHYSO_374518539131161051664e-14
SDRG_0878217304501771774e-14
PHYSO_524101597733081281754e-14
PHYSO_246676457051871591695e-14
PITG_1193697753331231756e-14
SPRG_077951259793351231738e-14
CCA1717917291851261688e-14
PHYRA_78161375713731251749e-14
PPTG_0462042333421291739e-14
PYIW_2196497752651281719e-14
CCI4738117292111261691e-13
PHYRA_7914038074241121741e-13
SPRG_076271258855361351741e-13
SPRG_2216117303001351711e-13
PYU1_G005324845341911231671e-13
PYU1_G005326463491911231671e-13
PYU1_G00532842331911231671e-13
PHYKE_6079597733021301711e-13
PYVX_21297798802631061701e-13
PYVX_20783375052761271702e-13
SDRG_154261258855231351722e-13
PPTG_0752038142941061702e-13
PHYRA_7358242353261261712e-13
PYAR_14260845342121201672e-13
PPTG_07516464352941061702e-13
PHYKE_2454751493741221712e-13
PITG_0494742332981291693e-13
PHYSO_24648197753181281693e-13
PHYRA_83494464352241061663e-13
PYAP_1971299581276971683e-13
PYAP_24691101441145701623e-13
PYIR_17978827562501311673e-13
PYU1_G005325943562071201653e-13
PHYCA_112615308831961141644e-13
PHYRA_7862657895473551704e-13
PHYRA_7862554146434551694e-13
PHYRA_83500718143941121694e-13
PHYCA_19598375713901231694e-13
PHYRA_78174188562791381674e-13
PHYCA_69583463492241321655e-13
PYVX_24563161732541291655e-13
PHYKE_607897753171301675e-13
PITG_0889273983091211675e-13
PYIW_1879293204125961586e-13
PYU1_G00152797792781291666e-13
PYU1_G00152397762781291666e-13
PHYKE_574938073001051666e-13
PPTG_03153597733141271667e-13
PYAR_2481897821981441628e-13
SDRG_1731716173122691578e-13
PYIW_19601827562411421648e-13
PYIW_1552617302561531648e-13
H257_112641259792821811659e-13
PHYKE_1913732362801051649e-13
PPTG_04803375052681011641e-12
PYAP_18221944962261591621e-12
PHYCA_132255434681281071561e-12
PHYCA_120062539132121071611e-12
PYU1_G00152697803341291651e-12
SPRG_077971259813181231641e-12
PHYKE_2379539132851321632e-12
PPTG_0625673983181231632e-12
PYU1_G006403823732521061612e-12
PHYKE_902473982991351632e-12
SPRG_078251259983371461632e-12
H257_112651431862821811622e-12
PPTG_1422144782751321622e-12
PHYRA_8063173983201351632e-12
PYVX_2250897752981281622e-12
PYIR_23585845342401201602e-12
PPTG_03138188562941281622e-12
PHYCA_15125371743341201623e-12
PHYCA_12331697763161221623e-12
PYIW_242881643022011461583e-12
PPTG_0315697874451221633e-12
PHYSO_525076188573661281623e-12
PHYCA_19612188566101281634e-12
HYAP_1192397766061231634e-12
PHYKE_6002526711971191574e-12
PYIW_242891643031961191574e-12
SPRG_0782697753711491614e-12
SDRG_009721259983331461605e-12
PHYSO_255056463492691231595e-12
PPTG_06253371743031351596e-12
PHYRA_84732161732651271586e-12
PHYCA_18729375053911011606e-12
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_537323

Length=200
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_537323                                                          379        5e-135
PPTG_17123                                                            354        2e-125
PHYRA_81105                                                           335        9e-118
PITG_18452                                                            352        3e-116
PHYSO_353401                                                          274        2e-94 
HYAP_07096                                                            275        2e-93 
PYVX_18173                                                            273        4e-89 
PYU1_G001739                                                          208        8e-67 
PHYKE_8390                                                            196        7e-64 
PYU1_G001738                                                          192        2e-61 
PYIW_18788                                                            179        1e-55 
PYU1_G001740                                                          176        6e-55 
PYIR_25089                                                            175        6e-54 
PPTG_10635                                                            172        1e-53 
PYU1_G001742                                                          170        1e-52 
PYU1_G001744                                                          170        1e-52 
PHYRA_85631                                                           170        3e-52 
PYU1_G001741                                                          168        6e-52 
PHYRA_84190                                                           167        1e-51 
PHYSO_536424                                                          167        1e-51 
PHYSO_507031                                                          167        1e-51 
PHYCA_14369                                                           168        2e-51 
PHYSO_341599                                                          166        2e-51 
PPTG_10636                                                            167        5e-51 
PPTG_10634                                                            165        9e-51 
PHYCA_102624                                                          163        4e-50 
PHYCA_102852                                                          162        9e-50 
PPTG_10048                                                            160        3e-49 
PHYCA_102550                                                          163        3e-49 
PHYSO_477820                                                          160        6e-49 
PHYKE_8388                                                            159        1e-48 
PHALS_00498                                                           158        4e-48 
PHYRA_82864                                                           157        8e-48 
PHYRA_81107                                                           157        2e-47 
PYIR_26626                                                            156        3e-47 
PHYKE_8389                                                            156        3e-47 
PPTG_10643                                                            157        5e-47 
PPTG_15264                                                            155        8e-47 
PPTG_17366                                                            155        8e-47 
PPTG_17121                                                            155        9e-47 
PHYCA_129425                                                          154        2e-46 
PHYCA_511409                                                          153        5e-46 
PHYRA_81106                                                           152        6e-46 
PHYKE_7718                                                            152        2e-45 
PHYSO_284086                                                          151        2e-45 
PYIW_18791                                                            151        3e-45 
PHYKE_3446                                                            150        3e-45 
PPTG_17122                                                            148        5e-44 
PHALS_03284                                                           147        1e-43 
PYAP_22273                                                            144        7e-42 
PYVX_18174                                                            141        2e-41 
PYIR_26546                                                            142        3e-41 
PYAR_24096                                                            141        3e-41 
PYVX_18176                                                            139        1e-40 
PITG_18450                                                            137        8e-40 
PYAP_22279                                                            135        1e-38 
PHALS_06480                                                           127        1e-36 
PHYCA_510817                                                          127        3e-36 
PYAP_22278                                                            130        4e-36 
PPTG_14254                                                            125        2e-35 
PPTG_08820                                                            127        3e-35 
PHYSO_499978                                                          124        3e-35 
PHYSO_501575                                                          124        3e-35 
PPTG_14255                                                            126        6e-35 
PHYSO_343376                                                          120        2e-33 
PHYKE_9185                                                            122        2e-33 
PITG_13520                                                            119        3e-33 
PHYSO_417649                                                          119        3e-33 
PITG_10499                                                            122        9e-33 
PHYSO_262732                                                          117        3e-32 
PHYCA_536934                                                          123        1e-31 
PHYSO_254168                                                          113        1e-30 
PHYSO_340369                                                          110        2e-29 
PHYSO_341596                                                          109        1e-28 
PHYSO_527908                                                          106        4e-28 
PYAP_18131                                                            98.2       2e-24 
PHYCA_14368                                                           92.4       3e-22 
PHYSO_342364                                                          88.2       7e-21 
PHYRA_74651                                                           90.5       1e-20 
PHYRA_73607                                                           89.7       2e-20 
PYAP_24689                                                            86.7       9e-20 
PYAP_18711                                                            85.5       1e-19 
PHYCA_534473                                                          89.0       1e-19 
PPTG_04622                                                            85.9       3e-19 
PHYRA_73584                                                           85.9       3e-19 
H310_06362                                                            84.0       4e-19 
PYIR_16435                                                            85.5       5e-19 
PHYSO_484051                                                          83.6       2e-18 
PHYKE_2937                                                            84.3       3e-18 
PHYRA_73606                                                           83.6       4e-18 
PPTG_04647                                                            83.2       5e-18 
PYVX_14662                                                            83.6       8e-18 
PHYSO_533903                                                          79.3       2e-17 
PHYCA_531163                                                          80.9       3e-17 
PITG_04948                                                            79.3       3e-17 
PHYCA_130365                                                          79.7       4e-17 
PHYKE_10578                                                           78.6       8e-17 
PHYRA_86016                                                           77.8       2e-16 
PHYCA_534296                                                          78.6       2e-16 
PHYRA_77971                                                           77.4       2e-16 
PHYRA_85794                                                           77.4       2e-16 
PHYKE_6001                                                            78.2       2e-16 
PHYRA_86752                                                           78.2       2e-16 
PITG_05271                                                            78.2       2e-16 
PHYKE_2809                                                            78.2       2e-16 
PPTG_04618                                                            78.6       2e-16 
PHYRA_83499                                                           79.3       2e-16 
SDRG_17318                                                            77.0       2e-16 
PYU1_G014690                                                          77.8       3e-16 
PHYSO_483955                                                          77.8       3e-16 
H257_13550                                                            77.0       4e-16 
SPRG_19917                                                            76.6       4e-16 
PHYSO_340333                                                          77.0       4e-16 
PPTG_04619                                                            77.0       5e-16 
PYU1_G005323                                                          76.6       5e-16 
PITG_04949                                                            77.4       5e-16 
PYIR_24743                                                            77.4       6e-16 
PHYSO_340332                                                          76.6       8e-16 
PHYCA_98479                                                           76.3       9e-16 
SDRG_08137                                                            76.3       9e-16 
PYU1_G007476                                                          74.7       1e-15 
SDRG_08129                                                            75.1       1e-15 
SDRG_07565                                                            75.9       1e-15 
PYAP_19707                                                            75.1       1e-15 
PYIR_16375                                                            75.5       2e-15 
PHYCA_19611                                                           77.0       2e-15 
PHYSO_485524                                                          75.5       2e-15 
PYAP_18709                                                            74.7       2e-15 
PHYCA_12942                                                           75.9       2e-15 
PYIW_27477                                                            73.2       2e-15 
PHYCA_18657                                                           75.1       3e-15 
PPTG_07521                                                            75.1       3e-15 
PHYRA_78175                                                           75.5       3e-15 
PHYRA_78689                                                           75.1       3e-15 
PPTG_07509                                                            74.7       4e-15 
PYAR_18165                                                            74.3       4e-15 
PHALS_05392                                                           75.5       4e-15 
PPTG_07507                                                            74.7       4e-15 
PYIR_16444                                                            72.8       5e-15 
PHYSO_459106                                                          73.2       5e-15 
PHALS_03179                                                           75.1       6e-15 
PYIW_19151                                                            73.6       6e-15 
PHYSO_533747                                                          72.4       8e-15 
PYVX_16138                                                            75.1       8e-15 
PYAR_14256                                                            72.4       9e-15 
PHYSO_438103                                                          72.8       9e-15 
PHYKE_3913                                                            73.9       1e-14 
PYVX_20789                                                            73.6       1e-14 
PYU1_G007364                                                          73.9       1e-14 
PPTG_03139                                                            73.6       1e-14 
PHYKE_6077                                                            73.6       1e-14 
PYIR_16443                                                            73.2       1e-14 
PHYRA_84947                                                           72.8       1e-14 
PHYRA_78176                                                           73.2       1e-14 
PHYCA_97965                                                           73.2       2e-14 
PHYCA_12943                                                           72.8       2e-14 
PYVX_18175                                                            70.1       2e-14 
PHYRA_73583                                                           73.9       2e-14 
PHYCA_127270                                                          72.8       2e-14 
PHYSO_533682                                                          72.4       2e-14 
PHALS_03176                                                           71.2       2e-14 
SPRG_19916                                                            72.8       2e-14 
PYVX_18179                                                            69.3       3e-14 
PYAP_18138                                                            71.6       4e-14 
PHYSO_374518                                                          68.6       4e-14 
SDRG_08782                                                            72.8       4e-14 
PHYSO_524101                                                          72.0       4e-14 
PHYSO_246676                                                          69.7       5e-14 
PITG_11936                                                            72.0       6e-14 
SPRG_07795                                                            71.2       8e-14 
CCA17179                                                              69.3       8e-14 
PHYRA_78161                                                           71.6       9e-14 
PPTG_04620                                                            71.2       9e-14 
PYIW_21964                                                            70.5       9e-14 
CCI47381                                                              69.7       1e-13 
PHYRA_79140                                                           71.6       1e-13 
SPRG_07627                                                            71.6       1e-13 
SPRG_22161                                                            70.5       1e-13 
PYU1_G005324                                                          68.9       1e-13 
PYU1_G005326                                                          68.9       1e-13 
PYU1_G005328                                                          68.9       1e-13 
PHYKE_6079                                                            70.5       1e-13 
PYVX_21297                                                            70.1       1e-13 
PYVX_20783                                                            70.1       2e-13 
SDRG_15426                                                            70.9       2e-13 
PPTG_07520                                                            70.1       2e-13 
PHYRA_73582                                                           70.5       2e-13 
PYAR_14260                                                            68.9       2e-13 
PPTG_07516                                                            70.1       2e-13 
PHYKE_2454                                                            70.5       2e-13 
PITG_04947                                                            69.7       3e-13 
PHYSO_246481                                                          69.7       3e-13 
PHYRA_83494                                                           68.6       3e-13 
PYAP_19712                                                            69.3       3e-13 
PYAP_24691                                                            67.0       3e-13 
PYIR_17978                                                            68.9       3e-13 
PYU1_G005325                                                          68.2       3e-13 
PHYCA_112615                                                          67.8       4e-13 
PHYRA_78626                                                           70.1       4e-13 
PHYRA_78625                                                           69.7       4e-13 
PHYRA_83500                                                           69.7       4e-13 
PHYCA_19598                                                           69.7       4e-13 
PHYRA_78174                                                           68.9       4e-13 
PHYCA_69583                                                           68.2       5e-13 
PYVX_24563                                                            68.2       5e-13 
PHYKE_6078                                                            68.9       5e-13 
PITG_08892                                                            68.9       5e-13 
PYIW_18792                                                            65.5       6e-13 
PYU1_G001527                                                          68.6       6e-13 
PYU1_G001523                                                          68.6       6e-13 
PHYKE_5749                                                            68.6       6e-13 
PPTG_03153                                                            68.6       7e-13 
PYAR_24818                                                            67.0       8e-13 
SDRG_17317                                                            65.1       8e-13 
PYIW_19601                                                            67.8       8e-13 
PYIW_15526                                                            67.8       8e-13 
H257_11264                                                            68.2       9e-13 
PHYKE_1913                                                            67.8       9e-13 
PPTG_04803                                                            67.8       1e-12 
PYAP_18221                                                            67.0       1e-12 
PHYCA_132255                                                          64.7       1e-12 
PHYCA_120062                                                          66.6       1e-12 
PYU1_G001526                                                          68.2       1e-12 
SPRG_07797                                                            67.8       1e-12 
PHYKE_2379                                                            67.4       2e-12 
PPTG_06256                                                            67.4       2e-12 
PYU1_G006403                                                          66.6       2e-12 
PHYKE_9024                                                            67.4       2e-12 
SPRG_07825                                                            67.4       2e-12 
H257_11265                                                            67.0       2e-12 
PPTG_14221                                                            67.0       2e-12 
PHYRA_80631                                                           67.4       2e-12 
PYVX_22508                                                            67.0       2e-12 
PYIR_23585                                                            66.2       2e-12 
PPTG_03138                                                            67.0       2e-12 
PHYCA_15125                                                           67.0       3e-12 
PHYCA_123316                                                          67.0       3e-12 
PYIW_24288                                                            65.5       3e-12 
PPTG_03156                                                            67.4       3e-12 
PHYSO_525076                                                          67.0       3e-12 
PHYCA_19612                                                           67.4       4e-12 
HYAP_11923                                                            67.4       4e-12 
PHYKE_6002                                                            65.1       4e-12 
PYIW_24289                                                            65.1       4e-12 
SPRG_07826                                                            66.6       4e-12 
SDRG_00972                                                            66.2       5e-12 
PHYSO_255056                                                          65.9       5e-12 
PPTG_06253                                                            65.9       6e-12 
PHYRA_84732                                                           65.5       6e-12 
PHYCA_18729                                                           66.2       6e-12 
PYIR_22134                                                            65.9       6e-12 
PITG_11937                                                            65.9       6e-12 
PHALS_03177                                                           65.5       6e-12 
PYU1_G001524                                                          65.9       7e-12 
PHYCA_6388                                                            65.5       7e-12 
PYAP_18713                                                            63.9       7e-12 
PYAP_22257                                                            65.1       8e-12 
PYU1_G005868                                                          65.1       9e-12 
SPRG_04679                                                            64.7       9e-12 
PYAR_15391                                                            63.5       9e-12 
PPTG_18166                                                            65.9       9e-12 
PPTG_03144                                                            65.1       1e-11 
PHYKE_7717                                                            65.5       1e-11 
PHYSO_476077                                                          64.7       1e-11 
PHYSO_472009                                                          64.7       1e-11 
PHYSO_426658                                                          63.9       1e-11 
PYAR_21940                                                            64.3       1e-11 
SDRG_17448                                                            64.3       1e-11 
H310_05432                                                            64.7       2e-11 
PYIR_22634                                                            64.3       2e-11 
PHYCA_122958                                                          63.9       2e-11 
PHYKE_10295                                                           64.3       2e-11 
PYAR_16493                                                            63.9       2e-11 
PHYRA_86241                                                           62.8       2e-11 
PPTG_10186                                                            63.9       2e-11 
PHYRA_78172                                                           64.7       2e-11 
PYIR_24867                                                            64.3       3e-11 
PPTG_10073                                                            62.8       3e-11 
PHYRA_86751                                                           62.0       3e-11 
PYU1_G006404                                                          63.5       3e-11 
H310_05438                                                            64.3       3e-11 
PYU1_G006405                                                          63.9       3e-11 
PPTG_07511                                                            62.0       4e-11 
PYIR_14463                                                            63.9       4e-11 
PYAP_22462                                                            62.8       4e-11 
PYU1_G005866                                                          62.4       4e-11 
SDRG_16534                                                            63.9       4e-11 
PHYKE_2539                                                            63.2       4e-11 
PYIR_26867                                                            61.6       4e-11 
PYU1_G005869                                                          63.2       4e-11 
PHYRA_80750                                                           63.2       5e-11 
PITG_20631                                                            63.2       5e-11 
PITG_20312                                                            63.2       5e-11 
PPTG_03140                                                            63.5       5e-11 
PHYKE_6076                                                            63.2       5e-11 
PYAR_20617                                                            62.8       5e-11 
PYVX_19277                                                            63.5       5e-11 
PYAP_18226                                                            62.4       5e-11 
PYVX_22510                                                            63.9       5e-11 
PHYCA_15124                                                           62.8       8e-11 
PHALS_10635                                                           62.8       8e-11 
PYIR_20481                                                            62.0       1e-10 
PPTG_06249                                                            62.0       1e-10 
PYU1_G001514                                                          62.8       1e-10 
PHYSO_375794                                                          59.3       1e-10 
PYAR_21271                                                            61.2       1e-10 
HYAP_14170                                                            61.6       1e-10 
PYIW_18794                                                            61.6       1e-10 
PHYRA_73581                                                           62.0       2e-10 
PHYRA_78162                                                           62.4       2e-10 
PHYCA_10471                                                           62.0       2e-10 
PPTG_03160                                                            62.0       2e-10 
PHYKE_9023                                                            61.6       2e-10 
PITG_11944                                                            61.6       2e-10 
PHALS_04411                                                           61.2       2e-10 
PYU1_G005867                                                          60.5       2e-10 
PHYRA_78177                                                           61.6       2e-10 
PYAP_20077                                                            60.8       3e-10 
PYIR_24421                                                            60.5       3e-10 
SPRG_07799                                                            61.2       3e-10 
SDRG_00948                                                            61.2       3e-10 
H257_11258                                                            61.6       3e-10 
HYAP_01683                                                            61.2       3e-10 
PYU1_G005871                                                          60.8       3e-10 
PHYSO_318683                                                          61.2       3e-10 
PHYSO_262844                                                          60.8       4e-10 
PHYSO_337515                                                          60.8       4e-10 
PHYSO_488139                                                          60.5       4e-10 
PYU1_G005872                                                          60.5       4e-10 
PYAP_14265                                                            60.5       5e-10 
PHYSO_488921                                                          60.5       5e-10 
PHYRA_78169                                                           60.8       5e-10 
PHYCA_15126                                                           60.8       5e-10 
PHYSO_329293                                                          60.5       5e-10 
PHYRA_78167                                                           60.1       5e-10 
PYU1_G001475                                                          60.1       5e-10 
PYIR_15187                                                            59.3       5e-10 
PPTG_03143                                                            60.5       5e-10 
PYIR_20483                                                            60.1       6e-10 
PHYKE_7445                                                            60.5       6e-10 
PITG_08895                                                            59.3       6e-10 
PYAP_23672                                                            59.7       7e-10 
PYIW_18065                                                            59.7       8e-10 
PYU1_G005873                                                          58.9       9e-10 
PITG_08202                                                            58.2       1e-09 
PYIR_19612                                                            59.3       1e-09 
PYVX_21174                                                            56.2       1e-09 
PPTG_18176                                                            58.9       1e-09 
PHALS_01293                                                           59.7       1e-09 
PHYKE_3912                                                            58.9       1e-09 
PYIR_16437                                                            58.9       1e-09 
H257_11306                                                            59.3       1e-09 
PYIW_26655                                                            58.9       2e-09 
PYU1_G001516                                                          58.9       2e-09 
PHYCA_562062                                                          58.5       2e-09 
PHYKE_7446                                                            59.3       2e-09 
PHYRA_77293                                                           58.9       2e-09 
PHYCA_103479                                                          58.9       2e-09 
PHYCA_12944                                                           57.0       2e-09 
PHALS_05394                                                           58.5       2e-09 
PPTG_03145                                                            58.5       2e-09 
PPTG_04801                                                            58.2       2e-09 
PITG_11957                                                            58.5       2e-09 
PPTG_04617                                                            58.9       2e-09 
PYU1_G005985                                                          57.4       2e-09 
PITG_01966                                                            58.5       3e-09 
PHYRA_79881                                                           58.2       3e-09 
PYIW_25463                                                            57.4       3e-09 
PHYSO_374025                                                          58.2       3e-09 
PHYCA_14560                                                           58.2       3e-09 
PHYRA_93650                                                           57.8       3e-09 
PHYCA_552912                                                          58.5       3e-09 
PYAP_16994                                                            57.8       3e-09 
PPTG_01148                                                            58.2       3e-09 
PPTG_03161                                                            58.2       4e-09 
PYAR_17163                                                            54.7       5e-09 
PYU1_G001519                                                          57.4       5e-09 
PHYRA_86201                                                           57.4       6e-09 
PHYRA_78164                                                           57.0       7e-09 
PHYSO_324715                                                          57.0       8e-09 
PHYKE_6069                                                            57.0       8e-09 
PPTG_01147                                                            56.6       8e-09 
PHALS_02044                                                           56.2       9e-09 
PITG_21641                                                            57.0       9e-09 
SDRG_16535                                                            56.6       1e-08 
PPTG_01152                                                            56.2       1e-08 
PYIR_25999                                                            56.6       1e-08 
PHYCA_19608                                                           56.6       1e-08 
PYVX_22511                                                            56.6       1e-08 
PHYRA_77291                                                           56.2       1e-08 
H310_05433                                                            56.6       1e-08 
PYIR_23689                                                            55.8       1e-08 
PHYSO_256017                                                          54.7       1e-08 
PHYRA_78168                                                           56.2       1e-08 
PYAP_23673                                                            56.6       1e-08 
SPRG_07796                                                            56.2       2e-08 
PHYSO_255975                                                          55.1       2e-08 
PYAP_16347                                                            54.7       2e-08 
PYIW_16810                                                            55.1       2e-08 
PHYSO_525490                                                          55.8       2e-08 
PYAR_17307                                                            55.1       2e-08 
PHYRA_80632                                                           55.8       2e-08 
PHYSO_318693                                                          55.8       2e-08 
PHYKE_10296                                                           55.8       2e-08 
PHYRA_95184                                                           55.8       3e-08 
PPTG_06106                                                            55.1       3e-08 
PYAR_17166                                                            52.8       3e-08 
PHYCA_14559                                                           55.1       3e-08 
H257_11271                                                            55.5       3e-08 
PYIW_17867                                                            55.5       3e-08 
PPTG_20376                                                            53.9       4e-08 
PHYSO_454780                                                          53.9       4e-08 
PHYSO_525121                                                          54.3       4e-08 
PYIW_18790                                                            51.6       5e-08 
PYU1_G001528                                                          54.7       5e-08 
PHALS_02041                                                           54.3       5e-08 
PYIW_16208                                                            54.3       5e-08 
PHYSO_489485                                                          52.8       6e-08 
PYU1_G001518                                                          54.7       6e-08 
PYAP_23455                                                            54.3       7e-08 
PYVX_16673                                                            54.7       8e-08 
PHYCA_559281                                                          52.0       8e-08 
PYU1_G003057                                                          53.5       8e-08 
PYIW_24287                                                            53.9       9e-08 
PPTG_03147                                                            53.9       9e-08 
PYAR_22058                                                            53.1       9e-08 
PITG_11942                                                            53.5       1e-07 
PPTG_03148                                                            53.5       1e-07 
PHYRA_77290                                                           53.5       1e-07 
PYU1_G007250                                                          52.4       1e-07 
PHYRA_87941                                                           51.6       2e-07 
PHYSO_339832                                                          52.8       2e-07 
PHALS_02295                                                           53.1       2e-07 
PHALS_02296                                                           52.8       2e-07 
PHYCA_123476                                                          53.1       2e-07 
PPTG_13879                                                            53.1       2e-07 
PYIW_23030                                                            52.8       2e-07 
PYAR_25093                                                            52.0       2e-07 
PHYSO_257305                                                          52.0       2e-07 
PYIR_22133                                                            53.1       2e-07 
PYAP_16338                                                            52.4       3e-07 
PHYRA_86151                                                           51.2       3e-07 
PPTG_01153                                                            52.8       3e-07 
PYIR_25334                                                            52.4       3e-07 
PHYRA_75781                                                           52.0       3e-07 
PYIR_24935                                                            52.4       3e-07 
PYIR_22135                                                            52.4       3e-07 
PPTG_00483                                                            52.0       3e-07 
PITG_01969                                                            52.0       4e-07 
PYIR_20304                                                            51.6       4e-07 
PYVX_21643                                                            52.0       4e-07 
PHYCA_10470                                                           52.0       4e-07 
PHYRA_78165                                                           52.0       4e-07 
PHALS_08575                                                           52.0       5e-07 
PHALS_02037                                                           52.0       5e-07 
PHYCA_19599                                                           51.6       6e-07 
PYIW_14252                                                            51.2       6e-07 
PYU1_G005878                                                          48.1       6e-07 
PYU1_G001520                                                          51.6       6e-07 
PYAP_16337                                                            51.2       6e-07 
PYIW_25573                                                            51.2       7e-07 
PYAR_14261                                                            49.7       8e-07 
PHALS_05110                                                           50.4       8e-07 
PYAP_18584                                                            50.4       9e-07 
PHYCA_558591                                                          48.5       9e-07 
PYVX_23997                                                            50.1       1e-06 
PYU1_G001525                                                          50.8       1e-06 
HYAP_01682                                                            50.8       1e-06 
PHYKE_6066                                                            50.1       2e-06 
PYU1_G006672                                                          46.2       2e-06 
PHYCA_19606                                                           49.7       2e-06 
PPTG_22744                                                            48.5       2e-06 
PYU1_G007254                                                          48.9       2e-06 
PYIR_25571                                                            49.7       3e-06 
PYU1_G007242                                                          49.3       3e-06 
PITG_11943                                                            48.5       3e-06 
PYIW_14247                                                            49.3       3e-06 
PYAR_23090                                                            47.8       4e-06 
PITG_11951                                                            47.8       4e-06 
PYU1_G005862                                                          48.1       4e-06 
PYIR_20850                                                            48.5       4e-06 
PYU1_G003056                                                          48.1       5e-06 
PITG_11946                                                            48.1       5e-06 
PITG_04404                                                            48.1       6e-06 
PYAP_24338                                                            48.5       6e-06 
PYU1_G001517                                                          48.5       7e-06 
PYVX_21644                                                            47.8       8e-06 
PYIW_21963                                                            48.1       8e-06 
PHALS_01460                                                           48.1       1e-05 
PYIW_20715                                                            47.8       1e-05 
PYAR_15390                                                            46.6       1e-05 
PYAR_24113                                                            46.6       2e-05 
PYIR_25275                                                            46.2       2e-05 
PYIR_22136                                                            47.0       2e-05 
PHYKE_7443                                                            47.0       2e-05 
PPTG_09880                                                            46.6       2e-05 
PYIR_20482                                                            45.8       2e-05 
PYVX_22509                                                            47.0       2e-05 
PYAP_20161                                                            46.2       3e-05 
PYIW_15528                                                            46.6       3e-05 

>PHYCA_537323
Length=200

 Score = 379 bits (972),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  1    MRFlrgsalffpllllslvlCVTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYL  60
            MRFLRGSALFFPLLLLSLVLCVTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYL
Sbjct  1    MRFLRGSALFFPLLLLSLVLCVTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYL  60

Query  61   QEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNS  120
            QEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNS
Sbjct  61   QEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNS  120

Query  121  FQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVE  180
            FQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVE
Sbjct  121  FQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVE  180

Query  181  GIYSWQVYKNCVGLGTAATA  200
            GIYSWQVYKNCVGLGTAATA
Sbjct  181  GIYSWQVYKNCVGLGTAATA  200

>PPTG_17123
Length=201

 Score = 354 bits (909),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)

Query  22   VTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYT  81
            + GQRRLDAGLGEGQVV HPPPFF+VDGLDFQGMALAYLQEQGVNTSIEAQSWM+QHGYT
Sbjct  23   IAGQRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYT  82

Query  82   SLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV  141
            SLRAMLDDESLY+VTEEAIFECGLTSP+TETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV
Sbjct  83   SLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV  142

Query  142  SAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            S+GRNCHTEFP GQH+VDYSSCG++CTLSWYWLGIKY+EGIYSWQVYKNCVGL TA TA
Sbjct  143  SSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201

>PHYRA_81105
Length=201

 Score = 335 bits (858),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)

Query  22   VTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYT  81
            + GQRRLDAGLGEGQ+V HPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQ WM+QHGY 
Sbjct  23   IAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYA  82

Query  82   SLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV  141
            SLR+MLDDESLYQVTEEAIF+CGLTSPKTETQ IPTN+SFQ+SGYTLDGPCEVWLDDTK 
Sbjct  83   SLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKA  142

Query  142  SAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            +AGRNCHTEFP GQHQ+DYS+CG +C L WYWLGIKYVEG YSWQVYKNC+ LG  ATA
Sbjct  143  AAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201

>PITG_18452
Length=856

 Score = 352 bits (903),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)

Query  21   CVTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGY  80
            CV GQRRLDAGLGEGQ+V HPPPFF+VDGLDFQGMALAYLQEQG+NTSIEAQSWM+Q GY
Sbjct  677  CVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGY  736

Query  81   TSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTK  140
            +SLRAMLDDESLY+VTEEAIFECGLTSP+TETQPIPTNNSFQTSGYTLDGPCE+WLDDTK
Sbjct  737  SSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTK  796

Query  141  VSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            V++GRNCHTEFP GQHQVDYSSCG SC LSWYWLGIKYVEGIYSWQVYKNCVGL    TA
Sbjct  797  VASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856

>PHYSO_353401
Length=146

 Score = 274 bits (700),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)

Query  55   MALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQP  114
            MALAYLQEQGVNTSIEAQSWM++HGY SLRAMLDDESLY+VTEEA+F+CGLTSPKTETQP
Sbjct  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60

Query  115  IPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWL  174
            IP+N+SFQTSGYTLDGPCEVWLDDTKV+AGRNCHT+FP GQH++DYS+CG+SCTL WYWL
Sbjct  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120

Query  175  GIKYVEGIYSWQVYKNCVGLGTAATA  200
            GIKYVEG YSWQVYKNCV L   ATA
Sbjct  121  GIKYVEGAYSWQVYKNCVALSKTATA  146

>HYAP_07096
Length=251

 Score = 275 bits (703),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 152/181 (84%), Gaps = 2/181 (1%)

Query  21   CVTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGY  80
            CVTGQR L + L EGQVV +P P FIVD    QG ALAYLQEQG++TSIEAQSW ++HGY
Sbjct  72   CVTGQR-LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGY  130

Query  81   TSLRAMLDDESLYQVTEEAIFECGLTSPKTET-QPIPTNNSFQTSGYTLDGPCEVWLDDT  139
             SLRAMLDD+SLY V+++AIF+CG TS  +ET Q IPTN + ++SGYTLDGPCEVW DDT
Sbjct  131  VSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDT  190

Query  140  KVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAAT  199
            +V++GRNC TEFP GQHQVDYSSCG+SCTL WYWLGI+Y++GIYSWQVYKNC+GLG   T
Sbjct  191  QVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVT  250

Query  200  A  200
            A
Sbjct  251  A  251

>PYVX_18173
Length=500

 Score = 273 bits (697),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 147/175 (84%), Gaps = 0/175 (0%)

Query  24   GQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSL  83
             QRRLD+GLGEGQVV +PPPFF+VDG+D++G  +AYL++QGV+T+IEAQ+W+ + GY +L
Sbjct  26   AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85

Query  84   RAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSA  143
            RA++DD+ LY VTEE +F+CGLT P TETQPIPTN SF TSGYTLDGPCE+W+D+T   A
Sbjct  86   RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145

Query  144  GRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            GRNCHTEFP+G H +DYS CGESC +SW+WLGIKY    YSWQV+KNC+ L  +A
Sbjct  146  GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200

 Score = 160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 1/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P + V+G D +   LA+L+ Q  +T+ +   +++ +G+ SLRA +DD+SLY V
Sbjct  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
               A F CG T P    QPIP +   +++GYT DGPCEVWLDDT+V    NCH       
Sbjct  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            + +DYS+C  SCTL WYWLG++Y++ +YSWQVYK CV +
Sbjct  355  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393

>PYU1_G001739
Length=266

 Score = 208 bits (529),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (73%), Gaps = 0/164 (0%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q++  P PFF+VDG D Q   LA+L+ QGVNTS +   +M+Q GY +LRA++DDE LY+V
Sbjct  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
              +A+FECG T P  E+QPIPT  + +++GYT DGPCEVWLDD KV +G NCH +FP   
Sbjct  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAAT  199
              +DYSSC  SCTL WYWLG++Y++  YSWQ+YK CV L   A+
Sbjct  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNAS  188

>PHYKE_8390
Length=130

 Score = 196 bits (497),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)

Query  24   GQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSL  83
            GQRRL A LGEGQ+V  PPPFFIVDGLDFQGMALAYLQEQGVNTSIE Q WM  HGY SL
Sbjct  19   GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78

Query  84   RAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPC  132
            RAMLDDE+LY+VTEEA+F+CGLTSPKTETQ IPTN++FQTSGYT+DGPC
Sbjct  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PYU1_G001738
Length=226

 Score = 192 bits (489),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 111/157 (71%), Gaps = 0/157 (0%)

Query  38   VQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTE  97
            V +P PF++VDG + Q   +A+L+EQG+ TS +   +M+Q GY +LRAMLDD+ LY V  
Sbjct  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84

Query  98   EAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQ  157
            +A+ ECG T P  E+QPIP  N+F ++GY L+GPCEVWLDD KV +  NCHT++P     
Sbjct  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144

Query  158  VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            +DYSSC  SC L WYWLGI+ V   YSWQVYK CV L
Sbjct  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PYIW_18788
Length=244

 Score = 179 bits (453),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 111/165 (67%), Gaps = 3/165 (2%)

Query  38   VQHPPPFFIVDGLDFQGMA-LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVT  96
            V +P PFF++DG D++  A +A L++Q V TS +   +++Q GY SLRAMLDDE+LY V 
Sbjct  30   VTYPEPFFLLDG-DYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  88

Query  97   EEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQH  156
             ++IFECG T P  E+QPIPTN   + +GY  DGPCE+W+DD K+ +  NC  +FP    
Sbjct  89   IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148

Query  157  QVDYSSCGESCTLSWYWLGI-KYVEGIYSWQVYKNCVGLGTAATA  200
            ++DYSSC   CTL WY L + K   G YSW+VYKNCV L    TA
Sbjct  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSDEPTA  193

>PYU1_G001740
Length=206

 Score = 176 bits (445),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 2/160 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P F V   D +   LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  Y+V
Sbjct  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
               A FECG T+     QPIP N  F+T+GYT DGPCEVWLD+TKV +G NCH +FP   
Sbjct  89   NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKT  146

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLG  195
            H + Y++C  SCTL WYW+GI++++G +SWQVYK CV LG
Sbjct  147  HAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLG  186

>PYIR_25089
Length=262

 Score = 175 bits (443),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 109/171 (64%), Gaps = 0/171 (0%)

Query  22   VTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYT  81
            V+     D  +   Q V  P P F V     Q   LA+L+ QG  T+ +  ++ +  GY 
Sbjct  15   VSSAALYDTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYK  74

Query  82   SLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV  141
            +LRA +DD+S Y+V + A FECG T      QPIP+ ++ +++GYT DGPCEVWLD T+V
Sbjct  75   TLRAFMDDKSAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRV  134

Query  142  SAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV  192
              G NCH+EFP    ++DYSSC  SC L WYW+GI++++G YSWQVYKNCV
Sbjct  135  LKGTNCHSEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCV  185

>PPTG_10635
Length=199

 Score = 172 bits (437),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 107/165 (65%), Gaps = 1/165 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +  D +   LA+L+ QG  T  + +SW +++GY SLR  +D  + Y+V
Sbjct  12   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEV  70

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T  A F CG T PK   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            + VDYSSC  SCTL WYWLG+++++  YSWQVYK C+ L   A A
Sbjct  131  YTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGAGA  175

>PYU1_G001742
Length=213

 Score = 170 bits (431),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 105/160 (66%), Gaps = 1/160 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q V  P P F V     Q   LA+L+ QG  T+++  ++ +  GY +LRA +DD   Y+V
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKV  88

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
               A F+CG T    + QPIP   + +++GYT DGPCEVWLD T+V  G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPAG-TIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTT  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLG  195
             ++DYSSC  SCTL WYW+GI++++G YSWQVYKNCV +G
Sbjct  148  FKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG  187

>PYU1_G001744
Length=213

 Score = 170 bits (430),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 105/160 (66%), Gaps = 1/160 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q V  P P F V     Q   LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  Y+V
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKV  88

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
               A F+CG T    + QPIP   + +++GYT DGPCEVWLD+T V  G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTT  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLG  195
            H++ Y+SC  SCTL WYW+GI++++G YSWQVYKNCV +G
Sbjct  148  HKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG  187

>PHYRA_85631
Length=228

 Score = 170 bits (430),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 104/159 (65%), Gaps = 1/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D  D +   LA+L+ +G  T  +  SW +++GY SLR  +D+ + Y V
Sbjct  29   QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
             + A F CG T PK   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            + VDYSSC  +CTL WYWLGI++++  YSWQVYK C+ L
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPL  186

>PYU1_G001741
Length=199

 Score = 168 bits (425),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 103/162 (64%), Gaps = 1/162 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q V  P P F V     Q   LA+L+ QG  T+ +  ++ +  GY +LRA +DD+  Y V
Sbjct  28   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
               A FECG T      Q IP   + +++GYT DGPCEVWLD T+V  G NCHTEF    
Sbjct  88   ASGADFECGWTKLDGTRQSIPAG-TIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTT  146

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTA  197
            H +DYSSC  SCTL WYW+GI++++G YSWQVYKNCV +G++
Sbjct  147  HTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGSS  188

>PHYRA_84190
Length=206

 Score = 167 bits (424),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 109/169 (64%), Gaps = 5/169 (3%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  D  D +   LA+L+ +G  T  +  +W  ++GY SLR  +D+ + Y V
Sbjct  12   QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSV  70

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T  A F CG T PK   QPIP +N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  71   TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  130

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV----GLGTAATA  200
            + VDYSSC  +CTL WYW+G+++++  YSWQVYK C+    G GT+ +A
Sbjct  131  YTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGSGTSESA  179

>PHYSO_536424
Length=197

 Score = 167 bits (423),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 108/175 (62%), Gaps = 1/175 (1%)

Query  26   RRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRA  85
            RR    +   Q+V  P P +  +  + +   LA+L+ +G  T  +  +W +++GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  86   MLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGR  145
             +D  + Y VT  A F CG T PK   QPIP  N  +++GYT DGPCEVWLDDT V  G 
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  146  NCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            NCH +FP   + VDYSSC  +CTL WYWLG+++++  YSWQVYK C+ L + + A
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMA  187

>PHYSO_507031
Length=197

 Score = 167 bits (423),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 108/175 (62%), Gaps = 1/175 (1%)

Query  26   RRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRA  85
            RR    +   Q+V  P P +  +  + +   LA+L+ +G  T  +  +W +++GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  86   MLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGR  145
             +D  + Y VT  A F CG T PK   QPIP  N  +++GYT DGPCEVWLDDT V  G 
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  146  NCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            NCH +FP   + VDYSSC  +CTL WYWLG+++++  YSWQVYK C+ L + + A
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMA  187

>PHYCA_14369
Length=248

 Score = 168 bits (426),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 104/165 (63%), Gaps = 1/165 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +  D +   LA+L+ QG  T  +  +W  ++GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T  A F CG T PK   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            + VDYSSC  +CTL WYWLG+++++  YSWQVYK C+ L  +  A
Sbjct  148  YTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSGGA  192

>PHYSO_341599
Length=185

 Score = 166 bits (420),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 105/165 (64%), Gaps = 1/165 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +  + +   LA+L+ QG  T  +  +W +++GY SLR  +D  + Y V
Sbjct  12   QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDV  70

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T  A F CG T PK   QPIP  N  +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            + VDYSSC  +CTL WYWLG+++++  YSWQVYK C+ L + + A
Sbjct  131  YTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMA  175

>PPTG_10636
Length=246

 Score = 167 bits (423),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 105/165 (64%), Gaps = 1/165 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +  D +   LA+L+ QG  T  +  SW  ++ Y SLR  +D+ + Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T  A F CG T PK   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            + VDYSSC  +CTL WYWLGI++++  YSWQVYK C+ L  +  A
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGEA  192

>PPTG_10634
Length=208

 Score = 165 bits (418),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 1/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +  + +   LA+L+ +G  T  +  +W +++GY SLR  LD+   Y V
Sbjct  29   QIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK-YPV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T+ A F+CG T PK   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   TDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            + VDYSSC  +CTL WYWLG+++++  YSWQVYK C+ L
Sbjct  148  YTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PHYCA_102624
Length=195

 Score = 163 bits (413),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 100/159 (63%), Gaps = 1/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D  D Q   L +L+  G  T  +  +W +++GY SLR  +D+   Y V
Sbjct  29   QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAK-YPV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            +E A F+CG T P    QPIP  N+ +++GYT DGPCEVW+DDT V  G NCH +FP   
Sbjct  88   SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKD  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            + +DYS C   CTL WYWLG+++++  YSWQVYK C+ L
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPL  186

>PHYCA_102852
Length=195

 Score = 162 bits (410),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 103/159 (65%), Gaps = 1/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +  D +   LA+L+ +G  T  +  +W  ++GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            TE A F+CG T P    QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKG  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            + +DYSSC  +CTL W+WLG+++++  YSWQVYK C+ L
Sbjct  148  YTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPL  186

>PPTG_10048
Length=190

 Score = 160 bits (406),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 104/164 (63%), Gaps = 1/164 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV HP P +I D  D Q   LA+L+ QG  T  + +SW  Q+GY +LR  ++  + Y V
Sbjct  26   QVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFME-HAKYTV  84

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            TE A F CG T+PK   QPIP     +++GYT +GPCE+W+ DT+V    NCH   P  +
Sbjct  85   TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKE  144

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAAT  199
            + +DYS C  +C L WYWLG+++++  YSWQVYK C+ L T +T
Sbjct  145  YPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNST  188

>PHYCA_102550
Length=268

 Score = 163 bits (413),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 101/165 (61%), Gaps = 1/165 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D  D Q   LA+L+ QG  T  +  +W  ++GY SLR  +D  + Y V
Sbjct  29   QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
               A F+CG T P    QPIP  N+ +++GYT DGPCEVW+DDT V  G NCH +FP   
Sbjct  88   RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKG  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            + +DYS C   CTL WYWLG+++++  YSWQVYK C+ L  +  A
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSGGA  192

>PHYSO_477820
Length=202

 Score = 160 bits (405),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 102/166 (61%), Gaps = 1/166 (1%)

Query  33   GEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESL  92
            G  QVV  P P +  D    +   LA+L++QG  T  +  +W   +GY SLRA  D  S 
Sbjct  23   GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS-  81

Query  93   YQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFP  152
            Y V + A F CG T+   E QPIP +N+ +++GYT DGPCEVWLDDT V    NCH    
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  153  QGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
               + +DYSSC  +CTL W+WLG++Y++  YSWQ+YK CV L T+A
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSA  187

>PHYKE_8388
Length=205

 Score = 159 bits (403),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 101/163 (62%), Gaps = 1/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D    +   LA+L++QG +T  +  +W   +GY SLRA  DD S Y V
Sbjct  29   QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS-YTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            ++ A F CG T      QPIP +N+ +++GYT DGPCEVWLDDT V    NCH       
Sbjct  88   SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKD  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  +CTL W+W+G++Y++  YSWQVYK CV L  +A
Sbjct  148  YTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASA  190

>PHALS_00498
Length=199

 Score = 158 bits (400),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 108/171 (63%), Gaps = 1/171 (1%)

Query  28   LDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAML  87
            L   +   Q+V  P P +  +  D +   LA+L+ Q   T+ +AQ++ +Q+ + +LR  +
Sbjct  21   LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  80

Query  88   DDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNC  147
            D+   Y V + A   CG T P    QPIP NN+ +++GYT DGPCEVWL++T+V +  NC
Sbjct  81   DNAK-YTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNC  139

Query  148  HTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            H +FP   + +DYSSC ++C L WYWLG+++++  YSWQVYK C+ L  +A
Sbjct  140  HEKFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSA  190

>PHYRA_82864
Length=193

 Score = 157 bits (397),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 2/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D  D +   LA+L+ QG  T  +  +W   +GY +LR  +D  + Y V
Sbjct  29   QVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMD-RAKYTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            TE A + CG T P    QPIP  N  +++GYT DGPCEVWLD+T+V  G NCH +FP   
Sbjct  88   TEGADYFCGWTDPNGTPQPIPAGN-MRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKD  146

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            + +DYSSC  +CTL WYW+G+++++  YSWQVYK C+ L
Sbjct  147  YPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISL  185

>PHYRA_81107
Length=202

 Score = 157 bits (396),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 101/163 (62%), Gaps = 1/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D    +   LA+L++QG +T  +  +W E++GY SLRA  DD + Y V
Sbjct  26   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTV  84

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            ++ A F CG T    + Q IP  N+ +++GYT DGPCEVWLDDT V    NCH       
Sbjct  85   SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKD  144

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  +CTL W+W+G++Y+   YSWQVYK CV L  +A
Sbjct  145  YTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASA  187

>PYIR_26626
Length=212

 Score = 156 bits (395),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 109/176 (62%), Gaps = 2/176 (1%)

Query  22   VTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYT  81
            V+     D+ +   Q V  P P F     +     LA+L+ QG  T+ +   +++  GY 
Sbjct  15   VSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYK  74

Query  82   SLRAMLDDESLYQVTEE-AIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTK  140
            +LRA +DD+  Y+V    A FECG T+   + QPIP   + +++GYT DGPCEVWLD+TK
Sbjct  75   TLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTK  133

Query  141  VSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGT  196
            V +G NC+ +FP   H + Y+SC  SCTL WYW+G+++++  +SWQVYK CV +G+
Sbjct  134  VMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189

>PHYKE_8389
Length=204

 Score = 156 bits (394),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 99/163 (61%), Gaps = 1/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D  D +   LA+L+ QG  T  +  +W   +GY +LRA +D    Y V
Sbjct  28   QVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTV  86

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T+ A + CG T+     Q IP+ N+ +++GYT DGPCEVWLD T+V    NCH       
Sbjct  87   TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  146

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  +CTL WYWLG+++++  YSWQVYK CV L  +A
Sbjct  147  YTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189

>PPTG_10643
Length=250

 Score = 157 bits (397),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 1/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +  D +   LA+L+ QG     +  +W +++GY SLR  +D  + Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMD-RAKYEV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T  A F CG T+PK   QPIP     +++GYT DGPCEV+LDDT V  G NCH +FP   
Sbjct  88   TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKD  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
              +DYSSC  +CTL WYWLGI++++  YSWQVYK C+ L
Sbjct  148  CPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

>PPTG_15264
Length=194

 Score = 155 bits (391),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 99/163 (61%), Gaps = 3/163 (2%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  D  D +   LA+L+ QG  T  +  +W   +GY +LR  +D  + Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            TE A + CG T PK   QPIP   + +++GYT DGPCEVWLDD +V  G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  156  HQVDYSSCGES--CTLSWYWLGIKYVEGIYSWQVYKNCVGLGT  196
            + +DYSSC +   C L WYWLG+++++  YSWQVYK C+ L T
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTT  187

>PPTG_17366
Length=194

 Score = 155 bits (391),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 99/163 (61%), Gaps = 3/163 (2%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  D  D +   LA+L+ QG  T  +  +W   +GY +LR  +D  + Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            TE A + CG T PK   QPIP   + +++GYT DGPCEVWLDD +V  G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  156  HQVDYSSCGES--CTLSWYWLGIKYVEGIYSWQVYKNCVGLGT  196
            + +DYSSC +   C L WYWLG+++++  YSWQVYK C+ L T
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTT  187

>PPTG_17121
Length=202

 Score = 155 bits (391),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 101/163 (62%), Gaps = 1/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV    P +  D  D +   LA+L++QG  T  +  +W + +GY SLRA  D  S Y V
Sbjct  26   QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS-YTV  84

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            ++ A   CG T+   + QPIP  N+ +++GYT DGPCEVWLDDT V    NCH       
Sbjct  85   SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKY  144

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  +CTL W+WLG++Y++  YSWQ+YK CV L T+A
Sbjct  145  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSA  187

>PHYCA_129425
Length=204

 Score = 154 bits (389),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 100/163 (61%), Gaps = 2/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D  D +   LA+L+ QG  T  +   W   +GY +LRA +D    Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-YTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T+ A + CG T+ K   QPIP + + +++GYT DGPCEVWLD T+V    NCH  FP   
Sbjct  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  SC L WYWLG ++++  +SWQVYK C+ L ++A
Sbjct  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189

>PHYCA_511409
Length=204

 Score = 153 bits (386),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 101/163 (62%), Gaps = 1/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D    +   LA+L++QG  T  +  +W + +GY SLRA  +D + Y V
Sbjct  28   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTV  86

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            ++ A F CG T+   + Q IP  N+ +++GYT DGPCEVWLDDT V    NCH       
Sbjct  87   SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKD  146

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  +CTL W+WLG++Y++  YSWQ+YK CV L  +A
Sbjct  147  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASA  189

>PHYRA_81106
Length=202

 Score = 152 bits (385),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 97/163 (60%), Gaps = 1/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D  D +   LA+L+ QG  T  +  +W   +GY +LRA +D    Y V
Sbjct  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
             + A + CG T+     Q IP  N+ +++GYT DGPCEVWLD T+V    NCH       
Sbjct  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  +CTL WYW+G++Y++  YSWQVYK CV L  +A
Sbjct  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190

>PHYKE_7718
Length=220

 Score = 152 bits (384),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 97/159 (61%), Gaps = 1/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  D  D +   LA+L+ +G     +  +W  ++GY SLR  +D+ + Y V
Sbjct  33   QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYSV  91

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T  A   CG T P    QPIP  N+ +++GYT DGPCEVW+DDT      NCH  FP   
Sbjct  92   TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKD  151

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            + +DYS+C  +CTL WYWLG+++++  YSWQVYK C+ L
Sbjct  152  YTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPL  190

>PHYSO_284086
Length=204

 Score = 151 bits (382),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 99/163 (61%), Gaps = 2/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D    +   LA+L+ QG  T  +  +W    GY +LRA +D  S Y V
Sbjct  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
             + A + CG T  K   QPIP + + +++GYT DGPCEVWLD T+V    NCH  F    
Sbjct  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  SCTL WYWLG+++++  YSWQVYK CV L T+A
Sbjct  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSA  189

>PYIW_18791
Length=194

 Score = 151 bits (381),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 2/165 (1%)

Query  31   GLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDE  90
            G    Q V+ P P + V         L++L++ GV TS     +M+  GY++LRA++DD 
Sbjct  18   GADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDS  77

Query  91   SLYQVTEEA-IFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHT  149
             LY+    A  F CG T P   +Q IP +++ +T+GYT  GPCEVW+DD +V AG NCH 
Sbjct  78   KLYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHE  137

Query  150  EFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            +      +VDYS+C   CT+ WYWLG++Y++  +SWQVYKNC+ L
Sbjct  138  QV-SNTTKVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIAL  181

>PHYKE_3446
Length=199

 Score = 150 bits (380),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 99/159 (62%), Gaps = 1/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  D  + +   LA+L+ QG  T  +A +W   +GY +LRA +D  + YQV
Sbjct  29   QIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMD-MAKYQV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            TE A + CG T P    QPIP   + +++GYT DGPCEVW+D+T+V    NCH       
Sbjct  88   TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKD  147

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            + +DYS+C  +C L WYWLG+++++  YSWQVYK C+ L
Sbjct  148  YTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPL  186

>PPTG_17122
Length=204

 Score = 148 bits (373),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 97/163 (60%), Gaps = 2/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D  D +   LA+L+ QG  T  +   W   +GY +LR  +D  + Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T+ A + CG T+     QPIP + + +++GYT DGPCEVWLD  +V    NCH       
Sbjct  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  +CTL WYWLG++Y++  YSWQ+YK C+ L  +A
Sbjct  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASA  189

>PHALS_03284
Length=188

 Score = 147 bits (370),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 98/159 (62%), Gaps = 1/159 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q++  P P +  +  D +   LA+L+ Q   TS +   +++++ Y SLR  L   + Y V
Sbjct  15   QIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLK-RANYTV  73

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            TE A  +CG T P    QPIP  N+ + +GYT DG CE+WLDDTKV +G NCH +FP   
Sbjct  74   TEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKD  133

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
              VDYSSC ++C + WYWL ++ ++  YSWQVYK C+ L
Sbjct  134  CPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPL  172

>PYAP_22273
Length=268

 Score = 144 bits (364),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 87/140 (62%), Gaps = 2/140 (1%)

Query  58   AYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPT  117
            A L+ QG  T+ +  +++  +GY +LR  +D    Y+  + A  ECG T P    QPIPT
Sbjct  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108

Query  118  NNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ--HQVDYSSCGESCTLSWYWLG  175
            N  F+TSGYT +GPCE+W+DD  V +G+NCH +  +     ++DYS+C   C L WYWLG
Sbjct  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168

Query  176  IKYVEGIYSWQVYKNCVGLG  195
            I+ +   YSWQ+YK C+ L 
Sbjct  169  IRPMGKKYSWQIYKACIPLA  188

>PYVX_18174
Length=204

 Score = 141 bits (356),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 95/164 (58%), Gaps = 4/164 (2%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q V  P P +     D     LA+L++QG  T  +  +W   +GY +LRA +D  S Y V
Sbjct  29   QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS-YTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T+ A   CG T      QPIP N  F+++GYT DGPCE+WLD T+V A  NCH       
Sbjct  88   TDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKD  145

Query  156  HQVDYSSCGE-SCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
              +DYS     +CTL WYW+G++Y+   YSWQVYKNCV L T+A
Sbjct  146  TAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSA  189

>PYIR_26546
Length=239

 Score = 142 bits (357),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 108/179 (60%), Gaps = 7/179 (4%)

Query  28   LDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQ-GVNTSIEAQSWMEQHGYTSLRAM  86
            LD+     Q+V  P P + ++G   Q   +AYL+ Q G + + +   ++   G+ ++R  
Sbjct  21   LDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREF  80

Query  87   LDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRN  146
            +D++ LY+   +A F+CG T    E QPIP N+  +T+GYT +GPCE+WLDD KV  G+N
Sbjct  81   MDNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKN  140

Query  147  CHTEFPQGQH--QVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL----GTAAT  199
            CH +   G +  ++D+SSC   CT+ WYW+GI+      SWQ+YK C+ L    GTA+T
Sbjct  141  CHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPLIGHGGTAST  199

>PYAR_24096
Length=227

 Score = 141 bits (356),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 88/139 (63%), Gaps = 2/139 (1%)

Query  58   AYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPT  117
            A L++QG  T+ +  ++++ + Y +LR  +D    Y+    A FECG T PK   QPIP 
Sbjct  50   AKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPK  109

Query  118  NNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ--HQVDYSSCGESCTLSWYWLG  175
            + +F+TSGYT +GPCE+W+DD +V  G NCH +  +     ++DYS+C  +C L WYWLG
Sbjct  110  DGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLG  169

Query  176  IKYVEGIYSWQVYKNCVGL  194
            I+     YSWQ+YK C+ L
Sbjct  170  IRPTGKSYSWQIYKACIPL  188

>PYVX_18176
Length=201

 Score = 139 bits (350),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 96/163 (59%), Gaps = 2/163 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q V  P P +  D  D     LA+L++QG +T  +  +W   +GY SLRA +D  S Y V
Sbjct  26   QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-YTV  84

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T+ A   CG T+     Q +P +   +++GYT  GPCEVWLDDT V    NCH       
Sbjct  85   TDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKT  143

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  +CTL W+W+G++Y+   YSWQVYKNCV L  +A
Sbjct  144  YDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASA  186

>PITG_18450
Length=203

 Score = 137 bits (345),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 94/163 (58%), Gaps = 5/163 (3%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            QVV  P P +  D  D +   L +L+ QG  T  +   W   +GY +LR  ++    Y V
Sbjct  29   QVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
             + A + CG T+     QP P + + +++GYT DGPCEVWLD T+V    NCH       
Sbjct  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            + +DYSSC  +CTL WYWLG+++++  YSWQ+YK C+ L  +A
Sbjct  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186

>PYAP_22279
Length=223

 Score = 135 bits (339),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 101/171 (59%), Gaps = 7/171 (4%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q +  P P    D  +     LA+L+ QGV  + +   ++ Q G  +LR  +D+++ Y+V
Sbjct  23   QRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKV  81

Query  96   TEE-AIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV--SAGRNCHTEFP  152
                A FECG T P    QPIP+N   +++GYT DGPCEVWLD+T+V  S   +CH +  
Sbjct  82   EAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDIG  141

Query  153  QG--QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL-GTAATA  200
            QG   +++D+S C  +C L WYWL  + +   +SWQVYK CV L G+AA +
Sbjct  142  QGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSAARS  192

>PHALS_06480
Length=159

 Score = 127 bits (319),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)

Query  21  CVTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGY  80
           C+ G RRL+AGLGEGQVV +P PF++VDGLDFQGMALAYL+EQG+NTSIE QSWM+ H Y
Sbjct  20  CIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAY  79

Query  81  TSLRAMLDDESLYQ  94
            SLRAMLDD+ LY+
Sbjct  80  NSLRAMLDDDMLYK  93

>PHYCA_510817
Length=188

 Score = 127 bits (320),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 89/138 (64%), Gaps = 1/138 (1%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            L++L+++G  T      +   +GY SLR  ++ ++ Y+V++ A   CG + PK   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSDPKGIPQQIP  108

Query  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGI  176
            ++ + +TSGYT DGPCE+W+ D    +  NCH   P+   ++DYS CG+SC L WYWLG+
Sbjct  109  SDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  177  KYVEGIYSWQVYKNCVGL  194
            + ++G YSWQVYK C+ L
Sbjct  169  RKLKGKYSWQVYKECIPL  186

>PYAP_22278
Length=289

 Score = 130 bits (327),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 98/171 (57%), Gaps = 6/171 (4%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q V  P P F  +  +     LA+L+ QGV    +   ++   G  +LR  +D+++ Y++
Sbjct  26   QRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKI  85

Query  96   TEE-AIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV--SAGRNCHTEFP  152
                A FECG T+P    QPIP N   +++GYT DGPCEVWLD+T+V  S   NCH +  
Sbjct  86   EARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDVG  145

Query  153  QG--QHQVDYSSCGESCTLSWYWLGIKYVEG-IYSWQVYKNCVGLGTAATA  200
                 +++D+S C  +C L WYWLG + + G  +SWQ+YK CV L  + TA
Sbjct  146  NKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSGTA  196

>PPTG_14254
Length=188

 Score = 125 bits (315),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 87/138 (63%), Gaps = 1/138 (1%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            L++L+++G  T      +   +GY SLR  +D  + Y+VTE A   CG T PK   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTDPKGIPQKIP  108

Query  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGI  176
             + + +T+GYT DGPCE+++ +    +  NCH   P+   ++DYS CG+SC L WYWLG+
Sbjct  109  EDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  177  KYVEGIYSWQVYKNCVGL  194
            + ++G YSWQVYK C+ +
Sbjct  169  RKLKGKYSWQVYKECIPI  186

>PPTG_08820
Length=250

 Score = 127 bits (318),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 93/164 (57%), Gaps = 5/164 (3%)

Query  36   QVVQHPPPFFI--VDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLY  93
            Q++  P P +   ++  D +   LA+L+ QG     +   W  Q GY +LR  +D     
Sbjct  29   QLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYT  88

Query  94   -QVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFP  152
              VT  A   CGLT  K   +PIP +   +++GYT DGPC V+LDD  V    NCH + P
Sbjct  89   TSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLP  148

Query  153  QGQHQVDYSSCGES--CTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
               +++DYSSC +   CTL W+WLGI++V+  +SWQVYK CV L
Sbjct  149  GKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPL  192

>PHYSO_499978
Length=174

 Score = 124 bits (312),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 84/138 (61%), Gaps = 1/138 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +  + +   LA+L+ QG  T  + + W  ++GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T+ A F CG T PK   QPIP  ++ +++GYT DGPCEVW+D+T+V  G NCH +     
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  156  HQVDYSSCGESCTLSWYW  173
            + +DYS+C  +CTL WYW
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 124 bits (312),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 84/138 (61%), Gaps = 1/138 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +  + +   LA+L+ QG  T  + + W  ++GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T+ A F CG T PK   QPIP  ++ +++GYT DGPCEVW+D+T+V  G NCH +     
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  156  HQVDYSSCGESCTLSWYW  173
            + +DYS+C  +CTL WYW
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PPTG_14255
Length=268

 Score = 126 bits (317),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 87/138 (63%), Gaps = 1/138 (1%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            L++L+++G  T      +   +GY SLR  +D+ + Y VT+ A   CG T PK   Q IP
Sbjct  49   LSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQIP  107

Query  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGI  176
             + + +TSGYT DGPCE+++ DT   +  NCH        ++DYS+CG+SC L WYWLG+
Sbjct  108  EDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGV  167

Query  177  KYVEGIYSWQVYKNCVGL  194
            +Y++  YSWQVYK C+ L
Sbjct  168  RYLKKKYSWQVYKECIPL  185

>PHYSO_343376
Length=172

 Score = 120 bits (300),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 76/117 (65%), Gaps = 1/117 (1%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            LA+L+ QG  T  + ++W  ++GY +LR  +D    Y VT+ A F CG T PK   QPIP
Sbjct  48   LAFLENQGFATQQDFRAWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  106

Query  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYW  173
              ++ +++GYT DGPCEVW+D+T+V  G NCH +     + +DYS+C  +CTL WYW
Sbjct  107  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  163

>PHYKE_9185
Length=281

 Score = 122 bits (307),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 87/138 (63%), Gaps = 1/138 (1%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            L++L+++G+ T      +   + Y SLR  +D ++ Y+V++ A   CG T PK   Q IP
Sbjct  52   LSFLEKEGIKTQENFTQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTDPKGIPQQIP  110

Query  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGI  176
             + + +TSGYT DGPCE+++ D    +  NCH        ++DYS+CG+SC L WYWLG+
Sbjct  111  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGV  170

Query  177  KYVEGIYSWQVYKNCVGL  194
            + ++G YSWQ+YK C+ L
Sbjct  171  RKLKGSYSWQIYKECIPL  188

>PITG_13520
Length=171

 Score = 119 bits (299),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%), Gaps = 1/128 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +     D +   LA+L+ QG  T  + ++W +++GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDV  87

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T  A F CG T PK   QPIP   + +++GYT DGPCEVWLDD  V  G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKD  147

Query  156  HQVDYSSC  163
            + VDYSSC
Sbjct  148  YTVDYSSC  155

>PHYSO_417649
Length=185

 Score = 119 bits (299),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 85/138 (62%), Gaps = 1/138 (1%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            L++L+++G  T      +   +GY SLR  ++  + Y++T+ A   CG T PK   Q IP
Sbjct  48   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTDPKGIPQQIP  106

Query  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGI  176
             + + +TSGYT DGPCE+++ D    +  NCH        ++DYS CG+SC L WYWLG+
Sbjct  107  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  166

Query  177  KYVEGIYSWQVYKNCVGL  194
            + ++G +SWQVYK C+ L
Sbjct  167  RKLKGKFSWQVYKECIPL  184

>PITG_10499
Length=323

 Score = 122 bits (306),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 91/160 (57%), Gaps = 5/160 (3%)

Query  40   HPPPFFI--VDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDES-LYQVT  96
             P P +   ++  D +   LA+L+ QG     +   W  ++GY  LR  +D    +  VT
Sbjct  3    QPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVT  62

Query  97   EEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQH  156
              A   CGLT  K   +PIP + + +++GYT DGPC ++LDD  V    NCH   P   +
Sbjct  63   PGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTY  122

Query  157  QVDYSSCGES--CTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            ++D+SSC +   CTL W+WLGI++V+  +SWQVYK C+ L
Sbjct  123  KIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISL  162

>PHYSO_262732
Length=188

 Score = 117 bits (293),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 77/121 (64%), Gaps = 2/121 (2%)

Query  73   SWMEQHGY-TSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGP  131
            +++E  G+ T LR  +D+   Y VTE A   CG T PK   Q IP++ + +TSGYT DGP
Sbjct  50   AFLENQGFQTHLRDFMDNAK-YTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGP  108

Query  132  CEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNC  191
            CE+++ D    +  NCH        ++DYS CG+SCTL WYWLG++++   YSWQVYK C
Sbjct  109  CEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKEC  168

Query  192  V  192
            +
Sbjct  169  I  169

>PHYCA_536934
Length=983

 Score = 123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 1/138 (1%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            L++L+++G  T      +   +GY +LR  +D+   Y VT+ A   CG + P    Q IP
Sbjct  66   LSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDNAK-YAVTDGADQACGWSDPNGIPQQIP  124

Query  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGI  176
             + + +TSGYT DGPCE+W+ D    +  NCH        ++DYS CG+SC L WYWLG+
Sbjct  125  EDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  184

Query  177  KYVEGIYSWQVYKNCVGL  194
            +Y++  YSWQVYK C+ L
Sbjct  185  RYLKKKYSWQVYKECIPL  202

>PHYSO_254168
Length=170

 Score = 113 bits (282),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 87/153 (57%), Gaps = 18/153 (12%)

Query  47   VDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLT  106
            V+  D +   LA+L+ QG  T     +    +GY +LR  +D    Y VT+ A + CG T
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMD-RGKYTVTQGADYFCGWT  86

Query  107  SPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGES  166
            +PK   QPIP     +++GYT DGPCE+WLDD +V           +    +DYSSC + 
Sbjct  87   NPKGTPQPIP-----RSTGYTHDGPCEIWLDDVRVL----------ERSPTIDYSSCEKK  131

Query  167  --CTLSWYWLGIKYVEGIYSWQVYKNCVGLGTA  197
              CT+ WYWLG+++++  YSWQVYK C+ L  A
Sbjct  132  GGCTMHWYWLGVRFLKNSYSWQVYKECIPLTAA  164

>PHYSO_340369
Length=200

 Score = 110 bits (276),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 78/140 (56%), Gaps = 15/140 (11%)

Query  55   MALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQP  114
            M LAY ++QG NTS     W   +G+ +LR  +D+ +             +TSP    Q 
Sbjct  50   MPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNGNY-----------SVTSP----QQ  94

Query  115  IPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWL  174
            IP +N  +T GYT DGPCE+WLD+T   +  +C    P   + +DYS CG SC + WY L
Sbjct  95   IPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTL  154

Query  175  GIKYVEGIYSWQVYKNCVGL  194
            G+   + +YSW+VYK C+ L
Sbjct  155  GVAKPDRVYSWEVYKECIPL  174

>PHYSO_341596
Length=231

 Score = 109 bits (272),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 1/114 (1%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            LA+L+ QG  T  +  SW +++GY SLR  +D ++ Y VT  A F CG T PK   QPIP
Sbjct  42   LAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTVTSGADFSCGFTDPKGTPQPIP  100

Query  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLS  170
              ++ +++GYT DGPCEVWLDDTKV  G NCH +FP   +    S   +  T S
Sbjct  101  AGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPGKDYTTGGSGTSQQSTPS  154

>PHYSO_527908
Length=174

 Score = 106 bits (265),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 76/126 (60%), Gaps = 1/126 (1%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            LA+L+ QG  T      +M  +GY SLR  +D+ + Y VT+ A   CG T P    Q IP
Sbjct  49   LAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTDPNGIPQQIP  107

Query  117  TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGI  176
             + + +TSG+T D PCE+++ D    +  NCH        ++DYS+CG+SC L WYWLG+
Sbjct  108  EDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLGV  167

Query  177  KYVEGI  182
            ++++GI
Sbjct  168  RFIKGI  173

>PYAP_18131
Length=226

 Score = 98.2 bits (243),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 72/119 (61%), Gaps = 7/119 (6%)

Query  87   LDDESLYQVTEE-AIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGR  145
            +DD++ Y+V    A FECG T P    QPIP N   +++G+T DG   VW+D+T+V   +
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  146  --NCHTEFPQG--QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
              NCH    QG   +++D+S C   C + WYWLG++ +   +SWQVYK C+ +  + TA
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGTA  117

>PHYCA_14368
Length=219

 Score = 92.4 bits (228),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 75/167 (45%), Gaps = 46/167 (28%)

Query  28   LDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAML  87
            LD+     Q+V  P P +  +  D +   LA+L+ QG  T  +  SW  ++ Y SLR  +
Sbjct  21   LDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFM  80

Query  88   DDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNC  147
            D+ + Y VT+ A F CG T PK                                      
Sbjct  81   DN-AKYTVTDGADFSCGFTDPK--------------------------------------  101

Query  148  HTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                    + VDYSSC  +CTL WYWLGI++++  YSWQVYK C+ L
Sbjct  102  -------DYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  141

>PHYSO_342364
Length=194

 Score = 88.2 bits (217),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 15/126 (12%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN-NSFQTSGYTLDGPCEVWL  136
            H Y  LR +LD+ ++Y         CG T+P    QPIPTN  +  + G    GPCE+WL
Sbjct  73   HNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWL  126

Query  137  DDTKVSAGRNCHTEFPQG------QHQVDYSSCGES--CTLSWYWLGIKYVEGIYSWQVY  188
            DD KV A  +C++++         +  VDYS C     C + +YWLG + +     WQ Y
Sbjct  127  DDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTY  186

Query  189  KNCVGL  194
            KNC+ L
Sbjct  187  KNCIPL  192

>PHYRA_74651
Length=344

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 70/132 (53%), Gaps = 16/132 (12%)

Query  73   SWMEQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDG  130
            S  E +GY+ +R +LD D SLY        +CG T P  T   P  T ++  + G    G
Sbjct  71   SLKESNGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDATFSRGMVHAG  124

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGE-SCTLSWYWLGIKYVEGI  182
            PCE+WLDDTKV +  NC   +  G  +       VDYSSC    CTL +YWL  + ++  
Sbjct  125  PCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSS  184

Query  183  YSWQVYKNCVGL  194
              WQVYKNCV L
Sbjct  185  TVWQVYKNCVPL  196

>PHYRA_73607
Length=343

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query  73   SWMEQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDG  130
            S    +GY+ +R +LD D SLY        +CG T+P  T   P  T ++  + G    G
Sbjct  71   SLKSSNGYSDIRTLLDSDTSLYGA------DCGFTNPDATAKDPPTTGDATFSRGMVHVG  124

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGI  182
            PCE+WLDDTKV +  NC   +  G          VDYSSC  S C L +YWL  + V+  
Sbjct  125  PCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSS  184

Query  183  YSWQVYKNCVGL  194
              WQVYKNCV L
Sbjct  185  MVWQVYKNCVPL  196

>PYAP_24689
Length=252

 Score = 86.7 bits (213),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 70/134 (52%), Gaps = 13/134 (10%)

Query  65   VNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-T  123
            + T  +  +  ++HG  +LRA L+ +            CG T+P  + +PIP +   +  
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFG  108

Query  124  SGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGI  182
            S     GPCE+W D+T+V    +C+  F    Q ++DYS C   C L +YWLG++  +G 
Sbjct  109  SSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGG  166

Query  183  YSWQVYKNCVGLGT  196
              WQ YKNCV LG 
Sbjct  167  KRWQSYKNCVPLGN  180

>PYAP_18711
Length=210

 Score = 85.5 bits (210),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 70/127 (55%), Gaps = 13/127 (10%)

Query  76   EQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPCEV  134
            ++ G  +LRA L+ +           ECG T+P  + +PIP++   +  S     GPCEV
Sbjct  66   KKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEV  116

Query  135  WLDDTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVG  193
            W D+T V +  +C   F    Q ++DYS C  +C L +YWLG++  +G   WQ YKNCV 
Sbjct  117  WFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

Query  194  LGTAATA  200
            +G+A  +
Sbjct  175  IGSATKS  181

>PHYCA_534473
Length=1050

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query  73   SWMEQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDG  130
            S  E +GY+ +R +LD D  LY         CG T P  T   P  T ++  + G    G
Sbjct  843  SLKESNGYSDIRTLLDSDTDLYGA------NCGFTDPDVTAKDPPTTGDATFSRGMVHAG  896

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGI  182
            PCE+WLDDTKV +  +C T +  G  +       VDYSSC  S C L +YWL  + V+  
Sbjct  897  PCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSK  956

Query  183  YSWQVYKNCVGL  194
              WQVYK+CV L
Sbjct  957  IVWQVYKDCVPL  968

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query  76   EQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPKTETQ-PIPTNNSFQTSGYTLDGPCE  133
            + +    +R M+D D  LY        +CG T PK + + P  T ++  + G    GPCE
Sbjct  541  KSNNVKDIRTMIDADPKLYGE------DCGNTDPKAKPKDPPSTGDATFSRGIVHAGPCE  594

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSW  185
            +WLDD  V    +C + +  G          VDYSSC    C   +YWL ++  +    W
Sbjct  595  IWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLW  654

Query  186  QVYKNCVGL  194
            QVYKNC+ L
Sbjct  655  QVYKNCIPL  663

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVW  135
            ++ Y  +R ++D   +Y        +CG T PK      PT+ +   S G    GPCE+W
Sbjct  73   KNNYKDVRTLMDGNPVYGE------DCGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIW  126

Query  136  LDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGE-SCTLSWYWLGIKYVEG  181
            LDD  V    +C   +  G  +       VDYSSC    C L +YWL ++ ++G
Sbjct  127  LDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKG  180

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (50%), Gaps = 16/109 (15%)

Query  83   LRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  140
            +R +LD D  LY        +CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  285  IRTLLDSDTKLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  338

Query  141  VSAGRNCHTEFPQGQHQ-------VDYSSCGE-SCTLSWYWLGIKYVEG  181
            V +  +C + +  G  +       VDYSSC    C   +YWL ++ ++G
Sbjct  339  VLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDG  387

>PPTG_04622
Length=273

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 67/132 (51%), Gaps = 16/132 (12%)

Query  73   SWMEQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDG  130
            S  E +GY+ +RA+LD D  LY         CG T P  T   P  T ++  + G    G
Sbjct  71   SLKESNGYSDIRALLDSDTDLYGA------NCGFTDPDATPKDPPTTGDATFSRGMVHAG  124

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGE-SCTLSWYWLGIKYVEGI  182
            PCE+WLDDT V +  +C T +  G          VDYSSC    C L +YWL  + V+  
Sbjct  125  PCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSK  184

Query  183  YSWQVYKNCVGL  194
              WQVYK+CV L
Sbjct  185  MVWQVYKDCVPL  196

>PHYRA_73584
Length=287

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (53%), Gaps = 17/138 (12%)

Query  72   QSWMEQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLD  129
             S  + +GY+ +R +LD D +LY         CG T+P  T   P  T ++  + G    
Sbjct  67   SSLKKSNGYSDIRTLLDSDTTLYGA------NCGFTNPDATAKDPPTTGDATFSRGMVHA  120

Query  130  GPCEVWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEG  181
            GPCE+WLDDT V +  +C T +  G  +       VDYSSC  S C L +YWL  + V+ 
Sbjct  121  GPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  180

Query  182  IYSWQVYKNCVGL-GTAA  198
               WQVYK+CV L G AA
Sbjct  181  KTVWQVYKDCVPLTGPAA  198

>H310_06362
Length=197

 Score = 84.0 bits (206),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 69/135 (51%), Gaps = 27/135 (20%)

Query  79   GYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------NSFQTSGYTLD--G  130
            G+ +LRAMLD             +CG T      +PIPT+      N     G+     G
Sbjct  51   GFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTG  101

Query  131  PCEVWLDDTKVSAGRNCHTEFPQ---GQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQV  187
            PCE+WLD+T+V    NC   FP+    Q  VD+SSC  SCT+ +YWL +   E +  WQV
Sbjct  102  PCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH--EDL--WQV  157

Query  188  YKNC---VGLGTAAT  199
            YKNC   VGL  + T
Sbjct  158  YKNCAPLVGLAASPT  172

>PYIR_16435
Length=304

 Score = 85.5 bits (210),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 69/122 (57%), Gaps = 14/122 (11%)

Query  76   EQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTL-DGPCEV  134
            ++ GY++LR+ ++D+            CG T+P    + IP++N+ + S   +  GPCE+
Sbjct  72   KEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIVHPGPCEL  122

Query  135  WLDDTKVSAGRNCHTEFPQG--QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV  192
            WLDD +V    NC   F       ++D+SSC  SC L W+WLG++  +    WQVYKNCV
Sbjct  123  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQVYKNCV  180

Query  193  GL  194
             L
Sbjct  181  PL  182

>PHYSO_484051
Length=285

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 67/129 (52%), Gaps = 16/129 (12%)

Query  76   EQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDG-PCE  133
            E +GY+ +R +LD D SLY        +CG T+P    +  PT      S   +   PCE
Sbjct  74   ESNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCE  127

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSW  185
            +WLDDT V +  +C T +  G  +       VDYSSC  S C L +YWL  + V+    W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  186  QVYKNCVGL  194
            QVYK+CV L
Sbjct  188  QVYKDCVPL  196

>PHYKE_2937
Length=366

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 68/129 (53%), Gaps = 16/129 (12%)

Query  76   EQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDGPCE  133
              +GY+ +R +LD D SLY        +CG T+P  T   P  T ++  + G    GPCE
Sbjct  78   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  131

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSW  185
            +WLDDT V +  +C T +  G          VDYSSC  S C L +YWL  + V+    W
Sbjct  132  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVW  191

Query  186  QVYKNCVGL  194
            QVYK+CV L
Sbjct  192  QVYKDCVPL  200

>PHYRA_73606
Length=366

 Score = 83.6 bits (205),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 68/129 (53%), Gaps = 16/129 (12%)

Query  76   EQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDGPCE  133
              +GY+ +R +LD D SLY        +CG T+P  T   P  T ++  + G    GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  127

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSW  185
            +WLDDT V +  +C T +  G          VDYSSC  S C L +YWL  + V+    W
Sbjct  128  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIVW  187

Query  186  QVYKNCVGL  194
            QVYK+CV L
Sbjct  188  QVYKDCVPL  196

>PPTG_04647
Length=327

 Score = 83.2 bits (204),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 67/129 (52%), Gaps = 16/129 (12%)

Query  76   EQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDGPCE  133
              +GY+ +R +LD D  LY        +CG T+P  T   P  T ++  + G    GPCE
Sbjct  73   SSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  126

Query  134  VWLDDTKVSAGRNCHTEFPQGQ-------HQVDYSSCGES-CTLSWYWLGIKYVEGIYSW  185
            +WLDDT V +  NC T +  G          VDYSSC  S C L +YWL  + V+    W
Sbjct  127  IWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  186

Query  186  QVYKNCVGL  194
            QVYK+CV L
Sbjct  187  QVYKDCVPL  195

>PYVX_14662
Length=540

 Score = 83.6 bits (205),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 68/132 (52%), Gaps = 15/132 (11%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDG  130
            +S   + G T +R++LDD S+Y        +CG T P    Q IPT+     S G    G
Sbjct  68   KSLAAEKGVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTDGKATFSRGMVHVG  121

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQV------DYSSC--GESCTLSWYWLGIKYVEGI  182
            PCE+WLDDT V    +C++ +      V      DYSSC  G    + +YWL  + V+G 
Sbjct  122  PCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDGD  181

Query  183  YSWQVYKNCVGL  194
              WQVYKNC+ L
Sbjct  182  TVWQVYKNCIPL  193

>PHYSO_533903
Length=208

 Score = 79.3 bits (194),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 67/127 (53%), Gaps = 16/127 (13%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN-NSFQTSGYTLDGPCEVWL  136
            + +  L+ MLDD SLY        +CG T P    QPIPT+  +  + G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  137  DDTKVSAGRNCHTEFPQG------QHQVDYSSC--GESCTLSWYWLGIKYVEGIYS-WQV  187
            DD KV    +C++E+         +  +DYSSC  G    + +YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  188  YKNCVGL  194
            YK+C+ L
Sbjct  188  YKDCIPL  194

>PHYCA_531163
Length=314

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 68/132 (52%), Gaps = 16/132 (12%)

Query  73   SWMEQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDG  130
            S    +GY+ +R +LD D SLY        +CG T+   T   P  T ++  + G    G
Sbjct  71   SLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVG  124

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGI  182
            PCE+WLDDT V +  +C T +  G          VDYSSC  S C L +YWL  + V+  
Sbjct  125  PCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSA  184

Query  183  YSWQVYKNCVGL  194
              WQVYK+CV L
Sbjct  185  IVWQVYKDCVPL  196

>PITG_04948
Length=232

 Score = 79.3 bits (194),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 65/126 (52%), Gaps = 16/126 (13%)

Query  83   LRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  140
            +R +LD D SLY        +CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  141  VSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQVYKNCV  192
            V    +C + +  G  +       VDYSSC    C L +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNCI  192

Query  193  GLGTAA  198
             L   A
Sbjct  193  PLSGPA  198

>PHYCA_130365
Length=266

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 63/126 (50%), Gaps = 15/126 (12%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWL  136
            + Y  +R+M+D  S+Y        +CG T P       PT+ +   S G    GPCE+WL
Sbjct  73   NNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIWL  126

Query  137  DDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQVY  188
            DD  V    +C + +  G          VDYSSC    C L +YWLG++ ++G   WQ Y
Sbjct  127  DDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQAY  186

Query  189  KNCVGL  194
            KNC+ L
Sbjct  187  KNCIPL  192

>PHYKE_10578
Length=239

 Score = 78.6 bits (192),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 17/106 (16%)

Query  102  ECGLTSPKTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQH  156
            +CG T    + QP+P++          +G+T  GPCEV++DD  V  G NC  E+P G  
Sbjct  85   KCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPD  144

Query  157  Q--------VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            +        +DYSSC   C LS+YWLG +  +    WQ Y NCV L
Sbjct  145  ESGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVPL  186

>PHYRA_86016
Length=236

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (53%), Gaps = 17/112 (15%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T    + QPIPT+   +       G+T  GPCE+++DDT V  G +C  E+P G  
Sbjct  21   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  80

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                  +  VDYSSC   CTL+ YWL  +  +    WQ Y NCV L  + +A
Sbjct  81   GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSA  128

>PHYCA_534296
Length=309

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 69/132 (52%), Gaps = 15/132 (11%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-G  130
            +S    + +  L+ ++DD S+Y        +CG T+P    QPIPT+     S   +  G
Sbjct  41   KSLKSANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVG  94

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGI  182
            PCE+WLDDTKV    +C++++            VDYSSC  G    + +YWL  + V+G 
Sbjct  95   PCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGK  154

Query  183  YSWQVYKNCVGL  194
              WQ YK+C+ L
Sbjct  155  TVWQSYKDCIPL  166

>PHYRA_77971
Length=230

 Score = 77.4 bits (189),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 56/112 (50%), Gaps = 18/112 (16%)

Query  102  ECGLTSPKTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQH  156
            +CG T    + QP+PTN           GYT  GPCE+++DD  V    NC  ++P G +
Sbjct  86   KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  157  Q--------VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL-GTAAT  199
                     VDYSSC   CT S YWLG +  +    WQ Y NCV L GT  T
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGET  193

>PHYRA_85794
Length=230

 Score = 77.4 bits (189),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 56/112 (50%), Gaps = 18/112 (16%)

Query  102  ECGLTSPKTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQH  156
            +CG T    + QP+PTN           GYT  GPCE+++DD  V    NC  ++P G +
Sbjct  86   KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  157  Q--------VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL-GTAAT  199
                     VDYSSC   CT S YWLG +  +    WQ Y NCV L GT  T
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGET  193

>PHYKE_6001
Length=289

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 15/128 (12%)

Query  76   EQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-GPCEV  134
            + + Y  L+ ++DD S+Y        +CG T P    QPIP++     S      GPCE+
Sbjct  71   KANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEI  124

Query  135  WLDDTKVSAGRNCHTEFP------QGQHQVDYSSC-GESCT-LSWYWLGIKYVEGIYSWQ  186
            WLDD  V +  +C+ ++       +    VDYSSC G  C  + +YWL  + V+G   WQ
Sbjct  125  WLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQ  184

Query  187  VYKNCVGL  194
             YKNC+ L
Sbjct  185  SYKNCIPL  192

>PHYRA_86752
Length=300

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (53%), Gaps = 17/112 (15%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T    + QPIPT+   +       G+T  GPCE+++DDT V  G +C  E+P G  
Sbjct  85   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  144

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                  +  VDYSSC   CTL+ YWL  +  +    WQ Y NCV L  + +A
Sbjct  145  GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSA  192

>PITG_05271
Length=278

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 64/124 (52%), Gaps = 15/124 (12%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-GPCEVWLDD  138
            +  L+ ++DD S+Y        +CG T P  + QPIP +     S   +  GPCE+WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDD  128

Query  139  TKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGIYSWQVYKN  190
            TKV    +C +++            VDYSSC  G    + +YWL  + V+G   WQ YK+
Sbjct  129  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKD  188

Query  191  CVGL  194
            C+ L
Sbjct  189  CIPL  192

>PHYKE_2809
Length=291

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 62/122 (51%), Gaps = 16/122 (13%)

Query  83   LRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  140
            +R MLD D  LY        +CG T PK   +  PT+ +   S G    GPCE+WLDD  
Sbjct  66   IRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDKM  119

Query  141  VSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQVYKNCV  192
            V    +C + +  G  +       VDYSSC    C   +YWL ++ ++G   WQVYKNCV
Sbjct  120  VLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCV  179

Query  193  GL  194
             L
Sbjct  180  PL  181

>PPTG_04618
Length=326

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 15/127 (12%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDGPCEVW  135
            ++ Y  +R+++D   +Y        +CG T PK T ++P     +  + G    GPCE+W
Sbjct  73   KNNYKDVRSLMDGNPVYGE------DCGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  136  LDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQV  187
            LDD  V    +C + +  G  +       VDYSSC    C L +YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQA  186

Query  188  YKNCVGL  194
            YKNC+ L
Sbjct  187  YKNCIPL  193

>PHYRA_83499
Length=473

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (53%), Gaps = 17/112 (15%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T    + QPIPT+   +       G+T  GPCE+++DDT V  G +C  E+P G  
Sbjct  85   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  144

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                  +  VDYSSC   CTL+ YWL  +  +    WQ Y NCV L  + +A
Sbjct  145  GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSA  192

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 12/72 (17%)

Query  125  GYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQ--------VDYSSCGESCTLSWYWLGI  176
            G  + GPCE++LDDT +  G NC  E+  G           +DYSSC  +CTL+ YWLG 
Sbjct  346  GTGISGPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF  405

Query  177  KYVEGIYSWQVY  188
            +  +    WQ Y
Sbjct  406  QNEQ----WQAY  413

>SDRG_17318
Length=241

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 68/135 (50%), Gaps = 25/135 (19%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNN--SFQTS----G  125
            +++  Q  Y +LRAMLD             +CG T      + IP+N   +FQ      G
Sbjct  65   KAFKAQSKYKTLRAMLDPHGP---------DCGNTLTNVARKEIPSNGKMTFQNPDTGEG  115

Query  126  Y--TLDGPCEVWLDDTKVSAGRNCHTEFPQ---GQHQVDYSSCG-ESCTLSWYWLGIKYV  179
            +  +  GPCEVWLD+ +V    +C T FPQ       VDYSSCG + C L +YW+ +   
Sbjct  116  FIPSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALHSP  175

Query  180  EGIYSWQVYKNCVGL  194
                 WQVYKNCV L
Sbjct  176  R----WQVYKNCVPL  186

>PYU1_G014690
Length=295

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 65/124 (52%), Gaps = 18/124 (15%)

Query  76   EQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTL-DGPCEV  134
            ++ G+ +LR+ ++D+            CG T P    + IP++N    S   +  GPCE+
Sbjct  68   KEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFSRPIVHPGPCEI  118

Query  135  WLDDTKVSAGRNCHTEFPQGQH----QVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKN  190
            WLDD +V    +C   F  G       +D+SSC  +C L ++WLG++  +    WQVYKN
Sbjct  119  WLDDKRVMQDDDCEATF--GDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYKN  174

Query  191  CVGL  194
            CV L
Sbjct  175  CVPL  178

>PHYSO_483955
Length=320

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 15/126 (12%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWL  136
            + Y  +R+++D   +Y        +CG T PK +    PT+ +   S G    GPCE+WL
Sbjct  74   NNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWL  127

Query  137  DDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQVY  188
            DD  V    +C + +  G  +       VDYSSC    C L +YWL ++ ++G   WQ Y
Sbjct  128  DDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAY  187

Query  189  KNCVGL  194
            KNC+ L
Sbjct  188  KNCIPL  193

>H257_13550
Length=266

 Score = 77.0 bits (188),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 25/133 (19%)

Query  79   GYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------NSFQTSGYTLD--G  130
            G+ +LRAMLD +           +CG +      +PIP++      N     G+     G
Sbjct  106  GFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPSHTG  156

Query  131  PCEVWLDDTKVSAGRNCHTEFPQ---GQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQV  187
            PCE+WLD+T+V    +C T FP+       VD++SC  SCT+ +YW+ +        WQV
Sbjct  157  PCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIALHQ----DLWQV  212

Query  188  YKNCVGL-GTAAT  199
            YKNC  L G +AT
Sbjct  213  YKNCAPLVGLSAT  225

>SPRG_19917
Length=241

 Score = 76.6 bits (187),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 69/141 (49%), Gaps = 25/141 (18%)

Query  66   NTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNN--SFQT  123
            N +   +++  Q  Y +LRA+LD             +CG T      + IP+N   +FQ 
Sbjct  59   NAANFNKAFKAQSKYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQN  109

Query  124  S----GYTLD--GPCEVWLDDTKVSAGRNCHTEF---PQGQHQVDYSSCG-ESCTLSWYW  173
                 G+ L   GPCEVWLD+ +V    +C T F   P     VDYSSCG + C L +YW
Sbjct  110  PDTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYW  169

Query  174  LGIKYVEGIYSWQVYKNCVGL  194
            + +        WQVYKNCV L
Sbjct  170  IALHSPR----WQVYKNCVPL  186

>PHYSO_340333
Length=284

 Score = 77.0 bits (188),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 15/126 (12%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-GPCEVWL  136
            + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  137  DDTKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGIYSWQVY  188
            DD KV    +C +++            VDYSSC  G    + +YWL  + V+G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  189  KNCVGL  194
            K+C+ L
Sbjct  187  KDCIPL  192

>PPTG_04619
Length=276

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 64/126 (51%), Gaps = 16/126 (13%)

Query  83   LRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  140
            +R +LD D SLY        +CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  141  VSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQVYKNCV  192
            V    +C + +  G  +       VDYSSC    C   +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  193  GLGTAA  198
             L   A
Sbjct  193  PLSGPA  198

>PYU1_G005323
Length=251

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 13/118 (11%)

Query  79   GYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPCEVWLD  137
            GY  L++ L+D+            CG + P  + +PIP++   +  S     GPCEVW D
Sbjct  68   GYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEVWFD  118

Query  138  DTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            D +     +C   F      +VD+S+C  SC L +YWLG++  +G   WQ YKNC+ L
Sbjct  119  DVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPL  174

>PITG_04949
Length=337

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 15/127 (12%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVW  135
            ++ +  +R+++D   ++        ECG T PK +    P++ +   S G    GPCE+W
Sbjct  73   KNNFKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  136  LDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQV  187
            LDD  V    +C + +  G  Q       VDYSSC    C L +YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQA  186

Query  188  YKNCVGL  194
            YKNC+ L
Sbjct  187  YKNCIPL  193

>PYIR_24743
Length=357

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 72/154 (47%), Gaps = 27/154 (18%)

Query  52   FQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTE  111
            FQG    +      N     +++  Q  + +LR +L D            +CG + P   
Sbjct  62   FQG---KFNDNPQANVDTFTKAFQGQSEFKTLRDLLKDHGA---------DCGDSKPDAS  109

Query  112  TQPIPTN------NSFQTSGY--TLDGPCEVWLDDTKVSAGRNCHTEF---PQGQHQVDY  160
             + IP +      N     G+  +  GPCE+WLDD +V +  NC   F   P+ +  VD+
Sbjct  110  RKAIPGDGKVVWQNPDTGEGFVPSHTGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDF  169

Query  161  SSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            SSC E+C L +YWL +       +WQVYKNCV L
Sbjct  170  SSCKENCMLRFYWLALHEP----TWQVYKNCVPL  199

>PHYSO_340332
Length=295

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 15/126 (12%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-GPCEVWL  136
            + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  137  DDTKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGIYSWQVY  188
            DD KV    +C +++            VDYSSC  G    + +YWL  + V+G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  189  KNCVGL  194
            K+C+ L
Sbjct  187  KDCIPL  192

>PHYCA_98479
Length=276

 Score = 76.3 bits (186),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 55/106 (52%), Gaps = 17/106 (16%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            ECG T      QP+PT+   +       G+T  GPCE+++DDT V  G NC  E+P G  
Sbjct  85   ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  144

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                     VDYSSC   CTL+ YWLG +  +    WQ Y NCV L
Sbjct  145  GSTVTSDMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYINCVPL  186

>SDRG_08137
Length=282

 Score = 76.3 bits (186),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 68/141 (48%), Gaps = 25/141 (18%)

Query  66   NTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------N  119
            N +    ++  Q  + +LR ML+ +            CG + P    + IP++      N
Sbjct  121  NVAAFTSAFKAQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWRN  171

Query  120  SFQTSGY--TLDGPCEVWLDDTKVSAGRNCHTEFPQ---GQHQVDYSSC-GESCTLSWYW  173
                 G+  +  GPCEVWLDD +V    +C T FPQ       VDYSSC G+ C L +YW
Sbjct  172  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYW  231

Query  174  LGIKYVEGIYSWQVYKNCVGL  194
            L +   +    WQVYKNCV L
Sbjct  232  LALHQPQ----WQVYKNCVPL  248

>PYU1_G007476
Length=195

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 60/123 (49%), Gaps = 17/123 (14%)

Query  76   EQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNN----SFQTSGYTLDGP  131
            +Q GY +LR+ L+++            CG T P T  + IP +     +    G+   GP
Sbjct  71   KQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPGP  121

Query  132  CEVWLDDTKVSAGRNCHTEFP--QGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYK  189
            CE+WLD+  +    NC   FP  +    VD+SSC  +C L  YWLG +  +    WQ YK
Sbjct  122  CELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQ--DQGQRWQTYK  179

Query  190  NCV  192
             CV
Sbjct  180  YCV  182

>SDRG_08129
Length=218

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 68/141 (48%), Gaps = 25/141 (18%)

Query  66   NTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------N  119
            N +    ++  Q  + +LR ML+ +            CG + P    + IP++      N
Sbjct  57   NVAAFTSAFKVQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGAMTWRN  107

Query  120  SFQTSGY--TLDGPCEVWLDDTKVSAGRNCHTEFPQ---GQHQVDYSSC-GESCTLSWYW  173
                 G+  +  GPCEVWLDD +V    +C T FPQ       VDYSSC G+ C L +YW
Sbjct  108  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYW  167

Query  174  LGIKYVEGIYSWQVYKNCVGL  194
            L +   +    WQVYKNCV L
Sbjct  168  LALHQPQ----WQVYKNCVPL  184

>SDRG_07565
Length=278

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 64/126 (51%), Gaps = 16/126 (13%)

Query  81   TSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------NSFQTSGY--TLDGPC  132
            T+ +A    ++L  + E     CG + P    + IP++      N     G+  +  GPC
Sbjct  125  TAFKAQSQFKTLRDMLEPQGPACGNSLPNASKKTIPSDGTMTWLNPDTGEGFISSHTGPC  184

Query  133  EVWLDDTKVSAGRNCHTEFPQ---GQHQVDYSSCGES-CTLSWYWLGIKYVEGIYSWQVY  188
            EVWLDD +V    +C T FPQ       VDYSSCG S C L +YWL +   +    WQVY
Sbjct  185  EVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWLALHQPQ----WQVY  240

Query  189  KNCVGL  194
            KNCV L
Sbjct  241  KNCVPL  246

>PYAP_19707
Length=241

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 57/106 (54%), Gaps = 8/106 (8%)

Query  92   LYQVTEEAIFECGLTSPKTETQPIPTNN--SFQTSGYTLDGPCEVWLDDTKVSAGRNCHT  149
            +  + E A  +CG T      QPIPT+   +F  S   + GPCEVWLD+TKV++ + C  
Sbjct  58   IKALAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHI-GPCEVWLDNTKVASAKECWK  116

Query  150  EFPQGQHQVDYSSCGE-SCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            EFP  + +VD++ C   SC L W W+          W+ + NCV +
Sbjct  117  EFPNKRIKVDFAKCKSGSCQLRWVWMATH----TSPWEFFDNCVRV  158

>PYIR_16375
Length=262

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 63/120 (53%), Gaps = 12/120 (10%)

Query  79   GYTSLRAM-LDDESLYQVTEEAIFECGLTS---PKTETQPIPTNNSFQTSGYTLDGPCEV  134
            GYTSLR + L ++ +Y   E    ECGLT+    K  T P   N +F  SG+T  GPCE+
Sbjct  77   GYTSLRDLILANQDMYD--ESTDKECGLTTLDEAKRTTMPASGNITF--SGFTHPGPCEL  132

Query  135  WLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            W DD K++   NC   +P G+   D + C  +     +W+G+        WQVY NCV L
Sbjct  133  WCDDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGVHGSP----WQVYTNCVYL  188

>PHYCA_19611
Length=531

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 13/128 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--  128
            M    YTSL+  ++D+ +  V +E   ECG T+PK   QP+P      +     G+T   
Sbjct  280  MAASKYTSLKEFMNDK-MVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSH  338

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQ--GQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
            +GPCEVW DDT+V    NC   FP    +   D  +C  S  L+ YW+ +       SWQ
Sbjct  339  EGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALHSP----SWQ  394

Query  187  VYKNCVGL  194
            VY NC  L
Sbjct  395  VYINCAAL  402

 Score = 39.7 bits (91),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 46/108 (43%), Gaps = 17/108 (16%)

Query  89   DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCH  148
            + S Y+  +E I + G T  +         N FQ    T +GP  V      ++   NC 
Sbjct  48   EASKYKSLKEVINDLGKTKLR---------NRFQR--RTSNGPTVVAKALPPLTKDDNCA  96

Query  149  TEFPQGQHQVDYS--SCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
              +P    +V Y   +C  +  L++YWL +       +WQVY NC  L
Sbjct  97   ANYPTAPAKVPYDRDACLGASRLTFYWLALHSS----TWQVYTNCAAL  140

>PHYSO_485524
Length=278

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 64/133 (48%), Gaps = 16/133 (12%)

Query  76   EQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCE  133
            + +    +R +LD D  LY         CG T+P    +  PT+ +   S G    GPCE
Sbjct  72   DSNNAKDIRTLLDSDTKLYGAN------CGYTNPDATPEDPPTDGTATFSRGIVHAGPCE  125

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSW  185
            +WLDD  V    +C + +  G  +       VDYSSC    C   +YWL ++ ++G   W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYW  185

Query  186  QVYKNCVGLGTAA  198
            QVYKNC+ L   A
Sbjct  186  QVYKNCIPLSGPA  198

>PYAP_18709
Length=235

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 62/118 (53%), Gaps = 13/118 (11%)

Query  79   GYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPCEVWLD  137
            G+  LR+ L+D+            CG + P    +PIP++ + +  S     GPCEVWLD
Sbjct  68   GFKDLRSFLEDKGP---------TCGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLD  118

Query  138  DTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            +T+     +C   F      ++D+ +C  SC L +YWLG++  +G   WQ YKNC+ L
Sbjct  119  NTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPL  174

>PHYCA_12942
Length=353

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 54/101 (53%), Gaps = 12/101 (12%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T      QPIP++   +       G+T  GPCE+++DD  V  G NC  EF  G  
Sbjct  83   KCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDT  142

Query  155  -QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
               ++DYSSC  +C L+ YWLG +  +    WQ Y NCV L
Sbjct  143  SDMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>PYIW_27477
Length=180

 Score = 73.2 bits (178),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 5/119 (4%)

Query  73   SWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-GP  131
            SW +   +  +      E+L    E+   +CG T P  + + IP++N  + S   +  GP
Sbjct  34   SWKDPANFAKVSKEKGFETLRSYIEDKGAKCGKTDPNAKAKAIPSDNVVKFSRAIVHPGP  93

Query  132  CEVWLDDTKVSAGRNCHTEFPQG--QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVY  188
            CE+W+DDT+V    NC   F       ++D+S+C   C L W+WLG++  +    WQVY
Sbjct  94   CELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

>PHYCA_18657
Length=295

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 57/112 (51%), Gaps = 18/112 (16%)

Query  102  ECGLTSPKTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQH  156
            +CG T    + +P+PTN           G+T  GPCE+++DD  V    +C  ++P G +
Sbjct  171  KCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPN  230

Query  157  Q--------VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL-GTAAT  199
                     VDYSSC   CT S YWLG +  +    WQ Y NCV L GT AT
Sbjct  231  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGAT  278

>PPTG_07521
Length=281

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 54/106 (51%), Gaps = 17/106 (16%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            ECG T      QPIP++   +       G+T  GPCE++LDD  V  G NC  E+P G  
Sbjct  85   ECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYPGGDV  144

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                     VDYSSC E CTL+ YWL  +      +WQ Y NCV L
Sbjct  145  GSTVTSDMPVDYSSCTEDCTLTIYWLAFQNA----NWQAYINCVPL  186

>PHYRA_78175
Length=319

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 62/123 (50%), Gaps = 13/123 (11%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--DGPCE  133
            Y+SL+  + D+ L  V +E   ECG T+P    QP+P      +     G+T   +GPCE
Sbjct  78   YSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTASHEGPCE  136

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQVYKNC  191
            VW DDT+V    NC   FP    ++ Y   +C  S  LS YW+ +       SWQVY NC
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALHSA----SWQVYINC  192

Query  192  VGL  194
              L
Sbjct  193  AAL  195

>PHYRA_78689
Length=296

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 15/132 (11%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-G  130
            +S    + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  G
Sbjct  67   KSLKTANNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVG  120

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGI  182
            PCE+WLDDTKV    +C +++            VDYSSC  G    + +YWL  + ++  
Sbjct  121  PCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSK  180

Query  183  YSWQVYKNCVGL  194
              WQ YK+C+ L
Sbjct  181  TVWQSYKDCIPL  192

>PPTG_07509
Length=299

 Score = 74.7 bits (182),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 58/112 (52%), Gaps = 17/112 (15%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T    + +PIP +   +       G+T  GPCE+++DD  V  G NC  +FP G  
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                  +  VD+SSC   CTL+ YWLG +  +    WQ Y NCV L  + +A
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSGSA  191

>PYAR_18165
Length=261

 Score = 74.3 bits (181),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 54/101 (53%), Gaps = 9/101 (9%)

Query  102  ECGLTSPKTETQPIPTNN--SFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVD  159
            +CG T+     QP P++   +F  S   + GPCE+WLDDTKV +  +C  +FP  +  VD
Sbjct  68   KCGKTNANAAVQPAPSDGVVAFAISAQHI-GPCEIWLDDTKVVSATDCWKQFPDKRIPVD  126

Query  160  YSSCGE--SCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            +S C    SC L W W+          W+ Y NCV +GT A
Sbjct  127  FSKCANKASCELRWIWMATH----TSPWEFYDNCVRVGTGA  163

>PHALS_05392
Length=367

 Score = 75.5 bits (184),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 62/130 (48%), Gaps = 15/130 (12%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWL  136
            + +  +R+++D   +Y        +CG T P       P+N     S G    GPCE+WL
Sbjct  157  NNFKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWL  210

Query  137  DDTKVSAGRNCHTEFPQGQHQ-------VDYSSCG-ESCTLSWYWLGIKYVEGIYSWQVY  188
            DD  V    +C   +  G  +       VDYSSC  + C L +YWL ++ ++G   WQ Y
Sbjct  211  DDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAY  270

Query  189  KNCVGLGTAA  198
            KNC+ L   A
Sbjct  271  KNCIPLNGPA  280

>PPTG_07507
Length=299

 Score = 74.7 bits (182),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 58/112 (52%), Gaps = 17/112 (15%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T    + +PIP +   +       G+T  GPCE+++DD  V  G NC  +FP G  
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                  +  VD+SSC   CTL+ YWLG +  +    WQ Y NCV L  + +A
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSGSA  191

>PYIR_16444
Length=182

 Score = 72.8 bits (177),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 14/120 (12%)

Query  76   EQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTL-DGPCEV  134
            +Q G+ +LR+ ++++            CG T+ K   +PIP++     S   +  GPCE+
Sbjct  69   KQKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHFSRAIVHPGPCEL  119

Query  135  WLDDTKVSAGRNCHTEFPQGQH--QVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV  192
            WLD+ +V    NC   F       ++D+SSC  +C L ++WLG++  +    WQVYKNCV
Sbjct  120  WLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCV  177

>PHYSO_459106
Length=223

 Score = 73.2 bits (178),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query  76   EQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTN-NSFQTSGYTLDGPCE  133
            + +    +R M+D D  LY        +CG T PK + Q  PT  ++  + G    GPCE
Sbjct  72   KANNVKDIRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATFSRGIVHAGPCE  125

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGE-SCTLSWYWLGIKYVEGIYSW  185
            +WLDD  V    +C + +  G          VDYSSC    C   +YWL ++  +    W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYW  185

Query  186  QVYKNCVGL  194
            QVYKNC+ L
Sbjct  186  QVYKNCIPL  194

>PHALS_03179
Length=372

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 11/127 (9%)

Query  79   GYTSLRAMLDDESLYQVTEEAIF--ECGLTSPKTETQPIPTNNSFQTSGYTLD-GPCEVW  135
             Y SL+A  + + L  + E      ECG + PK + QPIP +     S   +  GPCE+W
Sbjct  106  AYQSLKAANNFKDLKTLMETHALGPECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMW  165

Query  136  LDDTKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGIYSWQV  187
            LD+ KV    +C+ ++     +      VDYSSC  G    + +YWL  + ++GI  WQ 
Sbjct  166  LDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQS  225

Query  188  YKNCVGL  194
            YKNC+ L
Sbjct  226  YKNCIPL  232

>PYIW_19151
Length=248

 Score = 73.6 bits (179),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 82/167 (49%), Gaps = 31/167 (19%)

Query  37   VVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVT  96
            V+++PPP+   D  D +  A A                 ++ G+++LR+ L+D+      
Sbjct  44   VIEYPPPW-TGDWKDPKNFAAA----------------AKEKGFSTLRSYLEDKGAV---  83

Query  97   EEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTKVSAGRNCHTEFPQ--  153
                  CG T PK   + IP + + + S      GPCE+++DDT+V    +C + F    
Sbjct  84   ------CGFTDPKVSPRAIPADRTIRFSRDIPHPGPCELYIDDTRVYQNDDCESAFTGVI  137

Query  154  GQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                VD+S C   C + +YWLG++   G   WQVYK+CV + ++A A
Sbjct  138  PSWDVDWSLCKGECMIRFYWLGLQ-ASGT-RWQVYKSCVPVSSSAVA  182

>PHYSO_533747
Length=206

 Score = 72.4 bits (176),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 16/126 (13%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN-NSFQTSGYTLDGPCEVWL  136
            + +  L+ MLDD SLY        +CG T P    QPIPT+  +  + G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  137  DDTKVSAGRNCHTEFPQG------QHQVDYSSC--GESCTLSWYWLGIKYVEGIYS-WQV  187
            DD KV    +C++E+         +  +DYSSC  G    + +YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  188  YKNCVG  193
            Y   +G
Sbjct  188  YSTLLG  193

>PYVX_16138
Length=559

 Score = 75.1 bits (183),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 15/126 (12%)

Query  73   SWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGP  131
            S  E+ G T +R++LDD S+Y        +CG T P    Q IPT+++   S G    GP
Sbjct  69   SLAEEKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVGP  122

Query  132  CEVWLDDTKVSAGRNCHTEFPQGQHQ------VDYSSCGES-CT-LSWYWLGIKYVEGIY  183
            CE+WLDDT V    +C++ +            VDYSSC  S C+ + +YWL  + V+   
Sbjct  123  CEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDET  182

Query  184  SWQVYK  189
             WQVY 
Sbjct  183  VWQVYS  188

>PYAR_14256
Length=199

 Score = 72.4 bits (176),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 59/121 (49%), Gaps = 12/121 (10%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLD  137
             G+ +LRA L+D+            CG T P  + +P         S     GPCE+WLD
Sbjct  64   KGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLASTIEHPGPCEIWLD  114

Query  138  DTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGT  196
            D+      +C  +F      +VD+S+C  SC L +YWLG++       WQ YKNC+ LG 
Sbjct  115  DSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCIPLGG  172

Query  197  A  197
            A
Sbjct  173  A  173

>PHYSO_438103
Length=238

 Score = 72.8 bits (177),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 15/132 (11%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-G  130
            +S    + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  G
Sbjct  66   KSLKSANNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVG  119

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGI  182
            PCE+WLD+TKV    +C +++            VDYSSC  G    + +YWL  + ++  
Sbjct  120  PCEIWLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSK  179

Query  183  YSWQVYKNCVGL  194
              WQ YK+C+ L
Sbjct  180  TVWQSYKDCIPL  191

>PHYKE_3913
Length=321

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 61/122 (50%), Gaps = 16/122 (13%)

Query  83   LRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  140
            +R + D D SLY         CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  106  IRTLFDSDTSLYGE------NCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  159

Query  141  VSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQVYKNCV  192
            V    +C + +  G  +       VDYSSC    C   +YW+ ++ ++G   WQVYKNCV
Sbjct  160  VLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCV  219

Query  193  GL  194
             L
Sbjct  220  PL  221

>PYVX_20789
Length=290

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 87/199 (44%), Gaps = 38/199 (19%)

Query  22   VTGQRRLDAG-LGEGQVVQHPP------------PFFIVDGLDFQGMALAYLQEQGVNTS  68
            VT Q  L  G LG G ++   P            P   +D  +  G ++     QGV   
Sbjct  10   VTVQATLIVGTLGHGNIILPKPTGDSDHVYYYGGPAGTIDMPEIIGDSIYSEYYQGV---  66

Query  69   IEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNN--SFQTSGY  126
                 W  ++G +SL+        Y      I ECG T      QP+P++      T G 
Sbjct  67   ---ADWFTENGISSLKE-------YXXXXTNISECGNTEKDGTAQPVPSDGYAEHDTLGN  116

Query  127  TLDGPCEVWLDDTKVSAGRNCHTEFPQGQH----QVDYSSCGESCTLSWYWLGIKYVEGI  182
            +  GPCE+W DDT+V    NC T+F  GQ      +D ++C  S    +YWL +      
Sbjct  117  SHPGPCEIWCDDTRVFNSTNCVTDF-SGQSPAMIPIDVATCTASSEFVFYWLALH----A  171

Query  183  YSWQVYKNCVGL-GTAATA  200
              WQVY NCV L GT+++A
Sbjct  172  QPWQVYINCVALDGTSSSA  190

>PYU1_G007364
Length=316

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 14/104 (13%)

Query  102  ECGLTSPKTETQPIPTN------NSFQTSGYTLD--GPCEVWLDDTKVSAGRNCHTEFP-  152
            +CG T      +PIP++      N     G+     GPCE+WLDDT V    NC   FP 
Sbjct  102  DCGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSHTGPCEIWLDDTPVLKEENCAGRFPG  161

Query  153  -QGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLG  195
               Q +VD+SSC   C + +YWL ++      +WQ+YKNC+ L 
Sbjct  162  NPAQMKVDFSSCTGKCVMRFYWLTLQEP----AWQIYKNCIPLA  201

>PPTG_03139
Length=320

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 13/123 (11%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP------TNNSFQTSGYTLDGPCE  133
            Y+SL+  + D+ +  V+++   ECG T+P    QP+P      ++ S +    + +GPCE
Sbjct  78   YSSLKEFMTDK-MVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCE  136

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNC  191
            VW DDT+V    NC   FP    ++  D+ +C  S  LS YW+ +       SWQVY NC
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALHSP----SWQVYINC  192

Query  192  VGL  194
              L
Sbjct  193  AAL  195

>PHYKE_6077
Length=322

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP------TNNSFQTSGYTL  128
            M    YTSL+  +  ++    + E   ECG T+PK   QP+P      ++ S +    + 
Sbjct  73   MAASKYTSLKEFMAAKAKV-TSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGFTSSH  131

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYS--SCGESCTLSWYWLGIKYVEGIYSWQ  186
            +GPCEVW DDT+V    NC   FP    ++ Y   +C  S  L+ YW+ +       SWQ
Sbjct  132  EGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALHSP----SWQ  187

Query  187  VYKNCVGL  194
            VY NC  L
Sbjct  188  VYINCAAL  195

>PYIR_16443
Length=275

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 15/120 (13%)

Query  76   EQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTL-DGPCEV  134
            +Q G+ +LR+ ++D+            CG T+P    + IP+++  + S   +  GPCE+
Sbjct  69   KQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEI  119

Query  135  WLDDTKVSAGRNCHTEFPQG--QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVY-KNC  191
            WLDD +V    NC   F       ++D+SSC  SC L W+WLG++  +    WQVY K+C
Sbjct  120  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSC  177

>PHYRA_84947
Length=265

 Score = 72.8 bits (177),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 65/134 (49%), Gaps = 17/134 (13%)

Query  73   SWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS--GYTLDG  130
            SW  ++   SL+  +   + Y      I ECG+T      QP+P++   Q    G +  G
Sbjct  68   SWFTKNNIASLKEYI---TTYGTD---ISECGVTKKNGAPQPVPSDGYAQHDNLGNSHPG  121

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQH----QVDYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
            PCE+W DDT+V    NC  +F  GQ      +D S+C  S  L +YWL +     I  WQ
Sbjct  122  PCEIWCDDTRVFHDSNCVAKF-SGQSPAKIPIDVSTCKSSSELVFYWLALH----IQPWQ  176

Query  187  VYKNCVGLGTAATA  200
            VY NCV L  A  A
Sbjct  177  VYINCVALDGAGAA  190

>PHYRA_78176
Length=312

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--  128
             E   Y+SL+  +DD++   VT+ A   CG   P    QP+P          + G+T   
Sbjct  74   FESSSYSSLKEFIDDKATITVTD-ATLTCGACDPDETAQPLPETYVEWAHSDSEGFTASH  132

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
            +GPCEVW DD +V    +C  +F     Q+  D+ +C  S  L++YWL +       +WQ
Sbjct  133  EGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALHSS----TWQ  188

Query  187  VYKNCVGL  194
            VY NC  L
Sbjct  189  VYVNCAPL  196

>PHYCA_97965
Length=288

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 55/106 (52%), Gaps = 17/106 (16%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T    + QPIP++   +       G+T  GPCE+++DD  V  G +C  EFP G  
Sbjct  87   KCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAK  146

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                  +  VD+SSC   CTL+ YWL  +  +    WQ Y NCV L
Sbjct  147  GSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPL  188

>PHYCA_12943
Length=287

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 55/106 (52%), Gaps = 17/106 (16%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T    + QPIP++   +       G+T  GPCE+++DD  V  G +C  EFP G  
Sbjct  87   KCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPD  146

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                  +  VD+SSC   CTL+ YWL  +  +    WQ Y NCV L
Sbjct  147  GSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPL  188

>PYVX_18175
Length=147

 Score = 70.1 bits (170),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)

Query  158  VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            +DYSSC  SCTL WYW+G++Y++G YSWQVYKNCV L T+A
Sbjct  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130

 Score = 35.8 bits (81),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 0/53 (0%)

Query  36  QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLD  88
           Q V  P P +     D     LA+L+ QG  T  +  +W   +GY +LR+ +D
Sbjct  29  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81

>PHYRA_73583
Length=630

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 63/126 (50%), Gaps = 16/126 (13%)

Query  83   LRAMLD-DESLYQVTEEAIFECGLTSPKTETQ-PIPTNNSFQTSGYTLDGPCEVWLDDTK  140
            +R +LD D +LY         CG T+P    + P  T ++  + G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGPCEIWLDDKM  132

Query  141  VSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQVYKNCV  192
            V    +C + +  G  +       VDYSSC    C   +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNCI  192

Query  193  GLGTAA  198
             L   A
Sbjct  193  PLSGPA  198

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 60/126 (48%), Gaps = 16/126 (13%)

Query  83   LRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDGPCEVWLDDTK  140
            +R M+D D  LY        +CG T PK T   P  T ++  + G    GPCEVWLDD  
Sbjct  380  IRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATFSRGMVHAGPCEVWLDDEM  433

Query  141  VSAGRNCHTEFPQGQHQ-------VDYSSC-GESCTLSWYWLGIKYVEGIYSWQVYKNCV  192
            V    +C + +  G          +DYSSC    C   ++WL ++  +    WQVYKNCV
Sbjct  434  VLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQVYKNCV  493

Query  193  GLGTAA  198
             L   A
Sbjct  494  PLSGPA  499

>PHYCA_127270
Length=279

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 64/132 (48%), Gaps = 15/132 (11%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-G  130
            +S    + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  G
Sbjct  67   KSLKAANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVG  120

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGI  182
            PCE+WLDD KV    +C +++            VDYSSC  G    + +YWL  + +   
Sbjct  121  PCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKK  180

Query  183  YSWQVYKNCVGL  194
              WQ YK+C+ L
Sbjct  181  TVWQSYKDCIPL  192

>PHYSO_533682
Length=278

 Score = 72.4 bits (176),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 15/131 (11%)

Query  73   SWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGP  131
            S+   + +  L+ ++DD S+Y        +CG T P    QPIPT+     S G    GP
Sbjct  68   SFKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGP  121

Query  132  CEVWLDDTKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGIY  183
            CE+WLDD KV +  +C++++            VDYSSC  G    +  Y LG + +    
Sbjct  122  CEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKT  181

Query  184  SWQVYKNCVGL  194
             WQ YKNC+ L
Sbjct  182  VWQSYKNCIPL  192

>PHALS_03176
Length=207

 Score = 71.2 bits (173),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 11/126 (9%)

Query  80   YTSLRAMLDDESLYQVTEEAIF--ECGLTSPKTETQPIPTNNSFQTSGYTLD-GPCEVWL  136
            +  L+A    + L  + + + F  +CG + PK + QPIP +     S   +  GPCE+WL
Sbjct  66   FQKLKAANKFKDLKTLMDTSAFGAKCGFSDPKGKPQPIPKDGKATFSRAIVHTGPCEIWL  125

Query  137  DDTKVSAGRNCHTEFP------QGQHQVDYSSC--GESCTLSWYWLGIKYVEGIYSWQVY  188
            D+ KV    +C++++       +    VDYSSC  G    + +YWL  + V G   WQ Y
Sbjct  126  DNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSY  185

Query  189  KNCVGL  194
            KNC+ L
Sbjct  186  KNCIPL  191

>SPRG_19916
Length=305

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 66/142 (46%), Gaps = 25/142 (18%)

Query  65   VNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------  118
             N +   +++  Q  + +LR MLD +           +CG T      + IPTN      
Sbjct  58   TNVANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQ  108

Query  119  NSFQTSGYTLD--GPCEVWLDDTKVSAGRNCHTEF---PQGQHQVDYSSC-GESCTLSWY  172
            N     G+     GPCEVW+DD +V    +C T F   P     +DYSSC G+ C L +Y
Sbjct  109  NPDTGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFY  168

Query  173  WLGIKYVEGIYSWQVYKNCVGL  194
            WL +        WQVYKNCV L
Sbjct  169  WLALHEP----MWQVYKNCVPL  186

>PYVX_18179
Length=147

 Score = 69.3 bits (168),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)

Query  158  VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198
            VDYSSC  SCTL W+W+G++Y++G YSWQVYKNCV L T+A
Sbjct  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131

 Score = 37.7 bits (86),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  36  QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLD  88
           Q V  P P +  +  D     LA+L++QG  T  +  SW   +GY +LRA +D
Sbjct  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81

>PYAP_18138
Length=268

 Score = 71.6 bits (174),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 16/118 (14%)

Query  76   EQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPCEV  134
            +QHG   LR+ +D +         I ECG +      +PIP  N+       T  GPCE 
Sbjct  80   KQHGVKDLRSYIDAK---------ITECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEF  130

Query  135  WLDDTKVSAGRNCHTEFPQGQH-QVDYSSC-GESCTLSWYWLGIKYVEGIYSWQVYKN  190
            W+DDT+V    +C   F +     +DYS C G++C L +YWLG++  +    WQVY+N
Sbjct  131  WIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGLQNSD----WQVYRN  184

>PHYSO_374518
Length=116

 Score = 68.6 bits (166),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 55/105 (52%), Gaps = 10/105 (10%)

Query  100  IFECGLTSPKTETQPIPTNNSFQ--TSGYTLDGPCEVWLDDTKVSAGRNCHTEFP---QG  154
            I ECG T  K   QP+P++   Q  T G +  GPCE+W DDT+V    NC  E+      
Sbjct  5    ISECGNTEKKGLAQPVPSDGYAQHDTLGSSHPGPCEIWCDDTRVFHNTNCAQEYAGEVPT  64

Query  155  QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL-GTAA  198
            +  +D S+C  S    +YWL +        WQVY NCV L GTAA
Sbjct  65   KLPIDVSTCKASSEFVFYWLALH----AQPWQVYINCVALDGTAA  105

>SDRG_08782
Length=450

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 79/177 (45%), Gaps = 32/177 (18%)

Query  37   VVQHPPPFFIVDGLDFQGMALAYLQEQG-------VNTSIEAQSWMEQHGYTSLRAMLDD  89
            +V +PP  F  D +  + +A       G        N +   +++  Q  + +LR MLD 
Sbjct  22   IVSNPPAEFRSDVMRTKYVATIQANFPGKFDDSPQTNVANFNKAFKAQSQFKTLRDMLDP  81

Query  90   ESLYQVTEEAIFECGLTSPKTETQPIPTN------NSFQTSGY--TLDGPCEVWLDDTKV  141
                        +CG T    + + IP N      N     G+  +  GPCEVW+D+ +V
Sbjct  82   HGP---------DCGYTLTNVDKKAIPGNGQMTWKNPDTGEGFIPSHKGPCEVWIDNERV  132

Query  142  SAGRNCHTEFPQGQH---QVDYSSCGES-CTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                +C T FPQ       VDYSSCG + C L +YWL +        WQVYKNCV L
Sbjct  133  FQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALHEPM----WQVYKNCVPL  185

>PHYSO_524101
Length=308

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 65/128 (51%), Gaps = 13/128 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--  128
             E   Y+SL+ +++D++   VT+ A   CG+  P    QP+P          + G+T   
Sbjct  73   FESSSYSSLKELINDKATITVTD-ATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTASH  131

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQ  186
            +GPCEVW DD +V    +C  ++     ++ Y   +C  S TL++YWL +       +WQ
Sbjct  132  EGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALHSS----TWQ  187

Query  187  VYKNCVGL  194
            VY NC  L
Sbjct  188  VYVNCAPL  195

>PHYSO_246676
Length=187

 Score = 69.7 bits (169),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 69/159 (43%), Gaps = 39/159 (25%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q+V  P P +  +    +   LA+L+ QG  T  +  +W +++GY +LR  +D ++ Y V
Sbjct  12   QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMD-KAKYDV  70

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155
            T  A F CG T PK   QPIP  N  +++GYT DG                         
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG-------------------------  105

Query  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                         L    L +  ++  YSW+VYK C+ L
Sbjct  106  -------------LVHASLVLDGMKNSYSWKVYKACIPL  131

>PITG_11936
Length=333

 Score = 72.0 bits (175),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 13/123 (11%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--DGPCE  133
            Y SL+  ++D ++  V E+   ECG T+P    QP+P      +     G+TL  +GPCE
Sbjct  78   YKSLKEFMND-NMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCE  136

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNC  191
            V+ D+T+V    NC   FP    ++  D+ +C  S  LS YW+ +       SWQVY NC
Sbjct  137  VYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALHSP----SWQVYINC  192

Query  192  VGL  194
              L
Sbjct  193  APL  195

>SPRG_07795
Length=335

 Score = 71.2 bits (173),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 60/123 (49%), Gaps = 15/123 (12%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS--GY--TLDGPCEVW  135
            + +L+A LD             +CG+T P    QP+P+   +     G+  +  GPCE+W
Sbjct  76   FKTLKAFLD-------AHPTGGDCGITDPNGPAQPLPSTVKWANGELGFISSHQGPCELW  128

Query  136  LDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLG  195
             D+T+V    NC   +P G   +D S C  +  L+  WL +   E    WQVYKNCV L 
Sbjct  129  CDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLS  184

Query  196  TAA  198
             AA
Sbjct  185  GAA  187

>CCA17179
Length=185

 Score = 69.3 bits (168),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 23/126 (18%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------NSFQTSGYTLD--GP  131
            + +LR  L D+  Y         CG T+P  + +PIP +      N     G+     GP
Sbjct  46   FQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHMGP  96

Query  132  CEVWLDDTKVSAGRNCHTEFPQGQHQ--VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYK  189
            CEVWL++ +V    NC   F     +  +D+S+C   C L ++WL +   +    WQVYK
Sbjct  97   CEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLALHEPQ----WQVYK  152

Query  190  NCVGLG  195
            NC+ + 
Sbjct  153  NCIPIA  158

>PHYRA_78161
Length=373

 Score = 71.6 bits (174),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 13/125 (10%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--DGPCE  133
            Y+SL+  ++D++   VT  A   CG   PK E QP+P +    +   + G+T   +GPCE
Sbjct  76   YSSLKEFINDKATVTVTG-ATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCE  134

Query  134  VWLDDTKVSAGRNCHTEFPQ--GQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNC  191
            VW DD +     +C   +P    Q   D  +C  S TL++YW+ +       +WQVY NC
Sbjct  135  VWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAMHSS----TWQVYVNC  190

Query  192  VGLGT  196
              L +
Sbjct  191  APLAS  195

>PPTG_04620
Length=342

 Score = 71.2 bits (173),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query  76   EQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDGPCE  133
            + +    +R M+D D  LY        +CG T PK T   P  T ++  + G    GPCE
Sbjct  74   KSNNVKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPSTGDATFSRGIVHAGPCE  127

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGE-SCTLSWYWLGIKYVEGIYSW  185
            +WLDD  V    +C + +  G  +       +DYSSC    C   +YWL ++  +    W
Sbjct  128  IWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTLW  187

Query  186  QVYKNCVGL  194
            QVYKNC+ L
Sbjct  188  QVYKNCIPL  196

>PYIW_21964
Length=265

 Score = 70.5 bits (171),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (51%), Gaps = 14/128 (11%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTLD-  129
            ++   Y S+RA++DD++++   +EA  ECG+TSP    QP+P      +   + G+T   
Sbjct  77   LKASTYKSMRALVDDKAVF--IKEANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSH  134

Query  130  -GPCEVWLDDTKVSAGRNCHTEFPQGQHQ--VDYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
             GPCEVW DD       NC  ++     +  +D++ C  +  L   WL +       +WQ
Sbjct  135  QGPCEVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALHS----STWQ  190

Query  187  VYKNCVGL  194
            +Y NC  L
Sbjct  191  IYINCAPL  198

>CCI47381
Length=211

 Score = 69.7 bits (169),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 60/126 (48%), Gaps = 23/126 (18%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSF------QTSGYTLD--GP  131
            + +LR  L D+  Y         CG T+P    +PIP +N+          G+     GP
Sbjct  72   FRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGP  122

Query  132  CEVWLDDTKVSAGRNCHTEFPQGQHQ--VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYK  189
            CEVWL +T+V    NC   F     +  +++SSC   C L ++WL +   +    WQVYK
Sbjct  123  CEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVYK  178

Query  190  NCVGLG  195
            NC+ + 
Sbjct  179  NCIPIA  184

>PHYRA_79140
Length=424

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 56/112 (50%), Gaps = 17/112 (15%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T      QPIP++   +       G+T  GPCE++LDDT V    NC  ++P G  
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                     VDYSSC   CTL+ YWL  +  +    WQ Y NCV L  + +A
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPLSGSGSA  192

>SPRG_07627
Length=536

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 67/135 (50%), Gaps = 25/135 (19%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------NSFQTSG  125
            +++  Q  Y +LR +LD             +CG T P    + IP++      N     G
Sbjct  62   KAFAAQTQYKTLRDLLDLHGP---------DCGNTLPNVAAKAIPSDGKMTWKNPDTGEG  112

Query  126  Y--TLDGPCEVWLDDTKVSAGRNCHTEF---PQGQHQVDYSSCGES-CTLSWYWLGIKYV  179
            +  +  GPCE+WLD T+V    +C T F   P+ +  VDY+ CG + C L +YWL +   
Sbjct  113  FIPSHTGPCEIWLDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALHQP  172

Query  180  EGIYSWQVYKNCVGL  194
            +    WQVYKNCV L
Sbjct  173  Q----WQVYKNCVPL  183

>SPRG_22161
Length=300

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 65/135 (48%), Gaps = 25/135 (19%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------NSFQTSG  125
            +++  Q  + +LR MLD +           +CG T      + IPTN      N     G
Sbjct  65   KAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQNPDTGEG  115

Query  126  Y--TLDGPCEVWLDDTKVSAGRNCHTEF---PQGQHQVDYSSCGES-CTLSWYWLGIKYV  179
            +  +  GPCEVW+D+ +V    +C T F   P     VDYSSCG + C L +YWL +   
Sbjct  116  FIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLALHEP  175

Query  180  EGIYSWQVYKNCVGL  194
                 WQVYKNCV L
Sbjct  176  ----MWQVYKNCVPL  186

>PYU1_G005324
Length=191

 Score = 68.9 bits (167),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 61/123 (50%), Gaps = 13/123 (11%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPCEVW  135
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  136  LDDTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            L +T+     +C   F      ++D+S+C  +C L +YWLG++  +G   WQ YKNCV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

Query  195  GTA  197
             ++
Sbjct  176  KSS  178

>PYU1_G005326
Length=191

 Score = 68.9 bits (167),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 61/123 (50%), Gaps = 13/123 (11%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPCEVW  135
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  136  LDDTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            L +T+     +C   F      ++D+S+C  +C L +YWLG++  +G   WQ YKNCV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

Query  195  GTA  197
             ++
Sbjct  176  KSS  178

>PYU1_G005328
Length=191

 Score = 68.9 bits (167),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 61/123 (50%), Gaps = 13/123 (11%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPCEVW  135
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  136  LDDTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            L +T+     +C   F      ++D+S+C  +C L +YWLG++  +G   WQ YKNCV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

Query  195  GTA  197
             ++
Sbjct  176  KSS  178

>PHYKE_6079
Length=302

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 67/130 (52%), Gaps = 13/130 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--  128
             +   YTSL+ +++D +   VT+ A   CG   P    QP+P      +   + G+T   
Sbjct  74   FDSSKYTSLKELINDLATITVTD-ATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSH  132

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
            +GPCEVW DD +V   ++C  ++     ++  D+ +C  + TL++YWL +       +WQ
Sbjct  133  EGPCEVWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLALHSS----TWQ  188

Query  187  VYKNCVGLGT  196
            VY NC  L T
Sbjct  189  VYVNCAPLET  198

>PYVX_21297
Length=263

 Score = 70.1 bits (170),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 8/106 (8%)

Query  92   LYQVTEEAIFECGLTSPKTETQPIPTNN--SFQTSGYTLDGPCEVWLDDTKVSAGRNCHT  149
            +  +   A   CG T      QP+P++   +F  S   + GPCEVWLDDTKV++  +C +
Sbjct  56   IRDLANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHI-GPCEVWLDDTKVASANDCWS  114

Query  150  EFPQGQHQVDYSSC-GESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
             +      +DYS C G SC L W WL          W+++ NCV +
Sbjct  115  TYADKTIPIDYSVCTGSSCQLRWVWLATHNDP----WEIFDNCVNV  156

>PYVX_20783
Length=276

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 61/127 (48%), Gaps = 18/127 (14%)

Query  74   WMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ--TSGYTLDGP  131
            W   +G +SL+        Y  T  +  ECG T      QP+P++   Q  T G +  GP
Sbjct  69   WFTANGISSLKE-------YITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGP  121

Query  132  CEVWLDDTKVSAGRNCHTEFPQGQH----QVDYSSCGESCTLSWYWLGIKYVEGIYSWQV  187
            CE+W DDT+V    NC TEF  GQ      +D ++C  S    +YWL +        WQV
Sbjct  122  CEIWCDDTRVFTSTNCVTEF-SGQSPAKIPIDVATCTGSSEFVFYWLALH----AQPWQV  176

Query  188  YKNCVGL  194
            Y NCV L
Sbjct  177  YINCVAL  183

>SDRG_15426
Length=523

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 66/135 (49%), Gaps = 25/135 (19%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN------NSFQTSG  125
            +++  Q  Y +LR +LD             +CG T      +PIP++      N     G
Sbjct  38   KAFAAQSQYKTLRDLLDLSGP---------DCGNTRTNVAPKPIPSDGMMTWQNPDTGEG  88

Query  126  Y--TLDGPCEVWLDDTKVSAGRNCHTEF---PQGQHQVDYSSCGES-CTLSWYWLGIKYV  179
            +  +  GPCE+WLD+ +V    NC T F   P  +  VDY+ CG + C L +YWL +   
Sbjct  89   FIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLALHQP  148

Query  180  EGIYSWQVYKNCVGL  194
            +    WQVYKNCV L
Sbjct  149  Q----WQVYKNCVPL  159

>PPTG_07520
Length=294

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 53/106 (50%), Gaps = 17/106 (16%)

Query  102  ECGLTSPKTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSAGRNCHTEF---PQ  153
            +CG T    + QPIP +        +  G+T  GPCE++LDD  V  G +C  EF   P 
Sbjct  83   KCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPN  142

Query  154  GQHQ-----VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            G  Q     VD+SSC   C L+ YWL  +  +    WQ Y NCV L
Sbjct  143  GSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PHYRA_73582
Length=326

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 16/126 (13%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEVWL  136
            + Y  L+ ++D     +       +CG T P       PT+ +   S G    GPCE+WL
Sbjct  74   NNYKDLKTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWL  126

Query  137  DDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGES-CTLSWYWLGIKYVEGIYSWQVY  188
            DD  V    +C + +  G  +       VDYS C    C L +YWL ++ ++G   WQ Y
Sbjct  127  DDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSY  186

Query  189  KNCVGL  194
            KNC+ L
Sbjct  187  KNCIPL  192

>PYAR_14260
Length=212

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 13/120 (11%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPCEVWL  136
             G+ +LR+ L+ +            CG +    + +PIP++   +  S     GPCE+WL
Sbjct  44   KGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDGMVKFASTLEHPGPCEIWL  94

Query  137  DDTKVSAGRNCHTEFPQGQH-QVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLG  195
            D+T      +C  +F      +V++S+C  SC L +YWLG++  +    WQ YKNCV LG
Sbjct  95   DETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPLG  152

>PPTG_07516
Length=294

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 53/106 (50%), Gaps = 17/106 (16%)

Query  102  ECGLTSPKTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSAGRNCHTEF---PQ  153
            +CG T    + QPIP +        +  G+T  GPCE++LDD  V  G +C  EF   P 
Sbjct  83   KCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPN  142

Query  154  GQHQ-----VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            G  Q     VD+SSC   C L+ YWL  +  +    WQ Y NCV L
Sbjct  143  GSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PHYKE_2454
Length=374

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 60/122 (49%), Gaps = 12/122 (10%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN---NSFQTSGYTL--DGPCEV  134
            Y SL+A++DD++   V+  A   CG   P    QP+P+    +   + G+T   +GPCE 
Sbjct  76   YKSLKALIDDKAKITVSG-ATLTCGSADPSAAAQPLPSTLEWSHSDSEGFTPSHEGPCEA  134

Query  135  WLDDTKVSAGRNCHTEFPQGQHQVDYSSCGES--CTLSWYWLGIKYVEGIYSWQVYKNCV  192
            W DD +V    NC   FP    ++ Y S   S    L +YW+ +       SWQVY NC 
Sbjct  135  WCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMHGP----SWQVYVNCA  190

Query  193  GL  194
             L
Sbjct  191  AL  192

>PITG_04947
Length=298

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query  76   EQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPK-TETQPIPTNNSFQTSGYTLDGPCE  133
            + +    +R M+D D  LY        +CG T PK T   P  T ++  + G    GPCE
Sbjct  47   KSNNIKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPTTGDATFSRGIVHAGPCE  100

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQ-------VDYSSCGE-SCTLSWYWLGIKYVEGIYSW  185
            +WLDD  V    +C + +  G  +       +DYSSC    C   +YWL ++  +    W
Sbjct  101  IWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLW  160

Query  186  QVYKNCVGL  194
            QVYKNC+ L
Sbjct  161  QVYKNCIPL  169

>PHYSO_246481
Length=318

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 13/128 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTLD-  129
             E   YTSL+ +++D++   VT+ A   CG   P    QP+P      +   T G++   
Sbjct  74   FEASSYTSLKELINDKATITVTD-ATLTCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSH  132

Query  130  -GPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
             GPCEVW DD +V    +C  ++     ++  D  +C  + TL++YWL +       +WQ
Sbjct  133  AGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALHSS----TWQ  188

Query  187  VYKNCVGL  194
            VY NC  L
Sbjct  189  VYINCAPL  196

>PHYRA_83494
Length=224

 Score = 68.6 bits (166),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 51/106 (48%), Gaps = 17/106 (16%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T      Q +PT+   +       G+T  GPCE+++DD  V  G NC  ++P G  
Sbjct  22   KCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDV  81

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                     VDYSSC   CT + YWL  +  +    WQ Y NCV L
Sbjct  82   GSTVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPL  123

>PYAP_19712
Length=276

 Score = 69.3 bits (168),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 10/97 (10%)

Query  102  ECGLTSPKTETQPIPTNNSFQ---TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQV  158
            +CG T P    QPIP +   Q   T+ +   GPCE+WLD   V++ + C  E+P  + +V
Sbjct  71   KCGKTDPNGAVQPIPADGYVQLQITAAHI--GPCELWLDGEMVASAKQCVKEYPDRKIKV  128

Query  159  DYSSCGES-CTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            D+S C  S C L W WL          W++Y NCV +
Sbjct  129  DFSKCKSSKCQLRWVWLATHN----SPWEIYDNCVTV  161

>PYAP_24691
Length=145

 Score = 67.0 bits (162),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query  130  GPCEVWLDDTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVY  188
            GPCE+W D+T+V    +C   F    Q ++DYS C  +C L +YWLG++  +G   WQ Y
Sbjct  5    GPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQSY  62

Query  189  KNCVGLGTAA  198
            KNCV +G   
Sbjct  63   KNCVPIGNGK  72

>PYIR_17978
Length=250

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 11/131 (8%)

Query  75   MEQHGYTSLRAM-LDDESLYQVTEE---AIFECGLTSPKTET-QPIPTNNSFQTSGYTLD  129
             ++  Y SLR   + ++ + Q  +    +  ECG T+P  +T QP+P N  +   G    
Sbjct  77   FKKSKYKSLREFFMKNQDMSQGVKSGNPSTAECGFTAPDKQTAQPLPDNIEWYGGGQNHP  136

Query  130  GPCEVWLDDTKV-SAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVY  188
            GPCE W D+  V     NC   FP+G    D + C     LS+YW+       +  WQVY
Sbjct  137  GPCEAWCDNEIVLPFTANCQAAFPKGIMAYDKAKCVGKNRLSFYWMAT-----LNQWQVY  191

Query  189  KNCVGLGTAAT  199
             +CV +G  A 
Sbjct  192  IDCVKIGNGAA  202

>PYU1_G005325
Length=207

 Score = 68.2 bits (165),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 59/120 (49%), Gaps = 13/120 (11%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPCEVW  135
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  136  LDDTKVSAGRNCHTEFPQG-QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            L +T+     +C   F      ++D+S+C  +C L +YWLG++  +G   WQ YKNC+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCIPL  175

>PHYCA_112615
Length=196

 Score = 67.8 bits (164),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 59/114 (52%), Gaps = 19/114 (17%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-GPCEVWL  136
            + +  L+ ++DD S+Y        +CG T P  + QPIP++     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWL  126

Query  137  DDTKVSAGRNCHTEFPQGQHQVDYSSC--GESCTLSWYWLGIKYVEGIYSWQVY  188
            DDTK     +  + FP     VDYSSC  G    + +YWL  + V+G   WQ Y
Sbjct  127  DDTK-----DIKSIFP-----VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  170

>PHYRA_78626
Length=473

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 0/55 (0%)

Query  146  NCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            NCH        ++DYS CG+SC L WYWLG +Y++G YSWQVYK C+ L + + A
Sbjct  350  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGSGA  404

>PHYRA_78625
Length=434

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 0/55 (0%)

Query  146  NCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
            NCH        ++DYS CG+SC L WYWLG +Y++G YSWQVYK C+ L + + A
Sbjct  311  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGSGA  365

>PHYRA_83500
Length=394

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 55/112 (49%), Gaps = 17/112 (15%)

Query  102  ECGLTSPKTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG--  154
            +CG T      QPIP++   +       G+T  GPCE++LDDT V    NC  ++P G  
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  155  ------QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                     VDYSSC   CTL+ YWL  +  +    WQ Y NC  L  + +A
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPLSGSGSA  192

>PHYCA_19598
Length=390

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 13/123 (11%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--DGPCE  133
            Y SL+ +  D++   V+  A   CG   PK E QP+P +    +   + G+T   +GPCE
Sbjct  76   YKSLKDLFTDKAKITVSG-ATLTCGSCDPKEEPQPMPESIVEWSHSDSEGFTPSHEGPCE  134

Query  134  VWLDDTKVSAGRNCHTEFPQ--GQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNC  191
            VW DD +     NC T FP    +   D  +C  + TL++YW+ +       +WQVY NC
Sbjct  135  VWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMHS----DTWQVYVNC  190

Query  192  VGL  194
              L
Sbjct  191  APL  193

>PHYRA_78174
Length=279

 Score = 68.9 bits (167),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 16/138 (12%)

Query  66   NTSIEAQSWMEQHGYTSLRAMLDDESLYQVTE-EAIFECGLTSPKTETQPIP------TN  118
            NT+  A+ + E   YTSL+ M+ D  L +VT  +   ECG T+P    QP+P       +
Sbjct  64   NTAAFAKGF-EASKYTSLKEMVSD--LGKVTSADFTMECGYTNPDETAQPLPKTYVEWAH  120

Query  119  NSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGI  176
             S +    + +GPCEVW DD +V    +C   +     +V  D+ +C  +  L++YWL +
Sbjct  121  GSGEGFTSSHEGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLAL  180

Query  177  KYVEGIYSWQVYKNCVGL  194
                   +WQVY NC  L
Sbjct  181  HSS----TWQVYTNCAAL  194

>PHYCA_69583
Length=224

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query  76   EQHGY-TSLRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPC  132
            ++ GY  ++R +LD D +LY         CG ++P  + +  P++ +     G    GPC
Sbjct  73   KEAGYANNIRKLLDSDTNLYGA------NCGFSNPDAKAKDPPSDGTATFERGLAHHGPC  126

Query  133  EVWLDDTKVSAGRNCHTEFPQGQHQ--------VDYSSCGES-CTLSWYWLGIK-YVEGI  182
            E+WLDD  V    +C   F    +         +DYSSC  S C   +YWL  +    G 
Sbjct  127  EIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGK  186

Query  183  YSWQVYKNCVGL  194
            Y WQ+YK+C+ L
Sbjct  187  YVWQIYKDCIPL  198

>PYVX_24563
Length=254

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 65/129 (50%), Gaps = 29/129 (22%)

Query  79   GYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN--------NSFQTSGY--TL  128
            GYTSLRAM+D         E++ +CG T  +T+  P+           N  +  G+  + 
Sbjct  77   GYTSLRAMID---------ESVSDCGNT--RTDVSPVDMTGKKVLHWQNDQEGVGFVSSH  125

Query  129  DGPCEVWLDDTKVSAGRNC---HTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSW  185
             GPCEVW+DD  V+   +C   +T +P      D+S C  SCTL +YWL +       +W
Sbjct  126  HGPCEVWIDDVMVTHQDDCRAVYTSYP-ANVDADFSKCSGSCTLRFYWLALHEP----NW  180

Query  186  QVYKNCVGL  194
            Q+YK C  +
Sbjct  181  QIYKQCAPI  189

>PHYKE_6078
Length=317

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 64/130 (49%), Gaps = 13/130 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--  128
             E   Y+SL+  ++D++   VT+ A   CG   P    Q +P          + G+T   
Sbjct  73   FESSSYSSLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWAHSDSEGFTASH  131

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
            +GPCEVW DDT+V    +C  ++     Q+  D+ +C  S T++ YWL +       +WQ
Sbjct  132  EGPCEVWCDDTRVFQDDDCAADYTTAPAQLPFDHDACLGSSTVTLYWLALHSS----TWQ  187

Query  187  VYKNCVGLGT  196
            VY NC  L T
Sbjct  188  VYVNCAPLET  197

>PITG_08892
Length=309

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 9/121 (7%)

Query  75   MEQHGYTSLRAML-DDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCE  133
            +   G  SL A++  ++ LY  + E   +CGLT+ K   +     +  + +G+T  GPCE
Sbjct  74   LATKGGGSLGALIAKNQKLY--SSEVDPDCGLTTFKDSARSKLPASQLEYTGFTHPGPCE  131

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNC  191
            VW DDTKV    +C T+FP    ++  D S C ++  L+ YWL +   +    WQVY +C
Sbjct  132  VWCDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVHGEQ----WQVYSDC  187

Query  192  V  192
            V
Sbjct  188  V  188

>PYIW_18792
Length=125

 Score = 65.5 bits (158),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

Query  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95
            Q V  P P + V     Q   LA+L+ QG   + +  ++ +  GY +LR  +DD+  Y+V
Sbjct  25   QYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKV  84

Query  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGP  131
             +   FECG +S K   QPIP   + +++GYT DGP
Sbjct  85   -DGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGP  119

>PYU1_G001527
Length=278

 Score = 68.6 bits (166),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 18/129 (14%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP--------TNNSFQTSGYTL  128
            Q  Y S+RA++D + ++Q       ECG+TSP  E QP+P        +N+   T  +T 
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT-  136

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
             GPCEVW D+    +  NC T +P    ++  D S C     L +YWL +       +WQ
Sbjct  137  -GPCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHS----STWQ  191

Query  187  VYKNCVGLG  195
             Y  C  L 
Sbjct  192  AYIACAPLA  200

>PYU1_G001523
Length=278

 Score = 68.6 bits (166),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 18/129 (14%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP--------TNNSFQTSGYTL  128
            Q  Y S+RA++D + ++Q       ECG+TSP  E QP+P        +N+   T  +T 
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT-  136

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
             GPCEVW D+    +  NC T +P    ++  D S C     L +YWL +       +WQ
Sbjct  137  -GPCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHS----STWQ  191

Query  187  VYKNCVGLG  195
             Y  C  L 
Sbjct  192  AYIACAPLA  200

>PHYKE_5749
Length=300

 Score = 68.6 bits (166),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 52/105 (50%), Gaps = 17/105 (16%)

Query  103  CGLTSPKTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSAGRNCHTEF---PQG  154
            CG T P  + QPIP++        +  G+T  GPCE++LDD  V    +C  EF   P G
Sbjct  87   CGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVLHSDDCEDEFKGGPVG  146

Query  155  QHQ-----VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
              Q     VDYSSC   C  + YWL  +  +    WQ Y NCV L
Sbjct  147  STQTSDMPVDYSSCNGKCLFTIYWLAFQNAQ----WQTYINCVPL  187

>PPTG_03153
Length=314

 Score = 68.6 bits (166),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 12/127 (9%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSF---QTSGYTL--D  129
             E   Y SL+A++DD++   +   A   CG+  PK   QP+P    +   ++ G+T   +
Sbjct  70   FESSKYKSLKAVIDDKAKI-IVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHE  128

Query  130  GPCEVWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQV  187
            GPCEVW D  +V    NC   +     ++ Y  S C  +  L+ YW+ +       SWQV
Sbjct  129  GPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAMHGP----SWQV  184

Query  188  YKNCVGL  194
            Y NC  L
Sbjct  185  YVNCAPL  191

>PYAR_24818
Length=198

 Score = 67.0 bits (162),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 71/144 (49%), Gaps = 11/144 (8%)

Query  54   GMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQ  113
            GM+  Y  EQ  NT+   +++  Q  YTS+R M+ D+  ++    A  ECG ++     Q
Sbjct  54   GMSFGYGHEQ--NTAAFLKAYKSQSKYTSIRQMIYDK--FRPDGGATKECGRSAMTGPPQ  109

Query  114  PIPTNNSFQTS-GYTLDGPCEVWLDDTKVSAGRNCHTEFPQ--GQHQVDYSSCGESCTLS  170
             +P    ++T    T  GPCEVW DD +V    NC  ++PQ  G+   D + C  +  L 
Sbjct  110  DLPDFVEYETGFDSTHWGPCEVWCDDKRVFYEDNCAVKYPQKPGKLPYDKAQCRGAKRLQ  169

Query  171  WYWLGIKYVEGIYSWQVYKNCVGL  194
             +WL +     +  WQ Y +C  L
Sbjct  170  SFWLALH----VPDWQAYISCATL  189

>SDRG_17317
Length=122

 Score = 65.1 bits (157),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 40/69 (58%), Gaps = 8/69 (12%)

Query  130  GPCEVWLDDTKVSAGRNCHTEF---PQGQHQVDYSSC-GESCTLSWYWLGIKYVEGIYSW  185
            GPCEVWLDD +V    +C T F   P     +DYSSC G+ C L +YWL +        W
Sbjct  44   GPCEVWLDDKRVFQNDDCATNFPAKPAAHLPIDYSSCSGDGCMLRFYWLALHEP----MW  99

Query  186  QVYKNCVGL  194
            QVYKNCV L
Sbjct  100  QVYKNCVPL  108

>PYIW_19601
Length=241

 Score = 67.8 bits (164),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 67/142 (47%), Gaps = 18/142 (13%)

Query  71   AQSWMEQHG-------YTSLRA-MLDDESL---YQVTEEAIFECGLTSPKTET-QPIPTN  118
            + SW E  G       Y SLR  M+ ++++    +    +  ECG T+P+ +T Q +P N
Sbjct  55   SNSWAEVFGKAFKKSSYKSLREFMMKNQNMNGGVKSGNPSTKECGFTAPEKQTAQALPDN  114

Query  119  NSFQTSGYTLDGPCEVWLDDTKV-SAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIK  177
              +   G    GPCE W D+  V     NC   FP+G  + D + C     LS+YW+   
Sbjct  115  IEWYGGGMNHPGPCEAWCDNELVLPFTDNCQQTFPKGVMKYDKAKCVGKNQLSFYWMAT-  173

Query  178  YVEGIYSWQVYKNCVGLGTAAT  199
                +  WQVY +CV +G  A 
Sbjct  174  ----LNQWQVYIDCVKIGNGAA  191

>PYIW_15526
Length=256

 Score = 67.8 bits (164),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 71/153 (46%), Gaps = 26/153 (17%)

Query  52   FQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTE  111
            F G       EQ  N +    +W  + GYTSL+ MLD         +++  CG T+P   
Sbjct  52   FSGRIFNRSPEQ--NAAEFTAAW-PKTGYTSLKEMLD---------KSVSGCGYTNPNAA  99

Query  112  TQPIPTNNS--FQTSGY------TLDGPCEVWLDDTKVSAGRNCHTEFP--QGQHQVDYS  161
               +    S  +Q + Y      +  GPCE W+D+TK+    +C   +P       VDYS
Sbjct  100  PVDVSGLKSMKYQNNEYKEGFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYS  159

Query  162  SCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
             C  +C L++YWL +   +    WQVYK CV +
Sbjct  160  VCKGTCRLTFYWLAVHSPK----WQVYKGCVAI  188

>H257_11264
Length=282

 Score = 68.2 bits (165),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 80/181 (44%), Gaps = 27/181 (15%)

Query  30   AGLGEGQVVQHPPPFFIVDGLD---FQGMALAYLQEQGVN-------TSIEAQSWMEQHG  79
            A L  G +V  P P F+  G D   + G     +   G N        +IE    +++  
Sbjct  20   ATLAHGYLVD-PQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIEFTRQLKKSS  78

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ----TSGYTL--DGPCE  133
            + SLRA +D +           ECGLT      + +P+++  +    + G+ L  +GPCE
Sbjct  79   FASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCE  132

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVG  193
            +W D T+V    NC    P G   ++ S C  S  L   WL +   +    WQVYKNCV 
Sbjct  133  LWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ----WQVYKNCVR  188

Query  194  L  194
            L
Sbjct  189  L  189

>PHYKE_1913
Length=280

 Score = 67.8 bits (164),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 17/105 (16%)

Query  103  CGLTSPKTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQG---  154
            CG T    + +P+P++           G+T  GPCEV+++D  V  G +C  E+P G   
Sbjct  86   CGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVLHGDDCEDEYPGGPDG  145

Query  155  -----QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                 +  +DYSSC   CTL+ YWL  +  +    WQ Y NCV L
Sbjct  146  SNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQAYINCVPL  186

>PPTG_04803
Length=268

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 51/101 (50%), Gaps = 11/101 (11%)

Query  100  IFECGLTSPKTETQPIPTNNSFQ--TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQH-  156
            I ECG T  K   QP+P++   Q  T G +  GPCE+W DDT+V    NC   F  GQ  
Sbjct  89   ISECGNTEKKGTAQPVPSDGYAQHDTLGNSHPGPCEIWCDDTRVFHDTNCVVTF-SGQSP  147

Query  157  ---QVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                +D S+C  S    +YWL +        WQVY NCV L
Sbjct  148  AKIPIDVSTCKSSSEFVFYWLALH----AQPWQVYINCVAL  184

>PYAP_18221
Length=226

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 72/159 (45%), Gaps = 28/159 (18%)

Query  52   FQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTE  111
            FQG       EQ      +A    +Q G  SLR ++D         + +  CG T+P T 
Sbjct  56   FQGKPFNRSPEQNTQVFTDA---FKQSGLKSLRELMD---------KYVPGCGNTNPNTT  103

Query  112  TQPIPT-------NNSFQTSGY--TLDGPCEVWLDDTKVSAGRNCHTEFPQ--GQHQVDY  160
             + +         NN ++  G+  +  GPCEVW+D+T+V    +C   +        VDY
Sbjct  104  PRDVTKLKTMTYQNNEYK-EGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYPAALPVDY  162

Query  161  SSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAAT  199
            S C  +C L++YWL +   +    WQ YK CV +   A+
Sbjct  163  SKCKGTCRLTFYWLALHSQK----WQAYKQCVPIKYGAS  197

>PHYCA_132255
Length=128

 Score = 64.7 bits (156),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 54/107 (50%), Gaps = 11/107 (10%)

Query  100  IFECGLTSPKTETQPIPTNN--SFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ--  155
            I ECG T      QP+PT+      + G +  GPCE+W DDT+V    NC  E+  GQ  
Sbjct  5    IPECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEY-AGQVP  63

Query  156  --HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                +D  +C  S  L +YWL ++       WQVY NCV L  +A A
Sbjct  64   TSLPIDLDTCKSSSELVFYWLSLQGAP----WQVYINCVKLDGSAAA  106

>PHYCA_120062
Length=212

 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 54/107 (50%), Gaps = 11/107 (10%)

Query  100  IFECGLTSPKTETQPIPTNN--SFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ--  155
            I ECG T      QP+PT+      + G +  GPCE+W DDT+V    NC  E+  GQ  
Sbjct  37   IPECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEY-AGQVP  95

Query  156  --HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200
                +D  +C  S  L +YWL +     +  WQVY NCV L  +A A
Sbjct  96   TSLPIDLDTCKSSSELVFYWLALH----VQPWQVYINCVTLDGSAAA  138

>PYU1_G001526
Length=334

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 18/129 (14%)

Query  77   QHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP--------TNNSFQTSGYTL  128
            Q  Y S+RA++D + ++Q       ECG+TSP  E QP+P        +N+   T  +T 
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT-  136

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
             GPCEVW D+    +  NC T +P    ++  D S C     L +YWL +       +WQ
Sbjct  137  -GPCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHS----STWQ  191

Query  187  VYKNCVGLG  195
             Y  C  L 
Sbjct  192  AYIACAPLA  200

>SPRG_07797
Length=318

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 59/123 (48%), Gaps = 15/123 (12%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS--GY--TLDGPCEVW  135
            + +L+A LD          +  +CG+T      QP+P+   +     G+  +  GPCE+W
Sbjct  76   FKTLKAFLD-------AHPSGGDCGITDANGPAQPLPSTVKWANGQEGFISSHQGPCELW  128

Query  136  LDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLG  195
             D+ +V    NC   +P G   +D S C  +  L+  WL +   +    WQVYKNCV L 
Sbjct  129  CDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALHSPQ----WQVYKNCVNLS  184

Query  196  TAA  198
             AA
Sbjct  185  GAA  187

>PHYKE_2379
Length=285

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 64/132 (48%), Gaps = 16/132 (12%)

Query  74   WMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNN--SFQTSGYTLDGP  131
            W  ++G +SL+  +   + Y      I ECG T      + IP++      T G +  GP
Sbjct  70   WFTKNGISSLKEYI---TTYGTN---ISECGNTLKDGTAEAIPSDGYAEHDTLGNSHPGP  123

Query  132  CEVWLDDTKVSAGRNCHTEF---PQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVY  188
            CE+W DDT+V    NC TEF      +  +D S+C  S    +YWL +        WQVY
Sbjct  124  CEIWCDDTRVFNNTNCVTEFSGQSPAKIPIDVSTCKASSEFVFYWLALH----AQPWQVY  179

Query  189  KNCVGL-GTAAT  199
             NCV L GT A+
Sbjct  180  INCVALDGTTAS  191

>PPTG_06256
Length=318

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 9/123 (7%)

Query  75   MEQHGYTSLRAML-DDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCE  133
            +   G  SL A++  ++ LY  + +   +CGLT+ K   +     +  + +G+T  GPCE
Sbjct  74   LPTKGGGSLGALIAKNQKLY--SSDVDPDCGLTTFKESARSKLPASQLEYTGFTHPGPCE  131

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQVYKNC  191
            VW DDTKV    +C T+FP    ++ Y  S C  +  L+ YWL +   +    WQVY +C
Sbjct  132  VWCDDTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAVHGEQ----WQVYSDC  187

Query  192  VGL  194
            V L
Sbjct  188  VWL  190

>PYU1_G006403
Length=252

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 53/106 (50%), Gaps = 12/106 (11%)

Query  103  CGLTS-PKTETQPIPTNNSF---QTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQV  158
            CG T   + +   +PT   F      G+T  GPCE+W DDTK+S   +C  ++P G   +
Sbjct  103  CGYTKLDEAKRSELPTEMKFGNGDVGGFTHPGPCELWCDDTKLSYDNDCAAKYPSGLVPI  162

Query  159  DYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV----GLGTAATA  200
            D S C  +   + YWL +        WQVY NCV    G G AATA
Sbjct  163  DTSKCANANQFTVYWLAVH----ASMWQVYTNCVYLTGGSGGAATA  204

>PHYKE_9024
Length=299

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 66/135 (49%), Gaps = 10/135 (7%)

Query  64   GVNTSIEA-QSWMEQHGYTSLRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSF  121
            GVN ++   +      GY SL A +  ++ LY    +A  +CGLT  K   +     +  
Sbjct  62   GVNGTLNFFKDTFPSKGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPASKL  119

Query  122  QTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQ--GQHQVDYSSCGESCTLSWYWLGIKYV  179
              SG+T  GPCEVW DDTKV    +C T++P        D S C  +  L+ YW+G+   
Sbjct  120  TYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGLHGD  179

Query  180  EGIYSWQVYKNCVGL  194
                 WQVY +CV L
Sbjct  180  P----WQVYTDCVWL  190

>SPRG_07825
Length=337

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 72/146 (49%), Gaps = 15/146 (10%)

Query  58   AYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTS-PKTETQPIP  116
            AY Q+ G N +  A ++ +   Y +L+A LD       T     +CG+T       QP+P
Sbjct  54   AYNQDPGYNAAQFAANF-KTSKYKTLKAFLDAWD----TSAQCGQCGITKVDAANPQPLP  108

Query  117  TNNSFQ---TSGYTL--DGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSW  171
            +   ++     G+T   +GPCE+W D+T+V    +C    P G   +D S C  +  L+ 
Sbjct  109  SIVKWRHGDNEGFTPSHEGPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTM  168

Query  172  YWLGIKYVEGIYSWQVYKNCVGLGTA  197
             W+ +   +    WQ YKNCV +G+A
Sbjct  169  LWMALHTPQ----WQAYKNCVAIGSA  190

>H257_11265
Length=282

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 80/181 (44%), Gaps = 27/181 (15%)

Query  30   AGLGEGQVVQHPPPFFIVDGLD---FQGMALAYLQEQGVNTSIEAQS-------WMEQHG  79
            A L  G +V  P P F+  G D   + G     +   G N ++  Q         +++  
Sbjct  20   ATLAHGYLVD-PQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIAFTRQLKKSS  78

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ----TSGYTL--DGPCE  133
            + SLRA +D +           ECGLT      + +P+++  +    + G+ L  +GPCE
Sbjct  79   FASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCE  132

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVG  193
            +W D T+V    NC    P G   ++ S C  S  L   WL +   +    WQVYKNCV 
Sbjct  133  LWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ----WQVYKNCVR  188

Query  194  L  194
            L
Sbjct  189  L  189

>PPTG_14221
Length=275

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query  72   QSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDG  130
            +S    + +  L+ ++DD S+Y        +CG T+P    QPIPT+     S      G
Sbjct  67   KSLKAANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHG  120

Query  131  PCEVWLDDTKVSAGRNCHTEFPQGQHQ------VDYSSC--GESCTLSWYWLGIKYVEGI  182
            PC +WLDD  V    +C  ++            VDYSSC  G    + +YWL  + +   
Sbjct  121  PCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKK  180

Query  183  YSWQVYKNCVGL  194
              WQ YK+C+ L
Sbjct  181  TVWQSYKDCIPL  192

>PHYRA_80631
Length=320

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query  64   GVNTSIEA-QSWMEQHGYTSLRAML-DDESLYQVTEEAIFECGLTSPKTETQPIPTNNSF  121
            GVN ++   ++     GY SL A +  ++ LY    +   +CGLT  K   +     +  
Sbjct  62   GVNGTLNFFKATFPDKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASKL  119

Query  122  QTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYV  179
              SG+T  GPCEVW DDTKV    +C T++P     + Y  S C ++  L+ YW+G+   
Sbjct  120  TYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGLHGD  179

Query  180  EGIYSWQVYKNCVGL  194
                 WQVY +CV L
Sbjct  180  P----WQVYTDCVWL  190

>PYVX_22508
Length=298

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 58/128 (45%), Gaps = 12/128 (9%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--  128
             E   YTSL+ M+ D      T      CGLT P    Q +P          T G+T   
Sbjct  58   FEASDYTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSSTEGFTASH  117

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
            +GPCE+W DDT+V    +C   +     Q+  D  +C  +  L++YWL +       +WQ
Sbjct  118  EGPCEIWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALHSS----TWQ  173

Query  187  VYKNCVGL  194
            VY NC  L
Sbjct  174  VYINCAAL  181

>PYIR_23585
Length=240

 Score = 66.2 bits (160),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 14/120 (12%)

Query  78   HGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLD-GPCEVWL  136
             G+ + RA L+              CG T      +PIP++N+ + S   +  GPCE+W+
Sbjct  69   KGFATTRAFLESRGP---------TCGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWI  119

Query  137  DDTKVSAGRNCHTEFPQG--QHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            D+T+V    +C   F       ++D+S+C  SC L +YWLG++  +G   +Q Y  C+ L
Sbjct  120  DNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGARFQSYSKCLAL  177

>PPTG_03138
Length=294

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 65/128 (51%), Gaps = 13/128 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--  128
             E   ++SL+ ++++++   V++ A   CG   P    QP+P          + G+T   
Sbjct  73   FESSSFSSLKELINEKATLTVSD-ATLTCGSCDPDETAQPLPDTYVEWAHSDSEGFTASH  131

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
            +GPCE+W DD +V  G +C  ++     ++  D+ +C  S  L++YWL +       +WQ
Sbjct  132  EGPCEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLALHSS----TWQ  187

Query  187  VYKNCVGL  194
            VY NC  L
Sbjct  188  VYVNCAPL  195

>PHYCA_15125
Length=334

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 62/120 (52%), Gaps = 9/120 (8%)

Query  78   HGYTSLRAML-DDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWL  136
             GY SL A +  ++ LY    +   +CGLT  K   +     +  + SG+T  GPCEVW 
Sbjct  114  KGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASELEYSGFTHTGPCEVWC  171

Query  137  DDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
            DDTKV    +C T++P    ++ Y  S C  +  L+ YW+G+        WQVY +CV L
Sbjct  172  DDTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGLHGD----PWQVYTDCVWL  227

>PHYCA_123316
Length=316

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 58/122 (48%), Gaps = 12/122 (10%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN---NSFQTSGYTL--DGPCEV  134
            Y+S++  + D+    V   A  ECGLT P    Q +P         T G+T   +GPCE 
Sbjct  78   YSSIKDFVTDKGQI-VANGATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHEGPCEA  136

Query  135  WLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV  192
            W DDT+V    NC   F     ++ Y  + C  S  L++YWL +       +WQ+Y NC 
Sbjct  137  WCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALHSS----TWQIYVNCA  192

Query  193  GL  194
             L
Sbjct  193  AL  194

>PYIW_24288
Length=201

 Score = 65.5 bits (158),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 64/146 (44%), Gaps = 14/146 (10%)

Query  57   LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIP  116
            + Y      N  +  +++  Q+ Y +LR ++D  +++    +   ECG TS     QP+P
Sbjct  62   MTYSSNGANNARVYERAFGNQNRYRNLRELVDFTAVFSAGADK--ECGFTSATGAKQPLP  119

Query  117  ------TNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCT  168
                   N   Q    T +GPCEVW D        NC   F     ++ Y  S C  +  
Sbjct  120  AQYVEWNNRVNQGLAPTHEGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKM  179

Query  169  LSWYWLGIKYVEGIYSWQVYKNCVGL  194
            L +YWL +   E    W+VY NCV L
Sbjct  180  LKFYWLSLDSRE----WEVYINCVPL  201

>PPTG_03156
Length=445

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 60/122 (49%), Gaps = 12/122 (10%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSF---QTSGYTL--DGPCEV  134
            Y SL+A +DD++   VT  A   CG   P    QP+P    +   ++ G+T   +GPCE 
Sbjct  76   YKSLKAFIDDKAKITVTG-ATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEA  134

Query  135  WLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV  192
            W D  +V    NC   F     ++ Y  S C  + TL++YW+ +       +WQVY NC 
Sbjct  135  WCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMHGP----TWQVYVNCA  190

Query  193  GL  194
             L
Sbjct  191  PL  192

>PHYSO_525076
Length=366

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 13/128 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTLD-  129
             E   YTSL+ +++D++   VT+ A   CG   P    QP+P      +   T G++   
Sbjct  74   FEASSYTSLKELINDKATITVTD-ATLTCGSCYPDETAQPLPDTYVEWSHSSTEGFSSSH  132

Query  130  -GPCEVWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQ  186
             GPCEVW DD +V    +C  ++     ++ Y   +C  + TL++YWL +       +WQ
Sbjct  133  AGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALHSS----TWQ  188

Query  187  VYKNCVGL  194
            VY NC  L
Sbjct  189  VYINCAPL  196

>PHYCA_19612
Length=610

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query  75   MEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--  128
             E   Y+SL+ +++D++   VT+ A   CG   P    Q +P          + G+T   
Sbjct  378  FESSSYSSLKELINDKATITVTD-ATLTCGACDPDETAQALPATYVEWAHSDSEGFTASH  436

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQGQHQV--DYSSCGESCTLSWYWLGIKYVEGIYSWQ  186
            +GPCEVW DD +V  G +C  ++      +  D+ +C  S  L++YWL +       +WQ
Sbjct  437  EGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLALHSS----TWQ  492

Query  187  VYKNCVGL  194
            VY NC  L
Sbjct  493  VYVNCAPL  500

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query  79   GYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN----NSFQTSGYTL--DGPC  132
             YTSL+ ++   +   VT+ A   CG  +P    QP+P      +   T G+T   +GPC
Sbjct  80   SYTSLKDLITSLATVTVTD-ATLTCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSHEGPC  138

Query  133  EVWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQVYKN  190
            EVW DD +V    +C  ++     ++ Y   +C  + TL++YWL +       +WQVY N
Sbjct  139  EVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALHSS----TWQVYVN  194

Query  191  CVGL  194
            C  L
Sbjct  195  CAPL  198

>HYAP_11923
Length=606

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 61/123 (50%), Gaps = 14/123 (11%)

Query  80   YTSLRAMLDDESLYQVTEE-AIFECGLTSPKTETQPIPTN---NSFQTSGYTL--DGPCE  133
            ++S++ +    SL Q+  + A  ECGLT P    QPIP     +   T G+T   +GPCE
Sbjct  79   FSSIKDLA--TSLGQIVAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGPCE  136

Query  134  VWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQVYKNC  191
             W DDT+V    NC   F     ++ Y  + C  +   ++YWL +       +WQVY NC
Sbjct  137  AWCDDTQVFQDENCAAHFTTAPAKMPYDKAKCSGASRFTFYWLALHS----STWQVYVNC  192

Query  192  VGL  194
              L
Sbjct  193  AAL  195

>PHYKE_6002
Length=197

 Score = 65.1 bits (157),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 16/119 (13%)

Query  76   EQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTS-GYTLDGPCEV  134
            + + +  L+ ++DD S+Y        +CG T P    QPIP++     S      GPCE+
Sbjct  71   KANNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEI  124

Query  135  WLDDTKVSAGRNCHT--EFPQGQHQVDYSSC--GESCTLSWYWLGIKYVEGIYSWQVYK  189
            WLD TK  +  NC     FP     VDYSSC  G    + +YWL  + ++    WQ Y+
Sbjct  125  WLDSTKAFSKDNCADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PYIW_24289
Length=196

 Score = 65.1 bits (157),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (50%), Gaps = 13/119 (11%)

Query  80   YTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTL--DGPCEVWLD  137
            Y +LR ++D ++++    +   ECG T+  +  QP+   ++  T G+T    GPCE+W D
Sbjct  87   YRNLRDLIDTKAVFSAGTDK--ECGFTNVTSAKQPL---SAHATGGFTPTHQGPCEIWCD  141

Query  138  DTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
               V    NC   +P    Q+ Y  S C  +  L +YWL +  ++    W+ Y NC  L
Sbjct  142  RVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINCAPL  196

>SPRG_07826
Length=371

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 70/149 (47%), Gaps = 21/149 (14%)

Query  58   AYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTS-PKTETQPIP  116
            AY Q+ G N +  A ++ +   Y +L+A LD       T     +CG+T       QP+P
Sbjct  54   AYNQDPGYNAAQFAANF-KTSKYKTLKAFLD----AWDTSAQCGQCGITKVDAANPQPLP  108

Query  117  T--------NNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCT  168
            +        N  F  S    +GPCE+W D+T+V    +C    P G   +D S C  +  
Sbjct  109  SIVKWRHGDNEGFTPSH---EGPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQ  165

Query  169  LSWYWLGIKYVEGIYSWQVYKNCVGLGTA  197
            L+  W+ +   +    WQ YKNCV +G+A
Sbjct  166  LTMLWMALHTPQ----WQAYKNCVAIGSA  190

>SDRG_00972
Length=333

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 71/146 (49%), Gaps = 15/146 (10%)

Query  58   AYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTS-PKTETQPIP  116
            AY Q+ G N +  A ++     Y +L+A LD       T     +CG+T       QP+P
Sbjct  53   AYNQDPGYNAAQFAANFKASK-YKTLKAFLDAWD----TSAQCGQCGITKVDAANPQPLP  107

Query  117  TNNSFQ---TSGYTL--DGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSW  171
            +   ++     G+T   +GPCE+W D+T++    +C    P G   +D S C  +  L+ 
Sbjct  108  SIVKWRHGDNEGFTPSHEGPCELWCDETRLYYNDDCAKNIPDGSMPIDTSKCSGAKQLTM  167

Query  172  YWLGIKYVEGIYSWQVYKNCVGLGTA  197
             W+ +   +    WQ YKNCV +G+A
Sbjct  168  LWMALHTPQ----WQAYKNCVAIGSA  189

>PHYSO_255056
Length=269

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 61/123 (50%), Gaps = 15/123 (12%)

Query  76   EQHGY-TSLRAMLD-DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQ-TSGYTLDGPC  132
            ++ GY  ++R +LD D +LY        +CG ++P  + +  PT+ +     G    GPC
Sbjct  74   KEAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDGTATFERGLAHHGPC  127

Query  133  EVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIK-YVEGIYSWQVYKNC  191
            E+WLDDT V    +C   F       DY S    C   +YWL  +    G Y WQ+YKNC
Sbjct  128  EIWLDDTMVLHNDDCAKAF----SVEDYMSI-NGCMFRFYWLAFQGSTSGKYVWQIYKNC  182

Query  192  VGL  194
            + L
Sbjct  183  IPL  185

>PPTG_06253
Length=303

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query  64   GVNTSIEA-QSWMEQHGYTSLRAML-DDESLYQVTEEAIFECGLTSPKTETQPIPTNNSF  121
            GVN ++   ++     GY SL A +  ++ LY    +   +CGLT  K   +     +  
Sbjct  62   GVNGTLNFFKATFPTKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASQL  119

Query  122  QTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDY--SSCGESCTLSWYWLGIKYV  179
            + +G+T  GPCEVW DDTKV    +C T++P    ++ Y  S C  +  L+ YWL +   
Sbjct  120  EYTGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIPAKIPYDESKCANANRLTIYWLALHGD  179

Query  180  EGIYSWQVYKNCVGL  194
                 WQVY +CV L
Sbjct  180  P----WQVYTDCVWL  190

>PHYRA_84732
Length=265

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 61/127 (48%), Gaps = 28/127 (22%)

Query  79   GYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTN--------NSFQTSGY--TL  128
            GY+SLR MLD         + + +C  T  +T+  P+  +        N  +  G+  + 
Sbjct  80   GYSSLRDMLD---------QQVTDCANT--RTDVSPVDVSGLTVLNWQNDQEQKGFIDSH  128

Query  129  DGPCEVWLDDTKVSAGRNCHTEFPQG---QHQVDYSSCGESCTLSWYWLGIKYVEGIYSW  185
             GPCEVW+DDTKV    +C   +  G       D+S C   CTL +YWL +       +W
Sbjct  129  HGPCEVWIDDTKVDHQDDCVATYGSGYPASVSADFSKCSGDCTLRFYWLALHEP----NW  184

Query  186  QVYKNCV  192
            QVYK CV
Sbjct  185  QVYKQCV  191

>PHYCA_18729
Length=391

 Score = 66.2 bits (160),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 51/101 (50%), Gaps = 11/101 (11%)

Query  100  IFECGLTSPKTETQPIPTNNSFQ--TSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQH-  156
            I ECG T  K   Q +P++   Q  T G +  GPCE+W DDT+V    NC T F  GQ  
Sbjct  89   ISECGNTEKKGTAQSVPSDGYAQHDTLGNSHPGPCEIWCDDTRVFHDTNCVTTF-SGQSP  147

Query  157  ---QVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194
                +D S+C  S    +YWL +        WQVY NCV L
Sbjct  148  AKIPIDVSTCKSSSEFVFYWLALH----AQPWQVYINCVAL  184

Lambda      K        H        a         alpha
   0.318    0.134    0.431    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9038049390

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40