Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_5329125698662658629920.0
PHYCA_104465926765361629570.0
PHYCA_1043356903565661629550.0
PHYSO_4800105698665361228650.0
PHYSO_485614926765361228590.0
PHYRA_72463926265861628500.0
PHYRA_724155698665561628480.0
PHYSO_486085926565361228400.0
PITG_11244926266361228340.0
PHYSO_344705926279861228310.0
PPTG_02122926265761228310.0
PITG_11249926765361628290.0
PITG_11247926565361628290.0
PYAP_173349729165061627690.0
PYU1_G0139279729164961627460.0
PHYCA_1044294084764561227460.0
SPRG_04533926765260927110.0
SDRG_11899926765260927110.0
H310_0261014834765060927030.0
SDRG_1147312211563661126350.0
SPRG_0006812211564361126180.0
PYVX_15641926262961626010.0
PYU1_G013931926266361025770.0
PYIW_16876926264361625750.0
PYAP_192359943964361325750.0
CCI4322116052066061325730.0
CCI40249926766060725460.0
CCA16153926766360725420.0
PYAR_198079262161360125370.0
HYAP_01537927065161625350.0
PYAP_17333926265761625320.0
PITG_11252927065461025280.0
H257_12958926764961325120.0
PHYSO_482793927065861625040.0
H310_09557926764460724970.0
PHALS_09802927065161024770.0
PHYRA_71655927065361624560.0
PYIR_158579729157758624540.0
PHYKE_7016927065061724520.0
PHYCA_104444927064461724510.0
CCA14967152039143157524300.0
PYIR_15859926262659524040.0
H257_1732214834760660923680.0
CCI4024715245664361723650.0
PPTG_196902483756656523540.0
CCA1615115245664361723500.0
HYAP_015407534563459823380.0
PYVX_229818037761258723340.0
PYIW_168739729149645321070.0
PPTG_0212075345100144121060.0
PHALS_043303140378544220180.0
PHYKE_69845698645045020120.0
PYAR_18354478108461117850.0
PYU1_G00409847865661117780.0
PHALS_0083347865261117780.0
H310_0943447865861117770.0
PYIW_2175547865861117760.0
PHALS_013383001738337917720.0
PYVX_1673847865861117710.0
PYAP_1334147865761117690.0
PHYSO_28637647866061117610.0
PHYCA_51069647865961117580.0
PPTG_0824547865861117540.0
PHYRA_7104247865461117500.0
HYAP_0100547866061117480.0
HYAP_010049399666061117480.0
PHYKE_799247865761117410.0
PYU1_G0040979399666360817310.0
PITG_0052747865661117310.0
SDRG_0356447865861217180.0
CCI5023447866561717080.0
CCA2493647866161217010.0
PHYRA_478736903539635716610.0
SDRG_05777976178660516050.0
SPRG_1051912754278260516040.0
CCA20828976178760516010.0
PYIW_2656716585556454015990.0
CCI46091976178760515990.0
H257_0000712754278760715970.0
H310_1475912754278760715950.0
H257_18885976178660415930.0
HYAP_12660976178660515910.0
PYIW_221448493763360515890.0
PITG_11913976178655215840.0
PYIR_243878493763360515830.0
PYVX_18121976163360515810.0
PPTG_03121976178660515800.0
PHYRA_78193976178655215760.0
PHYKE_10815976178655215740.0
PHALS_02079976178655215730.0
PYAP_222388493763360515720.0
SPRG_0033347861561215690.0
PYU1_G0015408493763360515680.0
PHYCA_509820976178655215580.0
PHYRA_47865926738133715480.0
SPRG_10477976176259915070.0
PHYRA_418886871958635314790.0
PYIR_1673747851145414190.0
PHYRA_722386941960161313501e-179
H310_026044159331229613169e-179
PYAR_199308493762551812652e-166
PYVX_150511272863258412096e-158
PYAP_197381272864861312081e-157
PYU1_G0037541272865062512081e-157
PHYSO_5254295984561059912007e-157
PHYKE_90081272865062412012e-156
H310_066311272865161011846e-154
PITG_157861272863362411827e-154
PPTG_182741272864862411821e-153
H257_012771272865256111803e-153
PHYRA_711231272863362411774e-153
PHYCA_5411341272863362411757e-153
PHALS_076161272867762511781e-152
CCI459821272866160111761e-152
SDRG_110431272864956111733e-152
PHYSO_5004801272863362811723e-152
SDRG_0581612754247944711522e-151
CCA215141272865960411621e-150
PYAR_221881272863456511313e-146
PHYSO_3396666941958560811273e-146
PYIR_196971272860854011242e-145
PITG_153701240847427210834e-141
SPRG_022941272863456110941e-140
PYAR_144875698646724610408e-135
HYAP_01993309756952710272e-131
PHYSO_552116309757051710212e-130
PPTG_10122309756951710114e-129
PYAP_16216309756451810099e-129
PHYRA_71591309757051710044e-128
PITG_0572148643022569725e-127
PYU1_G00694030975655179959e-127
PYIR_16738939965553289922e-126
PITG_0354630975695179881e-125
PHYKE_6430975695179854e-125
PHALS_0039030975695439621e-121
PYIR_2412330975675179611e-121
SDRG_1003830975655129583e-121
SPRG_111331278736764399622e-120
PHYCA_532207309711185189862e-119
PYVX_1769230975515169331e-117
PPTG_02121972912222128975e-117
PYAR_2470430975254959092e-114
H310_1276530975605209104e-114
SPRG_1569530975815129072e-113
H257_0765030975634908958e-112
PITG_15111122191861808581e-111
PYIW_17145127284433968594e-108
PHYSO_54956197613613668333e-105
CCI4758230975825538523e-105
PPTG_1672792702172088168e-105
PYIW_19165309711245168803e-104
CCA2022930975835538402e-103
PHYKE_2977753452201708029e-103
SDRG_057781275266182407612e-91
PHALS_1279092652141637089e-89
PITG_16528133105615057321e-87
PYAR_246871058826185447351e-87
SDRG_171221278733613707106e-87
PHYRA_51904408471291286861e-86
PHALS_00667297021421426843e-86
PHYSO_493381133105625057092e-84
PYU1_G002895133105615057041e-83
PHYRA_79054133105635067041e-83
PHYCA_6458133105605087032e-83
PPTG_05819133105615067023e-83
PYAR_14579133105675076962e-82
H257_167751460792912666574e-80
PHALS_02692133105575056761e-79
PYIW_17320133105634986692e-78
H310_03911133105705166683e-78
SDRG_010681221786216176704e-78
SPRG_01255133105665006594e-77
CCI45261133105585076585e-77
PYIR_13638133105434996576e-77
PYAP_19903133105275046224e-72
PYVX_13615133105855356257e-72
HYAP_01857133104924676188e-72
H257_01680133105715186231e-71
CCA22305133105615106202e-71
HYAP_06818127283162506002e-71
SPRG_001821221786156146206e-71
SPRG_104761275262702765883e-70
SDRG_16621133105314936103e-70
SPRG_001831221796096106004e-68
PHYSO_249932300172321995541e-65
PYAP_18643457648046785894e-65
PYVX_13288457648106795878e-65
PHYSO_5252361275422462275341e-62
PHALS_04095457648036745666e-62
CCA159131523708576935642e-61
PYAR_15468457647696565585e-61
CCI467091523708196935526e-60
SDRG_010671221796116155411e-59
SPRG_06720139304253915291e-59
PYIR_21692139304683975285e-59
SDRG_16559139304613915267e-59
H257_164841261517956745412e-58
H310_062291261518006735384e-58
PYIW_19956139304593965204e-58
H257_04453139304233895159e-58
PHYRA_53570139303953955094e-57
PHALS_09281139304653975111e-56
PHYCA_111740415938103915202e-55
PPTG_19375457648093915192e-55
H310_12260139304243914992e-55
PHYCA_120845139304443924993e-55
PPTG_09003139304493964993e-55
HYAP_015389267130904672e-54
PHYRA_82545457648063915122e-54
PHYKE_6664457648043915122e-54
PYIW_142318611412435515163e-54
PYU1_G008851457647953935094e-54
PHALS_08498127148957295115e-54
PITG_17383139304383984836e-53
PYU1_G006843139304813974831e-52
PHYSO_247517457647946464936e-52
PHYCA_504114127148875414912e-51
HYAP_07918127148973964903e-51
CCA27145139304634034662e-50
PHYRA_73661127148845554815e-50
PITG_15771127148834064805e-50
PYAP_19741127148854054798e-50
SDRG_032661261517923914742e-49
SPRG_080601261517933914733e-49
SPRG_110071278024262084511e-48
PYAR_221401046463533264461e-48
PHYSO_2555061271412283984721e-48
PYAP_21865139304814104532e-48
PYAR_16202127148935284673e-48
PYU1_G000896861147115624545e-47
PHYKE_9011127149023984577e-47
HYAP_04460457648183934494e-46
PPTG_13159224481972274075e-45
CCA21519127149295544338e-44
H310_014931481489093974311e-43
PHYSO_285382139303793544102e-43
H310_01496127149043974293e-43
PYVX_15061127148913974258e-43
PYIR_25979861144384004108e-43
PYIR_18381457647473934221e-42
PHYKE_7077133106314704181e-42
PYIR_24220127149083974231e-42
PHYSO_339667525751601263852e-42
PHYSO_249902459321301223797e-42
HYAP_10418139303152423922e-41
H310_100601468051871913812e-41
H257_00287127148933974115e-41
CCI11769139303723613927e-41
SDRG_01828127148665584107e-41
PYU1_G003764127149103964108e-41
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_532912

Length=626
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_532912                                                          1157       0.0   
PHYCA_104465                                                          1143       0.0   
PHYCA_104335                                                          1142       0.0   
PHYSO_480010                                                          1108       0.0   
PHYSO_485614                                                          1105       0.0   
PHYRA_72463                                                           1102       0.0   
PHYRA_72415                                                           1101       0.0   
PHYSO_486085                                                          1098       0.0   
PITG_11244                                                            1096       0.0   
PHYSO_344705                                                          1095       0.0   
PPTG_02122                                                            1095       0.0   
PITG_11249                                                            1094       0.0   
PITG_11247                                                            1094       0.0   
PYAP_17334                                                            1071       0.0   
PYU1_G013927                                                          1062       0.0   
PHYCA_104429                                                          1062       0.0   
SPRG_04533                                                            1048       0.0   
SDRG_11899                                                            1048       0.0   
H310_02610                                                            1045       0.0   
SDRG_11473                                                            1019       0.0   
SPRG_00068                                                            1013       0.0   
PYVX_15641                                                            1006       0.0   
PYU1_G013931                                                          997        0.0   
PYIW_16876                                                            996        0.0   
PYAP_19235                                                            996        0.0   
CCI43221                                                              995        0.0   
CCI40249                                                              985        0.0   
CCA16153                                                              983        0.0   
PYAR_19807                                                            981        0.0   
HYAP_01537                                                            981        0.0   
PYAP_17333                                                            979        0.0   
PITG_11252                                                            978        0.0   
H257_12958                                                            972        0.0   
PHYSO_482793                                                          969        0.0   
H310_09557                                                            966        0.0   
PHALS_09802                                                           958        0.0   
PHYRA_71655                                                           950        0.0   
PYIR_15857                                                            949        0.0   
PHYKE_7016                                                            949        0.0   
PHYCA_104444                                                          948        0.0   
CCA14967                                                              940        0.0   
PYIR_15859                                                            930        0.0   
H257_17322                                                            916        0.0   
CCI40247                                                              915        0.0   
PPTG_19690                                                            911        0.0   
CCA16151                                                              909        0.0   
HYAP_01540                                                            905        0.0   
PYVX_22981                                                            903        0.0   
PYIW_16873                                                            816        0.0   
PPTG_02120                                                            815        0.0   
PHALS_04330                                                           781        0.0   
PHYKE_6984                                                            779        0.0   
PYAR_18354                                                            692        0.0   
PYU1_G004098                                                          689        0.0   
PHALS_00833                                                           689        0.0   
H310_09434                                                            689        0.0   
PYIW_21755                                                            688        0.0   
PHALS_01338                                                           687        0.0   
PYVX_16738                                                            686        0.0   
PYAP_13341                                                            686        0.0   
PHYSO_286376                                                          682        0.0   
PHYCA_510696                                                          681        0.0   
PPTG_08245                                                            680        0.0   
PHYRA_71042                                                           678        0.0   
HYAP_01005                                                            677        0.0   
HYAP_01004                                                            677        0.0   
PHYKE_7992                                                            675        0.0   
PYU1_G004097                                                          671        0.0   
PITG_00527                                                            671        0.0   
SDRG_03564                                                            666        0.0   
CCI50234                                                              662        0.0   
CCA24936                                                              659        0.0   
PHYRA_47873                                                           644        0.0   
SDRG_05777                                                            622        0.0   
SPRG_10519                                                            622        0.0   
CCA20828                                                              621        0.0   
PYIW_26567                                                            620        0.0   
CCI46091                                                              620        0.0   
H257_00007                                                            619        0.0   
H310_14759                                                            619        0.0   
H257_18885                                                            618        0.0   
HYAP_12660                                                            617        0.0   
PYIW_22144                                                            616        0.0   
PITG_11913                                                            614        0.0   
PYIR_24387                                                            614        0.0   
PYVX_18121                                                            613        0.0   
PPTG_03121                                                            613        0.0   
PHYRA_78193                                                           611        0.0   
PHYKE_10815                                                           610        0.0   
PHALS_02079                                                           610        0.0   
PYAP_22238                                                            610        0.0   
SPRG_00333                                                            608        0.0   
PYU1_G001540                                                          608        0.0   
PHYCA_509820                                                          604        0.0   
PHYRA_47865                                                           600        0.0   
SPRG_10477                                                            585        0.0   
PHYRA_41888                                                           574        0.0   
PYIR_16737                                                            551        0.0   
PHYRA_72238                                                           524        1e-179
H310_02604                                                            511        9e-179
PYAR_19930                                                            491        2e-166
PYVX_15051                                                            470        6e-158
PYAP_19738                                                            469        1e-157
PYU1_G003754                                                          469        1e-157
PHYSO_525429                                                          466        7e-157
PHYKE_9008                                                            467        2e-156
H310_06631                                                            460        6e-154
PITG_15786                                                            459        7e-154
PPTG_18274                                                            459        1e-153
H257_01277                                                            459        3e-153
PHYRA_71123                                                           457        4e-153
PHYCA_541134                                                          457        7e-153
PHALS_07616                                                           458        1e-152
CCI45982                                                              457        1e-152
SDRG_11043                                                            456        3e-152
PHYSO_500480                                                          456        3e-152
SDRG_05816                                                            448        2e-151
CCA21514                                                              452        1e-150
PYAR_22188                                                            440        3e-146
PHYSO_339666                                                          438        3e-146
PYIR_19697                                                            437        2e-145
PITG_15370                                                            421        4e-141
SPRG_02294                                                            426        1e-140
PYAR_14487                                                            405        8e-135
HYAP_01993                                                            400        2e-131
PHYSO_552116                                                          397        2e-130
PPTG_10122                                                            394        4e-129
PYAP_16216                                                            393        9e-129
PHYRA_71591                                                           391        4e-128
PITG_05721                                                            379        5e-127
PYU1_G006940                                                          387        9e-127
PYIR_16738                                                            386        2e-126
PITG_03546                                                            385        1e-125
PHYKE_64                                                              384        4e-125
PHALS_00390                                                           375        1e-121
PYIR_24123                                                            374        1e-121
SDRG_10038                                                            373        3e-121
SPRG_11133                                                            375        2e-120
PHYCA_532207                                                          384        2e-119
PYVX_17692                                                            363        1e-117
PPTG_02121                                                            350        5e-117
PYAR_24704                                                            354        2e-114
H310_12765                                                            355        4e-114
SPRG_15695                                                            353        2e-113
H257_07650                                                            349        8e-112
PITG_15111                                                            335        1e-111
PYIW_17145                                                            335        4e-108
PHYSO_549561                                                          325        3e-105
CCI47582                                                              332        3e-105
PPTG_16727                                                            318        8e-105
PYIW_19165                                                            343        3e-104
CCA20229                                                              328        2e-103
PHYKE_2977                                                            313        9e-103
SDRG_05778                                                            297        2e-91 
PHALS_12790                                                           277        9e-89 
PITG_16528                                                            286        1e-87 
PYAR_24687                                                            287        1e-87 
SDRG_17122                                                            278        6e-87 
PHYRA_51904                                                           268        1e-86 
PHALS_00667                                                           268        3e-86 
PHYSO_493381                                                          277        2e-84 
PYU1_G002895                                                          275        1e-83 
PHYRA_79054                                                           275        1e-83 
PHYCA_6458                                                            275        2e-83 
PPTG_05819                                                            275        3e-83 
PYAR_14579                                                            272        2e-82 
H257_16775                                                            257        4e-80 
PHALS_02692                                                           265        1e-79 
PYIW_17320                                                            262        2e-78 
H310_03911                                                            261        3e-78 
SDRG_01068                                                            262        4e-78 
SPRG_01255                                                            258        4e-77 
CCI45261                                                              258        5e-77 
PYIR_13638                                                            257        6e-77 
PYAP_19903                                                            244        4e-72 
PYVX_13615                                                            245        7e-72 
HYAP_01857                                                            242        8e-72 
H257_01680                                                            244        1e-71 
CCA22305                                                              243        2e-71 
HYAP_06818                                                            235        2e-71 
SPRG_00182                                                            243        6e-71 
SPRG_10476                                                            231        3e-70 
SDRG_16621                                                            239        3e-70 
SPRG_00183                                                            235        4e-68 
PHYSO_249932                                                          218        1e-65 
PYAP_18643                                                            231        4e-65 
PYVX_13288                                                            230        8e-65 
PHYSO_525236                                                          210        1e-62 
PHALS_04095                                                           222        6e-62 
CCA15913                                                              221        2e-61 
PYAR_15468                                                            219        5e-61 
CCI46709                                                              217        6e-60 
SDRG_01067                                                            213        1e-59 
SPRG_06720                                                            208        1e-59 
PYIR_21692                                                            207        5e-59 
SDRG_16559                                                            207        7e-59 
H257_16484                                                            213        2e-58 
H310_06229                                                            211        4e-58 
PYIW_19956                                                            204        4e-58 
H257_04453                                                            202        9e-58 
PHYRA_53570                                                           200        4e-57 
PHALS_09281                                                           201        1e-56 
PHYCA_111740                                                          204        2e-55 
PPTG_19375                                                            204        2e-55 
H310_12260                                                            196        2e-55 
PHYCA_120845                                                          196        3e-55 
PPTG_09003                                                            196        3e-55 
HYAP_01538                                                            184        2e-54 
PHYRA_82545                                                           201        2e-54 
PHYKE_6664                                                            201        2e-54 
PYIW_14231                                                            203        3e-54 
PYU1_G008851                                                          200        4e-54 
PHALS_08498                                                           201        5e-54 
PITG_17383                                                            190        6e-53 
PYU1_G006843                                                          190        1e-52 
PHYSO_247517                                                          194        6e-52 
PHYCA_504114                                                          193        2e-51 
HYAP_07918                                                            193        3e-51 
CCA27145                                                              184        2e-50 
PHYRA_73661                                                           189        5e-50 
PITG_15771                                                            189        5e-50 
PYAP_19741                                                            189        8e-50 
SDRG_03266                                                            187        2e-49 
SPRG_08060                                                            186        3e-49 
SPRG_11007                                                            178        1e-48 
PYAR_22140                                                            176        1e-48 
PHYSO_255506                                                          186        1e-48 
PYAP_21865                                                            179        2e-48 
PYAR_16202                                                            184        3e-48 
PYU1_G000896                                                          179        5e-47 
PHYKE_9011                                                            180        7e-47 
HYAP_04460                                                            177        4e-46 
PPTG_13159                                                            161        5e-45 
CCA21519                                                              171        8e-44 
H310_01493                                                            170        1e-43 
PHYSO_285382                                                          162        2e-43 
H310_01496                                                            169        3e-43 
PYVX_15061                                                            168        8e-43 
PYIR_25979                                                            162        8e-43 
PYIR_18381                                                            167        1e-42 
PHYKE_7077                                                            165        1e-42 
PYIR_24220                                                            167        1e-42 
PHYSO_339667                                                          152        2e-42 
PHYSO_249902                                                          150        7e-42 
HYAP_10418                                                            155        2e-41 
H310_10060                                                            151        2e-41 
H257_00287                                                            162        5e-41 
CCI11769                                                              155        7e-41 
SDRG_01828                                                            162        7e-41 
PYU1_G003764                                                          162        8e-41 
H257_18082                                                            148        3e-40 
PPTG_14555                                                            158        6e-40 
SPRG_06288                                                            157        4e-39 
CCI45987                                                              155        2e-38 
PYIW_19676                                                            151        1e-37 
PHYCA_558934                                                          148        2e-37 
PYVX_18450                                                            145        3e-37 
PPTG_10700                                                            137        7e-37 
PPTG_18280                                                            144        7e-37 
PPTG_04054                                                            142        8e-37 
HYAP_01856                                                            135        1e-34 
PPTG_17083                                                            135        2e-34 
PPTG_17863                                                            130        3e-34 
HYAP_01511                                                            130        7e-34 
PITG_21580                                                            138        3e-33 
PITG_03068                                                            131        4e-31 
PYU1_G004743                                                          131        6e-31 
PHYSO_321565                                                          130        1e-30 
PYIW_21045                                                            129        3e-30 
PPTG_23878                                                            129        8e-30 
PYAR_13948                                                            127        1e-29 
PYAP_23247                                                            122        7e-28 
PHALS_00479                                                           119        4e-27 
PHYSO_353741                                                          119        4e-27 
HYAP_00880                                                            116        6e-26 
H257_18435                                                            115        8e-26 
PPTG_18422                                                            115        1e-25 
SPRG_00713                                                            115        1e-25 
PITG_02259                                                            114        3e-25 
SDRG_01561                                                            112        8e-25 
PYIR_14416                                                            111        2e-24 
PHYSO_342817                                                          103        3e-24 
PHYKE_585                                                             109        8e-24 
H310_05216                                                            109        8e-24 
PPTG_22662                                                            105        1e-23 
PHYRA_42335                                                           97.8       1e-23 
PHYCA_502791                                                          105        2e-22 
PYVX_22905                                                            102        1e-21 
SPRG_17185                                                            92.0       1e-21 
PHYRA_80453                                                           99.0       2e-20 
PHYRA_81377                                                           89.7       5e-18 
HYAP_04461                                                            84.0       7e-18 
HYAP_01510                                                            82.8       1e-17 
PYVX_22561                                                            77.8       5e-14 
PYVX_17117                                                            75.9       4e-13 
CCI45196                                                              69.7       4e-13 
PYAP_20766                                                            68.2       6e-11 
PHYSO_532708                                                          62.8       1e-09 
PHYCA_549822                                                          63.2       2e-09 
PYU1_G008203                                                          62.4       4e-09 
PHYRA_82300                                                           61.2       2e-08 
SPRG_08648                                                            60.1       2e-08 
PPTG_04864                                                            59.7       3e-08 
SDRG_10651                                                            58.5       5e-08 
PYIW_19781                                                            56.6       3e-07 
PHYSO_383637                                                          51.2       3e-07 
PITG_03970                                                            53.5       1e-06 
PHYSO_530254                                                          48.9       1e-06 
PPTG_17862                                                            50.4       3e-06 
PHYKE_9691                                                            52.4       9e-06 
PYIR_22849                                                            49.7       1e-05 
H257_09465                                                            50.8       2e-05 
H310_13261                                                            50.4       2e-05 
PYIR_20734                                                            46.6       4e-04 
PPTG_03570                                                            43.5       4e-04 
PITG_11248                                                            41.2       0.002 
PPTG_23039                                                            40.8       0.003 
PHYRA_46132                                                           40.4       0.005 
CCA23736                                                              40.8       0.010 
PYAR_19707                                                            42.0       0.012 
SDRG_11277                                                            35.8       0.055 
PPTG_09610                                                            35.0       0.070 
PPTG_23917                                                            34.7       0.096 
PYIW_26103                                                            38.5       0.12  
PHYRA_54751                                                           33.9       0.27  
CCI47104                                                              37.0       0.34  
PPTG_24969                                                            32.3       1.2   
PYIW_26201                                                            34.3       2.7   
PYIW_17996                                                            33.9       3.5   
PPTG_22091                                                            30.0       4.5   
PPTG_05521                                                            30.0       4.5   
PYIW_14028                                                            33.1       4.7   
H310_14226                                                            32.7       6.5   
PPTG_00149                                                            33.1       7.0   
H257_04365                                                            32.7       8.1   
PYAR_23626                                                            32.7       9.1   

>PHYCA_532912
Length=626

 Score = 1157 bits (2992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/586 (100%), Positives = 586/586 (100%), Gaps = 0/586 (0%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMREDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  180
            PEEISSMVLIKMREDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD
Sbjct  121  PEEISSMVLIKMREDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  180

Query  181  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  240
            VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA
Sbjct  181  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  240

Query  241  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL  300
            CERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL
Sbjct  241  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL  300

Query  301  SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdss  360
            SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSS
Sbjct  301  SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSS  360

Query  361  eklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG  420
            EKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG
Sbjct  361  EKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG  420

Query  421  ERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  480
            ERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN
Sbjct  421  ERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  480

Query  481  DKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEA  540
            DKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEA
Sbjct  481  DKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEA  540

Query  541  DKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
            DKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY
Sbjct  541  DKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586

>PHYCA_104465
Length=653

 Score = 1143 bits (2957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/616 (95%), Positives = 586/616 (95%), Gaps = 30/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  360

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  480

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  540

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK
Sbjct  541  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  600

Query  571  QKELEGVANPVLQKMY  586
            QKELEGVANPVLQKMY
Sbjct  601  QKELEGVANPVLQKMY  616

>PHYCA_104335
Length=656

 Score = 1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/616 (95%), Positives = 586/616 (95%), Gaps = 30/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  360

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  480

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  540

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK
Sbjct  541  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  600

Query  571  QKELEGVANPVLQKMY  586
            QKELEGVANPVLQKMY
Sbjct  601  QKELEGVANPVLQKMY  616

>PHYSO_480010
Length=653

 Score = 1108 bits (2865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/612 (92%), Positives = 577/612 (94%), Gaps = 30/612 (5%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
            TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  4    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF+++SGAGDKPQITVQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEI  123

Query  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  364  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  423

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANK RIEAK
Sbjct  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAK  543

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            NALENYAYSLRNSLNDEK+KEKIPEADKK VDDKVTE IQWLDA+QS EK+ YE+KQKEL
Sbjct  544  NALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKEL  603

Query  575  EGVANPVLQKMY  586
            EGVANPVLQK+Y
Sbjct  604  EGVANPVLQKVY  615

>PHYSO_485614
Length=653

 Score = 1105 bits (2859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/612 (92%), Positives = 576/612 (94%), Gaps = 30/612 (5%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
            TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  4    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPF+++SG GDKPQITVQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFKISSGPGDKPQITVQFKGESKTFQPEEI  123

Query  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  364  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  423

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANK RIEAK
Sbjct  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAK  543

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            NALENYAYSLRNSLNDEK+KEKIPEADKK VDDKVTE IQWLDA+QS EK+ YE+KQKEL
Sbjct  544  NALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKEL  603

Query  575  EGVANPVLQKMY  586
            EGVANPVLQK+Y
Sbjct  604  EGVANPVLQKVY  615

>PHYRA_72463
Length=658

 Score = 1102 bits (2850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/616 (91%), Positives = 576/616 (94%), Gaps = 30/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M QA TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  360

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  480

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK R
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  540

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEAKNALENYAY+LRN+LNDEK+K++I E DKKA++DKVTE I WLDANQS EK+ YE K
Sbjct  541  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  600

Query  571  QKELEGVANPVLQKMY  586
            QKELEGVANP+LQKMY
Sbjct  601  QKELEGVANPILQKMY  616

>PHYRA_72415
Length=655

 Score = 1101 bits (2848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/616 (91%), Positives = 576/616 (94%), Gaps = 30/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M QA TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANK R
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEAKNALENYAYSLRNSLNDEK+KE+IPEADKK VDDKVTE IQWLDA+QS E + YESK
Sbjct  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600

Query  571  QKELEGVANPVLQKMY  586
            QKELEGVANP+LQKMY
Sbjct  601  QKELEGVANPILQKMY  616

>PHYSO_486085
Length=653

 Score = 1098 bits (2840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/612 (92%), Positives = 575/612 (94%), Gaps = 30/612 (5%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
            TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  4    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFDAKRLIGRKFSDPVVQADI+HWPF+++SG GDKPQITVQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDAKRLIGRKFSDPVVQADIQHWPFKISSGPGDKPQITVQFKGESKTFQPEEI  123

Query  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV++
Sbjct  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVEY  243

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            F QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  244  FVQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  364  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  423

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANK RIEAK
Sbjct  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAK  543

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            NALENYAYSLRNSLNDEK+KEKIPEADKK VDDKVTE IQWLDA+QS EK+ YE+KQKEL
Sbjct  544  NALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKEL  603

Query  575  EGVANPVLQKMY  586
            EGVANPVLQK+Y
Sbjct  604  EGVANPVLQKVY  615

>PITG_11244
Length=663

 Score = 1096 bits (2834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/612 (91%), Positives = 572/612 (93%), Gaps = 30/612 (5%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
            + SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++T+GAGDKPQITVQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITAGAGDKPQITVQFKGESKTFQPEEI  123

Query  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  364  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  423

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK RIEAK
Sbjct  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  543

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            NALENYAY+LRN+LNDEK+K++I E DKK +DDKVTE I WLDANQS EK+ YE KQKEL
Sbjct  544  NALENYAYNLRNTLNDEKLKDQISEDDKKVIDDKVTETINWLDANQSAEKEEYEGKQKEL  603

Query  575  EGVANPVLQKMY  586
            EGVANP+LQKMY
Sbjct  604  EGVANPILQKMY  615

>PHYSO_344705
Length=798

 Score = 1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/612 (91%), Positives = 573/612 (94%), Gaps = 30/612 (5%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
            + SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  145  SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  204

Query  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF+++SGAGDKPQITVQFKGESKTFQPEEI
Sbjct  205  MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEI  264

Query  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  265  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  324

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  325  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  384

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  385  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  444

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  445  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  504

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  505  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  564

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  565  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  624

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV+EAEKYKSEDEANK RIEAK
Sbjct  625  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVRIEAK  684

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            NALENYAY+LRN+LNDEK+K++I E DKKA+DDKVTE I WLDANQS EK+ YE KQKEL
Sbjct  685  NALENYAYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGKQKEL  744

Query  575  EGVANPVLQKMY  586
            EGVANP+LQKMY
Sbjct  745  EGVANPILQKMY  756

>PPTG_02122
Length=657

 Score = 1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/612 (91%), Positives = 572/612 (93%), Gaps = 30/612 (5%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
            + SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSG GDKPQITVQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQPEEI  123

Query  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  364  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  423

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV+EAEKYKSEDEANK RIEAK
Sbjct  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVRIEAK  543

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            NALENYAY+LRN+LNDEK+K++I E DKKA+DDKVTE I WLDANQS EK+ YE KQKEL
Sbjct  544  NALENYAYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGKQKEL  603

Query  575  EGVANPVLQKMY  586
            EGVANP+LQKMY
Sbjct  604  EGVANPILQKMY  615

>PITG_11249
Length=653

 Score = 1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/616 (91%), Positives = 576/616 (94%), Gaps = 31/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MTQAT SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQAT-SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKFSDPVVQADIKHWPF++T+G GDKPQITVQFKGE+KTFQ
Sbjct  60   NQVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV+HF QEFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNST
Sbjct  240  LVEHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+I+RMV+EAEKYKSEDEANK R
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSEDEANKVR  539

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEAKNALENYAYSLRNSLNDEKMKEKIPEADKK VDDKVTEVIQW+DA+QS EK+ YESK
Sbjct  540  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWMDAHQSSEKEEYESK  599

Query  571  QKELEGVANPVLQKMY  586
            QKELE VANPVLQK+Y
Sbjct  600  QKELESVANPVLQKVY  615

>PITG_11247
Length=653

 Score = 1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/616 (91%), Positives = 575/616 (93%), Gaps = 31/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MTQAT SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQAT-SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKFSDPVVQADIKHWPF++T+G GDKPQITVQFKGE+KTFQ
Sbjct  60   NQVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV+HF QEFKRKHRKD+T+NQRALRRLRTACERAKRTLSSS+QAYIEIDSLFDG+DFNST
Sbjct  240  LVEHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFDGVDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  360  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  419

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+I+RMV+EAEKYKS DEANK R
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSADEANKAR  539

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEAKNALENYAYSLRNSLNDEKMKEKIPEADKK VDDKVTEVIQWLDA+QS EK+ YESK
Sbjct  540  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDAHQSSEKEEYESK  599

Query  571  QKELEGVANPVLQKMY  586
            QKELE VANPVLQK+Y
Sbjct  600  QKELESVANPVLQKVY  615

>PYAP_17334
Length=650

 Score = 1071 bits (2769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/616 (89%), Positives = 566/616 (92%), Gaps = 31/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M QA  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MAQAV-SGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF V+ GAGDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFTVSPGAGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVL KMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLTKMREVAEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LVDHF  EFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFVSEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFEDMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KEP KSINPDEAVA+GATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLI 
Sbjct  360  KEPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIP  419

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  420  RNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSA+EKSTGKENKITITNDKGRLSQADIDRMVSEAEKYK+EDEANK R
Sbjct  480  VTFDIDANGILNVSAIEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKIR  539

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEAKN LENYAY+LRN+LNDEK+K +IPE D+KA+DDKVTEVI WLDA+Q+ EK+ +E+K
Sbjct  540  IEAKNGLENYAYNLRNTLNDEKLKSQIPEDDRKAIDDKVTEVINWLDAHQASEKEEFEAK  599

Query  571  QKELEGVANPVLQKMY  586
            QKELEG+ANP+LQKMY
Sbjct  600  QKELEGIANPILQKMY  615

>PYU1_G013927
Length=649

 Score = 1062 bits (2746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/616 (88%), Positives = 565/616 (92%), Gaps = 31/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M QA  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQAV-AGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQAD KHWPF V++G GDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADCKHWPFTVSAGPGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVSEAFIGKEVRNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LVDHF QEFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNST
Sbjct  240  LVDHFVQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  300  ITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KEP KSINPDEAVA+GATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLI+
Sbjct  360  KEPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIS  419

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV+EAEKYK+EDE+NK R
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVR  539

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEAKN LENYAY+LRN+L+DEK+K +I E D+ A++DKVTE I WLDANQS EK+ +E+K
Sbjct  540  IEAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAK  599

Query  571  QKELEGVANPVLQKMY  586
            QKELEGVANP+LQKMY
Sbjct  600  QKELEGVANPILQKMY  615

>PHYCA_104429
Length=645

 Score = 1062 bits (2746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/612 (89%), Positives = 561/612 (92%), Gaps = 42/612 (7%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
            + SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  123

Query  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK            EPN
Sbjct  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPN  351

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  352  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  411

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK RIEAK
Sbjct  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            NALENYAY+LRN+LNDEK+K++I E DKKA++DKVTE I WLDANQS EK+ YE KQKEL
Sbjct  532  NALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKEL  591

Query  575  EGVANPVLQKMY  586
            EGVANP+LQKMY
Sbjct  592  EGVANPILQKMY  603

>SPRG_04533
Length=652

 Score = 1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/609 (88%), Positives = 560/609 (92%), Gaps = 30/609 (5%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+DP  QADIKHWPF+VT GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            VLIKM+E                              DAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  158  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  278  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  337
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP KSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  338  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            NPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
            KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQIDVTFDIDA
Sbjct  426  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDA  485

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNAL  517
            NGILNVSAVEKSTGKENKITITNDKGRL++ DI+RMV EAEKYKSEDEANK RIEAKN L
Sbjct  486  NGILNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKNGL  545

Query  518  ENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGV  577
            ENYAY+LRN+LNDEK++ KI EADKKA+DDKVT+VI WLDANQS EK+ +E+KQKELEG+
Sbjct  546  ENYAYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELEGI  605

Query  578  ANPVLQKMY  586
            ANP++QKMY
Sbjct  606  ANPIMQKMY  614

>SDRG_11899
Length=652

 Score = 1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/609 (88%), Positives = 560/609 (92%), Gaps = 30/609 (5%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+DP  QADIKHWPF+VT GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            VLIKM+E                              DAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  158  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRARFE
Sbjct  246  EFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRARFE  305

Query  278  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  337
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP KSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  338  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            NPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
            KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQIDVTFDIDA
Sbjct  426  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDA  485

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNAL  517
            NGILNVSAVEKSTGKENKITITNDKGRL++ DI+RMV EAEKYKSEDEANK RIEAKN L
Sbjct  486  NGILNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKNGL  545

Query  518  ENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGV  577
            ENYAY+LRN+LNDEK++ KI EADKKA+DDKVT+VI WLDANQS EK+ +E+KQKELEG+
Sbjct  546  ENYAYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELEGI  605

Query  578  ANPVLQKMY  586
            ANP++QKMY
Sbjct  606  ANPIMQKMY  614

>H310_02610
Length=650

 Score = 1045 bits (2703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/609 (87%), Positives = 560/609 (92%), Gaps = 30/609 (5%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+DPV+QADIKHWPF+VT GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            VLIKM+E                              DAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  158  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
            EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  278  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  337
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP KSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  338  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            NPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
            KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQ+DVTFDIDA
Sbjct  426  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQVDVTFDIDA  485

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNAL  517
            NGILNVSA+EKSTGKENKITITNDKGRL++ DI+RMV EAEKYKSEDEANK RIEAKN L
Sbjct  486  NGILNVSAIEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKVRIEAKNGL  545

Query  518  ENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGV  577
            ENYAY+LRN+LNDEK++ K+  ADKK VDDKVTE I WLDANQS EK+ +E+KQKELEGV
Sbjct  546  ENYAYNLRNTLNDEKLQGKLDAADKKTVDDKVTETISWLDANQSAEKEEFEAKQKELEGV  605

Query  578  ANPVLQKMY  586
            ANP++QK+Y
Sbjct  606  ANPIMQKLY  614

>SDRG_11473
Length=636

 Score = 1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/611 (85%), Positives = 550/611 (90%), Gaps = 32/611 (5%)

Query  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            T+ YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  2    TTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKRLIGRKF D VVQADIKHWPF+VTSGA DKPQITVQFKGESKTFQPEEIS
Sbjct  62   NATNTVFDAKRLIGRKFHDAVVQADIKHWPFKVTSGAADKPQITVQFKGESKTFQPEEIS  121

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVLIKM+E                              DAGAIAGLNVLRIINEPTAAA
Sbjct  122  SMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  181

Query  156  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  182  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  241

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
            T EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRAR
Sbjct  242  TAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRAR  301

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FED+C DYFRKTMEPVEKVL+DAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGKEP K
Sbjct  302  FEDLCADYFRKTMEPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPCK  361

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
            SINPDEAVA+GATVQAAILSG+  S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTTV
Sbjct  362  SINPDEAVAFGATVQAAILSGDTQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTV  421

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTYADNQPGVLIQV+EGERSMT DN+LLGKF+LDGIPPMPRGVPQ+DVTFDI
Sbjct  422  PTKKSQTFSTYADNQPGVLIQVYEGERSMTADNHLLGKFSLDGIPPMPRGVPQVDVTFDI  481

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGILNVSAVEKSTGKENKITITNDKGRLS+ DIDRMV EAEKYK++DEA+K R+EAKN
Sbjct  482  DANGILNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRVEAKN  541

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALENYAYSLRN+LNDEK+  KI   DKK +DD V++ I WLD N   EK+ +E+KQKELE
Sbjct  542  ALENYAYSLRNTLNDEKV--KIDVNDKKRLDDMVSDTINWLDHNTHAEKEEFEAKQKELE  599

Query  576  GVANPVLQKMY  586
             VANP++QKMY
Sbjct  600  AVANPIMQKMY  610

>SPRG_00068
Length=643

 Score = 1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/611 (84%), Positives = 549/611 (90%), Gaps = 32/611 (5%)

Query  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            T+ YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  3    TTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKNQVAM  62

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKRLIGRKF D VVQADIKHWPF+VT GA DKPQITV+FKGESKTFQPEEIS
Sbjct  63   NAANTVFDAKRLIGRKFHDAVVQADIKHWPFKVTPGAADKPQITVEFKGESKTFQPEEIS  122

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVLIKM+E                              DAGAIAGLNVLRIINEPTAAA
Sbjct  123  SMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  182

Query  156  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  183  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  242

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
            T EFKRKHRKD+T+NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRAR
Sbjct  243  TAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSASAQAYIEIDSLFDGVDFNSTITRAR  302

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FED+C DYFRKTM+PVEKVL+DAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGKEP K
Sbjct  303  FEDLCADYFRKTMDPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPCK  362

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
            SINPDEAVA+GATVQAAILSG++ S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTTV
Sbjct  363  SINPDEAVAFGATVQAAILSGDNQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTV  422

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTYADNQPGVLIQV+EGERSMT DNNLLGKF+LDGIPPMPRGVPQ+DVTFDI
Sbjct  423  PTKKSQTFSTYADNQPGVLIQVYEGERSMTADNNLLGKFSLDGIPPMPRGVPQVDVTFDI  482

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGILNVSAVEKSTGKENKITITNDKGRLS+ DIDRMV EAEKYK++DEA+K R+EAKN
Sbjct  483  DANGILNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRVEAKN  542

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALENYAY+LRN+LNDEK+  KI   DKK +DD VT+ I WLD N   EK+ +E KQKELE
Sbjct  543  ALENYAYNLRNTLNDEKV--KIDADDKKRLDDMVTDTINWLDHNSHAEKEEFEGKQKELE  600

Query  576  GVANPVLQKMY  586
             VANP++QKMY
Sbjct  601  AVANPIMQKMY  611

>PYVX_15641
Length=629

 Score = 1006 bits (2601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/616 (85%), Positives = 543/616 (88%), Gaps = 55/616 (9%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M QA  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MAQAV-SGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQ+DIKHWPF +TSG GDKPQI VQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFTLTSGPGDKPQIQVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LVDHFTQEFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFTQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+                        QVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  300  ITRARFEDI------------------------QVHEVVLVGGSTRIPKVQQLLSDFFNG  335

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI 
Sbjct  336  KEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIP  395

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  396  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  455

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYK+EDEANK R
Sbjct  456  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKVR  515

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            I+AKN LENY+Y+LRN+LNDEK+K +I E D+KA+DDKVTE I WLDANQS EK+ +E+K
Sbjct  516  IDAKNGLENYSYNLRNTLNDEKLKSQISEEDRKAIDDKVTETINWLDANQSAEKEEFEAK  575

Query  571  QKELEGVANPVLQKMY  586
            QKELEG+ANP+LQKMY
Sbjct  576  QKELEGIANPILQKMY  591

>PYU1_G013931
Length=663

 Score = 997 bits (2577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/610 (82%), Positives = 542/610 (89%), Gaps = 30/610 (5%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA+NQVAMN
Sbjct  12   TGQSVGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAARNQVAMN  71

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFDAKRLIGRKF+DPVVQAD KHWPF+V +GA  KPQI VQFKGESKTFQPEEISS
Sbjct  72   AHNTVFDAKRLIGRKFTDPVVQADTKHWPFKVVAGAESKPQIVVQFKGESKTFQPEEISS  131

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM+E                              DAG I+GLNVLRIINEPTAAAI
Sbjct  132  MVLTKMKEIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAI  191

Query  157  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  216
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR+V++F 
Sbjct  192  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRIVEYFV  251

Query  217  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  276
            QEFKRKHRKD+T NQRALRRLRTACERAKRTLSSS+QAYIEIDSLF+GIDFNSTITRARF
Sbjct  252  QEFKRKHRKDMTGNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFEGIDFNSTITRARF  311

Query  277  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  336
            ED+C DYFRKTMEPVE+VLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK+  KS
Sbjct  312  EDLCADYFRKTMEPVERVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKDLYKS  371

Query  337  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  396
            INPDEAVA+GATVQAAILSG+D S +LQDLLLLDV PLS+GLETAGGVMTTLI RNTTVP
Sbjct  372  INPDEAVAFGATVQAAILSGSDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIPRNTTVP  431

Query  397  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  456
            TKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDVTFDID
Sbjct  432  TKKSQTFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDID  491

Query  457  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNA  516
            ANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMV++AE+YK +DE NK R+EAKN+
Sbjct  492  ANGILNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVTDAERYKDQDERNKLRVEAKNS  551

Query  517  LENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEG  576
            LENYAYSLRNSL +EK+  K+   DKK +DDK+ E I WLDANQ+ EK+ +  KQKELE 
Sbjct  552  LENYAYSLRNSLQEEKLASKLSADDKKLLDDKIAETINWLDANQAAEKEEFADKQKELES  611

Query  577  VANPVLQKMY  586
             ANP+LQ+MY
Sbjct  612  FANPILQRMY  621

>PYIW_16876
Length=643

 Score = 996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/616 (82%), Positives = 544/616 (88%), Gaps = 31/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M QA  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQAV-AGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMN  NTVFDAKRLIGRKFSD VVQAD+KHWPF+V +GA +KPQI V FKGE+KTFQ
Sbjct  60   NQVAMNPANTVFDAKRLIGRKFSDQVVQADLKHWPFKVVAGADNKPQIVVHFKGETKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAI+GLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVSEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAISGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV+ FT EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVEFFTAEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+C DYFRKTMEPVE+VLRDAKLSK QV+E+VLVGGSTRIPKVQQ+LS+FFNG
Sbjct  300  ITRARFEDLCADYFRKTMEPVERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSEFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            K+  KSINPDEAVA+GATVQAAILSGND S +LQDLLLLDV PLS+GLETAGGVMTTLI 
Sbjct  360  KDLYKSINPDEAVAFGATVQAAILSGNDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIP  419

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+ LGKF+LDGIPPMPRGVPQID
Sbjct  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFSLDGIPPMPRGVPQID  479

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV EAE+YK  DE NK R
Sbjct  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVEEAERYKDADERNKLR  539

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            +EAKNALENYAY LRNSL +EK++ K+   DKK ++DK+ E I WLDANQ+ EKD +++K
Sbjct  540  VEAKNALENYAYGLRNSLQEEKLQAKLAADDKKTLEDKIAETIAWLDANQAAEKDEFDAK  599

Query  571  QKELEGVANPVLQKMY  586
            QKELE VA+P+LQKMY
Sbjct  600  QKELESVASPILQKMY  615

>PYAP_19235
Length=643

 Score = 996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/613 (82%), Positives = 540/613 (88%), Gaps = 30/613 (5%)

Query  4    ATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63
            A  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV
Sbjct  2    AAVSGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEE  123
            AMNAHNTVFDAKRLIGRKF+DPVVQAD+KHWPF+V +GAGDKPQITV+FKGE K FQPEE
Sbjct  62   AMNAHNTVFDAKRLIGRKFTDPVVQADMKHWPFKVVTGAGDKPQITVEFKGEKKVFQPEE  121

Query  124  ISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTA  153
            ISSMVL KM+E                              DAG IAGLNV+RIINEPTA
Sbjct  122  ISSMVLTKMKEIAEAYLGTDVKNAVITVPAYFNDSQRQATRDAGTIAGLNVMRIINEPTA  181

Query  154  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  213
            AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV+
Sbjct  182  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVE  241

Query  214  HFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  273
            +F  EFKRKH+KD+T NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDGIDFNSTITR
Sbjct  242  YFVAEFKRKHKKDLTTNQRALRRLRTACERAKRTLSSSTQAYVEIDSLFDGIDFNSTITR  301

Query  274  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  333
            ARFEDMC DYFRKTMEPVEKVL DAK+ K QVHEVVLVGGSTRIPKVQQLL DFFNGKEP
Sbjct  302  ARFEDMCADYFRKTMEPVEKVLHDAKICKGQVHEVVLVGGSTRIPKVQQLLVDFFNGKEP  361

Query  334  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  393
             KSINPDEAVA+GA VQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLI RNT
Sbjct  362  CKSINPDEAVAFGAAVQAAILSGDDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIPRNT  421

Query  394  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  453
             VPTKKSQTFSTYADNQPGVLIQVFEGERSMT+DNNLLGKF+LDGIPPMPRG P+I+VTF
Sbjct  422  AVPTKKSQTFSTYADNQPGVLIQVFEGERSMTKDNNLLGKFSLDGIPPMPRGKPEIEVTF  481

Query  454  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEA  513
            DIDANGILNVSAVEKSTGK+NKITITNDKGRLSQ++IDRMV EAEKY  ED  NK R++A
Sbjct  482  DIDANGILNVSAVEKSTGKDNKITITNDKGRLSQSEIDRMVKEAEKYAKEDADNKARVDA  541

Query  514  KNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKE  573
            KN LENYAY+LRNSL+D  +K+++ E D+K +DD V+E I+WLDA+Q  EK  YE KQKE
Sbjct  542  KNTLENYAYNLRNSLDDAPVKQQMNEDDRKKIDDAVSETIKWLDAHQMSEKQEYEMKQKE  601

Query  574  LEGVANPVLQKMY  586
            LEG+ANP+LQKMY
Sbjct  602  LEGIANPILQKMY  614

>CCI43221
Length=660

 Score = 995 bits (2573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/613 (82%), Positives = 544/613 (89%), Gaps = 30/613 (5%)

Query  4    ATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63
            A  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  2    AQVSGPSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEE  123
            AMNA NTVFDAKRLIGR+ SDPVVQADIKHWPF+VTS  GDK  ITVQ+KGE+K+F+PEE
Sbjct  62   AMNATNTVFDAKRLIGRRCSDPVVQADIKHWPFKVTSSEGDKTMITVQYKGETKSFRPEE  121

Query  124  ISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTA  153
            ISSMVLIKMRE                              DAGAIAGLNVLRIINEPTA
Sbjct  122  ISSMVLIKMREIAEAFLGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  181

Query  154  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  213
            AAIAYGLD+KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVD
Sbjct  182  AAIAYGLDRKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVD  241

Query  214  HFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  273
            HF  EF RKHRKDIT NQRALRRLRTACERAKRTLSSSAQA+IEIDSLF+G+DFNSTITR
Sbjct  242  HFVAEFNRKHRKDITTNQRALRRLRTACERAKRTLSSSAQAHIEIDSLFEGVDFNSTITR  301

Query  274  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  333
            ARFED+C DYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGKE 
Sbjct  302  ARFEDLCADYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEL  361

Query  334  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  393
             KSINPDEAVA+GATVQAAILSG + SEKLQDLLLLDV PLSLGLETAGGVMTTLI RNT
Sbjct  362  CKSINPDEAVAFGATVQAAILSGTEQSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNT  421

Query  394  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  453
            T+PTKKSQ FSTY +NQPGV IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+VTF
Sbjct  422  TLPTKKSQMFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVTF  481

Query  454  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEA  513
            DIDANGILNVSA+EKST KENKITITNDKGRLSQADIDRMVSEAEKYK EDEAN+ RIEA
Sbjct  482  DIDANGILNVSAIEKSTNKENKITITNDKGRLSQADIDRMVSEAEKYKKEDEANRIRIEA  541

Query  514  KNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKE  573
            KN LENYA++LR++L+DEK+K +I   D+  V++KV EV+ WLDANQS EK+ +E KQK+
Sbjct  542  KNGLENYAFNLRSTLDDEKIKNQISPEDRTTVENKVKEVVSWLDANQSAEKEEFEHKQKD  601

Query  574  LEGVANPVLQKMY  586
            LE VANP++QKMY
Sbjct  602  LEAVANPIMQKMY  614

>CCI40249
Length=660

 Score = 985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/607 (82%), Positives = 534/607 (88%), Gaps = 30/607 (5%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TVFDAKRLIGR FSDP+VQAD+KHWPF V +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVTFKGEKKIFQPEEISSMVL  124

Query  130  IKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
            +KMRE                              DAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  125  VKMREVSEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  184

Query  160  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  219
            L+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  185  LEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFVAEF  244

Query  220  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  279
            KRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARFED+
Sbjct  245  KRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARFEDL  304

Query  280  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINP  339
            C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN KEP KSINP
Sbjct  305  CSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKSINP  364

Query  340  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  399
            DEAVA+GATVQAAILSGND SEKLQDLLLLDV PLSLGLETAGGVMT LI RNTT+PTKK
Sbjct  365  DEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKK  424

Query  400  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  459
            SQ FST+ DNQ  V IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V +DIDANG
Sbjct  425  SQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANG  484

Query  460  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALEN  519
            ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYK +DEANK RIEAKN LEN
Sbjct  485  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLEN  544

Query  520  YAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVAN  579
            YAY+LRNSLNDEK+K ++ E D+K +DDK++E + WLDANQS EK+ YE  QK+LE +AN
Sbjct  545  YAYNLRNSLNDEKLKSQLSEDDRKVLDDKISETMSWLDANQSAEKEEYEKLQKDLEAIAN  604

Query  580  PVLQKMY  586
            P+LQKMY
Sbjct  605  PILQKMY  611

>CCA16153
Length=663

 Score = 983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/607 (82%), Positives = 534/607 (88%), Gaps = 30/607 (5%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TVFDAKRLIGR FSDP+VQAD+KHWPF V +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVIFKGEKKIFQPEEISSMVL  124

Query  130  IKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
            +KMRE                              DAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  125  VKMREVSEAYIGKTVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  184

Query  160  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  219
            L+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  185  LEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFVAEF  244

Query  220  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  279
            KRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARFED+
Sbjct  245  KRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARFEDL  304

Query  280  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINP  339
            C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN KEP KSINP
Sbjct  305  CSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKSINP  364

Query  340  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  399
            DEAVA+GATVQAAILSGND SEKLQDLLLLDV PLSLGLETAGGVMT LI RNTT+PTKK
Sbjct  365  DEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKK  424

Query  400  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  459
            SQ FST+ DNQ  V IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V +DIDANG
Sbjct  425  SQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANG  484

Query  460  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALEN  519
            ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYK +DEANK RIEAKN LEN
Sbjct  485  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLEN  544

Query  520  YAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVAN  579
            YAY+LRNSLNDEK+K ++ E D+K +DDK++E + WLDANQS EK+ YE  QK+LE +AN
Sbjct  545  YAYNLRNSLNDEKLKSQLSEDDRKILDDKISETMNWLDANQSAEKEEYEKLQKDLEAIAN  604

Query  580  PVLQKMY  586
            P+LQKMY
Sbjct  605  PILQKMY  611

>PYAR_19807
Length=1613

 Score = 981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/601 (82%), Positives = 539/601 (90%), Gaps = 18/601 (3%)

Query  4    ATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63
            +  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV
Sbjct  5    SVVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  64

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEE  123
            AMNAHNTVFDAKRLIGRKF+D VVQADIKHWPF+V + + +KPQI VQFKGE+K F  EE
Sbjct  65   AMNAHNTVFDAKRLIGRKFTDAVVQADIKHWPFRVMADSANKPQIVVQFKGETKKFYAEE  124

Query  124  ISSMVLIKMRE------------------DAGAIAGLNVLRIINEPTAAAIAYGLDKKGG  165
            ISSMVL KMR+                  DAGAIAGLNVLRIINEPTAAAIAYGLD+KGG
Sbjct  125  ISSMVLTKMRDVAEAFIGKQVKNARQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRKGG  184

Query  166  ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRK  225
            E NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV++F  EFKRKHRK
Sbjct  185  EHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYFVGEFKRKHRK  244

Query  226  DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFR  285
            D+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++G+DFNSTITRARFED+C D+FR
Sbjct  245  DMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGVDFNSTITRARFEDLCADFFR  304

Query  286  KTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAY  345
            KTMEPVE+VLRDAKLSK+QV EVVLVGGSTRIPK+QQLLSDFFNGKE  KSINPDEAVA+
Sbjct  305  KTMEPVERVLRDAKLSKNQVQEVVLVGGSTRIPKIQQLLSDFFNGKELYKSINPDEAVAF  364

Query  346  GATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFST  405
            GATVQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTFST
Sbjct  365  GATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTFST  424

Query  406  YADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSA  465
            YADNQPGVLIQVFEGER+MTRDN+LLGKF+LD +PPMPRGVPQIDVTFDIDANGILNVSA
Sbjct  425  YADNQPGVLIQVFEGERTMTRDNHLLGKFSLDALPPMPRGVPQIDVTFDIDANGILNVSA  484

Query  466  VEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLR  525
            VEKSTGKENKITITNDKGRLSQ +IDRMVSEAE YK +DE NK R+EAKN LENYA++LR
Sbjct  485  VEKSTGKENKITITNDKGRLSQQEIDRMVSEAETYKDQDERNKLRVEAKNGLENYAFTLR  544

Query  526  NSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKM  585
            NSL D+K+  K+ + DKK + D + EV+ WLD +Q+ EK+ Y++KQKELE VA P+LQKM
Sbjct  545  NSLQDDKVTAKLGDEDKKTLGDAIAEVVAWLDGHQAAEKEEYDAKQKELENVATPILQKM  604

Query  586  Y  586
            Y
Sbjct  605  Y  605

>HYAP_01537
Length=651

 Score = 981 bits (2535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/616 (81%), Positives = 541/616 (88%), Gaps = 31/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MT++ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT+SERLIGDAAK
Sbjct  1    MTESVT-GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTESERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP VQ+DIKHWPF+VT  + DKPQ+ VQFKGE+K FQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPEVQSDIKHWPFKVTRDSADKPQVEVQFKGETKRFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREIAEAYIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLLSIE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LVDHF  EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSL DGIDFN+T
Sbjct  240  LVDHFVSEFKRKHRKDMTLNQRALRRLRTACERAKRTLSTSAQAYIEIDSLLDGIDFNTT  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+C D+FRKTMEPV +VLRD+KLSK +VHE+VLVGGSTRIPKVQQLL DFFNG
Sbjct  300  ITRARFEDLCADFFRKTMEPVAQVLRDSKLSKGEVHEIVLVGGSTRIPKVQQLLIDFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE  KSINPDEAVAYGATVQAAILSG  +S KLQDLLLLDV PLSLGLETAGGVMT LI 
Sbjct  360  KELFKSINPDEAVAYGATVQAAILSGGGASSKLQDLLLLDVAPLSLGLETAGGVMTKLIP  419

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVP KKSQ+FSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LDGIPPMPRGVPQID
Sbjct  420  RNTTVPAKKSQSFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFSLDGIPPMPRGVPQID  479

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV++AE YK +DE NK R
Sbjct  480  VTFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVNDAETYKDQDERNKLR  539

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            +E+KN LENYA+S+R S++DEK+  K+   DKK V+DKV E++QWLDAN S EK+  ++K
Sbjct  540  VESKNGLENYAFSVRTSVSDEKIAVKLSTDDKKIVEDKVAEILQWLDANHSAEKEEIDAK  599

Query  571  QKELEGVANPVLQKMY  586
            QKELEGVANP++QK+Y
Sbjct  600  QKELEGVANPIMQKIY  615

>PYAP_17333
Length=657

 Score = 979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/616 (80%), Positives = 544/616 (88%), Gaps = 30/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M+ A  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT +ERLIGDAAK
Sbjct  1    MSDAPVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGTERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKF DPVVQAD+KHWPFQV +G  DKPQI V+FKGESK F 
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFRDPVVQADLKHWPFQVVAGPDDKPQIIVEFKGESKRFY  120

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
             EEISSMVL KMR+                              DAGAIAGLNVLRIINE
Sbjct  121  AEEISSMVLTKMRDIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV++F  EFKRKHR+D++ NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++GIDFNST
Sbjct  241  LVEYFVGEFKRKHRRDMSNNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGIDFNST  300

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+CGD+FRKTMEPVE+VLRD+KLSKSQV EVVLVGGSTRIPK+QQ+LSD+FNG
Sbjct  301  ITRARFEDLCGDFFRKTMEPVERVLRDSKLSKSQVQEVVLVGGSTRIPKIQQMLSDYFNG  360

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE  KSINPDEAVA+GATVQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KELYKSINPDEAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LDG+PPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDGLPPMPRGVPQID  480

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMV EAEKYK +DE NK R
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVQEAEKYKDQDERNKLR  540

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            +EAKNALENYA+SLR+++ DEK+  K+ + DKK +D  V  VI+WLD +Q+ EK+ Y++K
Sbjct  541  VEAKNALENYAFSLRSAVQDEKLVMKLDQDDKKTIDSAVNGVIEWLDQHQAAEKEEYDAK  600

Query  571  QKELEGVANPVLQKMY  586
             KELEGVANP++QK+Y
Sbjct  601  MKELEGVANPIMQKLY  616

>PITG_11252
Length=654

 Score = 978 bits (2528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/610 (80%), Positives = 539/610 (88%), Gaps = 30/610 (5%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFD KRLIGRKF+DP VQ+DIKHWPF V  GA  KPQ+ VQFKGE KTFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFTDPEVQSDIKHWPFNVIRGAESKPQVVVQFKGEKKTFQPEEISS  125

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVLIKMRE                              DAGAIAGLNVLRIINEPTAAAI
Sbjct  126  MVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185

Query  157  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  216
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV+ F 
Sbjct  186  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEFFV  245

Query  217  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  276
             EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRARF
Sbjct  246  TEFKRKHRKDMTSNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNSTITRARF  305

Query  277  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  336
            ED+C +YFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIPKVQQLL DFFNGKE  KS
Sbjct  306  EDLCSEYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPKVQQLLKDFFNGKELFKS  365

Query  337  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  396
            INPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAGGVMT LI RNTTVP
Sbjct  366  INPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVP  425

Query  397  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  456
            +KK+Q+FSTYADNQ GVLIQVFEGER+MTRDN+ LGKFNLDGIPPMPRGVPQIDVTFD+D
Sbjct  426  SKKTQSFSTYADNQSGVLIQVFEGERTMTRDNHHLGKFNLDGIPPMPRGVPQIDVTFDVD  485

Query  457  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNA  516
             NGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV++AEKYK +DE NK R+E+KNA
Sbjct  486  VNGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVADAEKYKDQDERNKLRVESKNA  545

Query  517  LENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEG  576
            LENYA+SLRNS  +EK+  K+ E DKK+++DKV E + WLDANQ+ EK+ +++KQ+ELEG
Sbjct  546  LENYAFSLRNSTREEKIAAKLSEEDKKSIEDKVAETLHWLDANQAAEKEEFDAKQQELEG  605

Query  577  VANPVLQKMY  586
            VANP+LQK+Y
Sbjct  606  VANPILQKIY  615

>H257_12958
Length=649

 Score = 972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/613 (80%), Positives = 539/613 (88%), Gaps = 30/613 (5%)

Query  4    ATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63
            AT    SVGIDLGTTYSCVG WQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  2    ATKPEQSVGIDLGTTYSCVGTWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEE  123
            AMN  NTVFDAKRLIGRKF+DP++QADIKHWPF+V +GAGDKPQI V+FKGE KTFQPEE
Sbjct  62   AMNPSNTVFDAKRLIGRKFNDPMIQADIKHWPFKVIAGAGDKPQIVVEFKGERKTFQPEE  121

Query  124  ISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTA  153
            ISSMVLIKM+E                              DAGAIAGL V+RIINEPTA
Sbjct  122  ISSMVLIKMKEVAEAYLGLDVQNAVITVPAYFNDSQRQATKDAGAIAGLTVMRIINEPTA  181

Query  154  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  213
            AAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVD
Sbjct  182  AAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVD  241

Query  214  HFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  273
            HF  EFKRK+RKD+  NQRALRRLRTA ERAKRTLSSS QA++EIDSLFDGID+N+TITR
Sbjct  242  HFVDEFKRKYRKDMKTNQRALRRLRTASERAKRTLSSSTQAHLEIDSLFDGIDYNTTITR  301

Query  274  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  333
            ARFED+C DYFRKTM PVE VLRDAKLSK+QV+EVVLVGGSTRIPKVQQLLSDFFNGKE 
Sbjct  302  ARFEDLCSDYFRKTMGPVETVLRDAKLSKNQVNEVVLVGGSTRIPKVQQLLSDFFNGKEL  361

Query  334  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  393
             KSINPDEAVA+GATVQAAILSG   S+KLQDLLLLDVTPLSLGLETAGGVMTTLIARNT
Sbjct  362  YKSINPDEAVAFGATVQAAILSGTSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLIARNT  421

Query  394  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  453
            TVPTKKSQTFSTYADNQPGVLIQVFEGER MT+DNNLLGKF+LDG+PPMPRG+PQ+DVTF
Sbjct  422  TVPTKKSQTFSTYADNQPGVLIQVFEGERVMTKDNNLLGKFSLDGLPPMPRGMPQVDVTF  481

Query  454  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEA  513
            DIDANGILNVSAVEKSTGKENKITITNDKGRLS+ +IDRMV++AEKYK+EDE N+ RIEA
Sbjct  482  DIDANGILNVSAVEKSTGKENKITITNDKGRLSKDEIDRMVNDAEKYKAEDEKNRARIEA  541

Query  514  KNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKE  573
            KN LENYAYSLRN+LND+K+K  +  ADKK ++DKV + I W+D N + EKD +E+KQ+E
Sbjct  542  KNGLENYAYSLRNTLNDDKIKGAVDPADKKTLEDKVADTIAWMDRNLAAEKDEFEAKQQE  601

Query  574  LEGVANPVLQKMY  586
            LE VANP++QK+Y
Sbjct  602  LESVANPIMQKLY  614

>PHYSO_482793
Length=658

 Score = 969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/616 (80%), Positives = 542/616 (88%), Gaps = 31/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MT+  T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTEPVT-GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPF+V  G  +KPQ+ VQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVARGPENKPQLVVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV++F QEFKRKHR+D++ N RA+RRLRTACERAKRTLS+SAQAYIEIDSL DG DFNST
Sbjct  240  LVEYFVQEFKRKHRRDLSVNSRAMRRLRTACERAKRTLSTSAQAYIEIDSLLDGTDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+C ++FRKTM+PV +VLRD+KLSK+QV+EVVLVGGSTRIPKVQQLL DFFNG
Sbjct  300  ITRARFEDLCNEFFRKTMDPVAQVLRDSKLSKNQVNEVVLVGGSTRIPKVQQLLVDFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE  KSINPDEAVAYGATVQAAILSGNDSS KLQDLLLLDV PLSLGLETAGGVMT LI 
Sbjct  360  KELFKSINPDEAVAYGATVQAAILSGNDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIP  419

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTT+P+KK+Q+FSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQID
Sbjct  420  RNTTIPSKKTQSFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQID  479

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV++AEKYK +DE NK R
Sbjct  480  VTFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVADAEKYKDQDERNKLR  539

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IE+KNALENYA+SLR+S  +EK+  K+ E DKK ++ KV + + WLDANQ+ EK+ +++K
Sbjct  540  IESKNALENYAFSLRSSTREEKLAAKLSEDDKKTIEYKVADTLHWLDANQAAEKEEFDAK  599

Query  571  QKELEGVANPVLQKMY  586
            Q+ELE +ANP+LQK+Y
Sbjct  600  QQELESMANPILQKVY  615

>H310_09557
Length=644

 Score = 966 bits (2497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/607 (80%), Positives = 540/607 (89%), Gaps = 30/607 (5%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
            SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN  N
Sbjct  7    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  66

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TVFDAKRLIGRKF+DP++QADIKHWPF+V +G GDKPQI V+FKGESKTFQPEEISSMVL
Sbjct  67   TVFDAKRLIGRKFNDPMIQADIKHWPFKVVAGPGDKPQIVVEFKGESKTFQPEEISSMVL  126

Query  130  IKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
            IKM++                              DAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  127  IKMKQVAEAFIGVEVQNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  186

Query  160  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  219
            LDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAG+THLGGEDFDNRLVDHFT EF
Sbjct  187  LDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGNTHLGGEDFDNRLVDHFTDEF  246

Query  220  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  279
            KRK++ D+  NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDG+D+N+TITRARFED+
Sbjct  247  KRKYKGDLKTNQRALRRLRTACERAKRTLSSSTQAYLEIDSLFDGMDYNTTITRARFEDL  306

Query  280  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINP  339
            C DYFRKTMEPV+ VL+DAKLSK+QVHEVVLVGGSTRIPKVQQLLSDFF+GKE  KSINP
Sbjct  307  CSDYFRKTMEPVKSVLQDAKLSKNQVHEVVLVGGSTRIPKVQQLLSDFFHGKELYKSINP  366

Query  340  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  399
            DEAVA+GATVQAAILSG+  S+KLQDLLLLDVTPLSLGLETAGGVMTTLI+RNTTVPTKK
Sbjct  367  DEAVAFGATVQAAILSGSSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLISRNTTVPTKK  426

Query  400  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  459
            SQTFSTYADNQPGVLIQV+EGER+MT DN+LLGKF+LDG+PPMPRGVPQ+DVTFDIDANG
Sbjct  427  SQTFSTYADNQPGVLIQVYEGERTMTHDNHLLGKFSLDGLPPMPRGVPQVDVTFDIDANG  486

Query  460  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALEN  519
            ILNVSAVEKSTGKENKITITNDKGRLS+ +I+RMV++AEKYK+ED  NK+R+EAKN LEN
Sbjct  487  ILNVSAVEKSTGKENKITITNDKGRLSKDEIERMVNDAEKYKAEDTKNKERVEAKNGLEN  546

Query  520  YAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVAN  579
            YAYSLRN+L +EK++  +   DKK ++DKV ++I W+D N + EKD YE KQ+ELE VAN
Sbjct  547  YAYSLRNTLQEEKIQGAMDAGDKKVLEDKVHDIISWMDRNLAAEKDEYEGKQQELESVAN  606

Query  580  PVLQKMY  586
            P+LQK++
Sbjct  607  PILQKVH  613

>PHALS_09802
Length=651

 Score = 958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/610 (79%), Positives = 537/610 (88%), Gaps = 30/610 (5%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  66
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  6    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
            AHNTVFD KRLIGRKF+D  VQ+DIKHWPF+V  G  +KPQ+ VQFKGESKTFQPEEISS
Sbjct  66   AHNTVFDVKRLIGRKFADSEVQSDIKHWPFKVVCGPENKPQVVVQFKGESKTFQPEEISS  125

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVLIKMRE                              DAGAIAGLNVLRIINEPTAAAI
Sbjct  126  MVLIKMREIAEAFIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185

Query  157  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  216
            AYGLDKKGGE +VLIFDLGGGTFDVSLL+IEEGIFEV ATAGDTHLGGEDFDNRLV++F 
Sbjct  186  AYGLDKKGGEHHVLIFDLGGGTFDVSLLTIEEGIFEVMATAGDTHLGGEDFDNRLVEYFV  245

Query  217  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  276
             EFKRKHRKD++ NQRALRRLRTACERAKRTLS+SAQAY+EIDSLFDGIDFNSTITRARF
Sbjct  246  AEFKRKHRKDLSVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLFDGIDFNSTITRARF  305

Query  277  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  336
            ED+C +YFRKTM+PV +VLRD+KLSKSQV+E+VLVGGSTRIPKVQQ+L DFFNGK+  KS
Sbjct  306  EDLCAEYFRKTMDPVAQVLRDSKLSKSQVNEIVLVGGSTRIPKVQQMLMDFFNGKDLFKS  365

Query  337  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  396
            INPDEAVAYGATVQAAILSG++SS KLQDLLLLDV PLSLGLETAGGVMT LI RNTTVP
Sbjct  366  INPDEAVAYGATVQAAILSGSESSAKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVP  425

Query  397  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  456
             KK Q+FSTY DNQ GVLIQVFEGER+MTRDN+LLGKF+LDGIPPMPRGVPQIDVTFD+D
Sbjct  426  AKKMQSFSTYTDNQSGVLIQVFEGERTMTRDNHLLGKFSLDGIPPMPRGVPQIDVTFDVD  485

Query  457  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNA  516
             NGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMV++A+KYK +DE NK RIE+KN+
Sbjct  486  VNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADADKYKDQDERNKLRIESKNS  545

Query  517  LENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEG  576
            LEN+A+SLR+S+NDEK+  KI   D+K +D KV E +QWL+ANQ+ EK  +++KQ+ELEG
Sbjct  546  LENFAFSLRSSINDEKVVAKISAEDRKLIDGKVAETLQWLEANQAAEKGEFDAKQQELEG  605

Query  577  VANPVLQKMY  586
            VANP++QKMY
Sbjct  606  VANPIMQKMY  615

>PHYRA_71655
Length=653

 Score = 950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/616 (78%), Positives = 535/616 (87%), Gaps = 31/616 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MT++ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTESVT-GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFD KRLIGRKF+DP VQ+DI+HWPF+V  G  +KP++ VQFKGE  TFQ
Sbjct  60   NQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVL+KMRE                              DAG IAGLNVLRIINE
Sbjct  120  PEEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV+ F QEFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNST
Sbjct  240  LVEFFVQEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPKVQQLL DFFNG
Sbjct  300  ITRARFEDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPKVQQLLIDFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            K+  KSINPDEA+AYGATVQAAILSG+DSS KLQDLLLLDV PLSLGLETAGGVMT LI 
Sbjct  360  KKLFKSINPDEAIAYGATVQAAILSGHDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIP  419

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVP KK+Q+FSTYADNQ GVLIQVFEGERSMT DN+LLGKFNLDGIPPMPRGVPQID
Sbjct  420  RNTTVPAKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQID  479

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFD+D NGILNVSAVEKSTGKENKI ITNDKGRLSQ++I+RMV +AEKYK +DE NK R
Sbjct  480  VTFDVDVNGILNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLR  539

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IE+KNALENYA+SLR+S  DEK+  K+ + DKK ++DKV E + WLDANQ+  K+ +++K
Sbjct  540  IESKNALENYAFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAK  599

Query  571  QKELEGVANPVLQKMY  586
            Q+ELEGV NP++QK+Y
Sbjct  600  QQELEGVTNPIMQKIY  615

>PYIR_15857
Length=577

 Score = 949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/586 (83%), Positives = 517/586 (88%), Gaps = 46/586 (8%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M QA  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQAV-AGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF+V+ GAGDKPQITV+FKGE+KTFQ
Sbjct  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQ  119

Query  121  PEEISSMVLIKMREDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  180
            PEEISSMVLIKMRE + A  G                                       
Sbjct  120  PEEISSMVLIKMREVSEAFIG---------------------------------------  140

Query  181  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  240
                  +EGIFEVKATAGDTHLGGEDFDNRLVDHF  EFKRKHRKDIT NQRALRRLRTA
Sbjct  141  ------KEGIFEVKATAGDTHLGGEDFDNRLVDHFVGEFKRKHRKDITSNQRALRRLRTA  194

Query  241  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL  300
            CERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRARFEDMCGDYFRKTM+PVEKVLRD+KL
Sbjct  195  CERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRARFEDMCGDYFRKTMDPVEKVLRDSKL  254

Query  301  SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdss  360
            SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP K+INPDEAVA+GATVQAAILSGND S
Sbjct  255  SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKAINPDEAVAFGATVQAAILSGNDQS  314

Query  361  eklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG  420
            EKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG
Sbjct  315  EKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG  374

Query  421  ERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  480
            ERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN
Sbjct  375  ERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  434

Query  481  DKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEA  540
            DKGRLSQADIDRMV+EAEKYK+EDE+NK RIEAKN LENYAY+LRN+L+DEK+K +I E 
Sbjct  435  DKGRLSQADIDRMVAEAEKYKAEDESNKVRIEAKNGLENYAYNLRNTLDDEKLKSQISEE  494

Query  541  DKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
            D+ A++DKVTE I WLDANQS EK+ +E+KQKELEG+ANP+LQKMY
Sbjct  495  DRSAINDKVTETINWLDANQSAEKEEFEAKQKELEGIANPILQKMY  540

>PHYKE_7016
Length=650

 Score = 949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/617 (78%), Positives = 538/617 (87%), Gaps = 31/617 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M+ +  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSSSVVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFDAKRLIGRKFSD  VQ+DIKHWPF+V  G  +KPQ+ VQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDLEVQSDIKHWPFKVVRGPDNKPQVVVQFKGESKTFQ  120

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKK GE NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKRGEHNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV++F  +FKRKHRKD++ + RA+RRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNST
Sbjct  241  LVEYFVTDFKRKHRKDMSTSSRAMRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNST  300

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFE +C D+FRKTMEPV +VL DAKLSK  V EVVLVGGSTRIPKVQQLL+DFF+G
Sbjct  301  ITRARFESLCDDFFRKTMEPVAQVLHDAKLSKGHVQEVVLVGGSTRIPKVQQLLTDFFHG  360

Query  331  KEPNKSINPDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLI  389
            KE  KSINPDEAVA+GATVQAAILSG  D+S KLQDLLLLDV PLSLGLETAGGVMTTLI
Sbjct  361  KELFKSINPDEAVAFGATVQAAILSGAGDTSSKLQDLLLLDVAPLSLGLETAGGVMTTLI  420

Query  390  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  449
            ARNTTVP+KKSQTFSTY+DNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPM RG+PQI
Sbjct  421  ARNTTVPSKKSQTFSTYSDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMRRGIPQI  480

Query  450  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQ  509
            DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMV+EA+K+K +D  NK 
Sbjct  481  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQDEIDRMVAEADKFKDQDARNKL  540

Query  510  RIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYES  569
            RIE+KN++ENYA+SLR+S+ +EK+  K+   DK+ ++DKV EV+ WL+ NQ+ EK+ +++
Sbjct  541  RIESKNSVENYAFSLRSSIREEKLAVKLTAEDKQVIEDKVAEVLSWLEVNQAAEKEEFDA  600

Query  570  KQKELEGVANPVLQKMY  586
            KQKELE VANP+++K++
Sbjct  601  KQKELEDVANPIMEKIF  617

>PHYCA_104444
Length=644

 Score = 948 bits (2451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/617 (77%), Positives = 529/617 (86%), Gaps = 32/617 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MT+A T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTEAVT-GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPF++  G   KP + VQFKGE +TFQ
Sbjct  60   NQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKLVRGPESKPLVEVQFKGEKRTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVL+KMRE                              DAG IAGLNVLRIINE
Sbjct  120  PEEISSMVLVKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV+ F  EFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDGIDFNST
Sbjct  240  LVEFFVLEFKRKYRKDMTGNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGIDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+C +YFRKTM PV +VL+D+KLSK+ V+EVVLVGGSTRIPKVQQLL +FFNG
Sbjct  300  ITRARFEDLCSEYFRKTMGPVAQVLQDSKLSKNHVNEVVLVGGSTRIPKVQQLLMEFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp-lslglETAGGVMTTLI  389
            KE  KSINPDEAVAYGATVQAAILSG+ +       LLL     LSLGLETAGGVMT LI
Sbjct  360  KELFKSINPDEAVAYGATVQAAILSGSGNMSSKLQDLLLLDVAPLSLGLETAGGVMTKLI  419

Query  390  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  449
             RNTTVP KK+Q+FSTY+DNQ GVLIQVFEGERS+T+DN+LLGKFNLDGIPPM RGVPQI
Sbjct  420  PRNTTVPAKKTQSFSTYSDNQSGVLIQVFEGERSLTQDNHLLGKFNLDGIPPMQRGVPQI  479

Query  450  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQ  509
            DVTFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMV++AEKYK +DE NK 
Sbjct  480  DVTFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKL  539

Query  510  RIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYES  569
            RIE+KNALENYA+SLR+S+ ++K+  K+  ADKK ++DKV E +QWLDANQ+ EK+ ++S
Sbjct  540  RIESKNALENYAFSLRSSMKEDKLATKLSAADKKTIEDKVAETLQWLDANQAAEKEEFDS  599

Query  570  KQKELEGVANPVLQKMY  586
            KQ+ELEGVANP++QK+Y
Sbjct  600  KQQELEGVANPIMQKVY  616

>CCA14967
Length=1431

 Score = 940 bits (2430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/575 (83%), Positives = 511/575 (89%), Gaps = 30/575 (5%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
             IDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNA NTV
Sbjct  22   SIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAINTV  81

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            FDAKRLIGR+ SDPVVQADIKHWPF+VTS  GDKP ITVQ+KGE+K+F+PEEISSMVLIK
Sbjct  82   FDAKRLIGRRCSDPVVQADIKHWPFKVTSCEGDKPMITVQYKGETKSFRPEEISSMVLIK  141

Query  132  MRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYGLD  161
            MRE                              DAGAIAGLNVLRIINEPTAAAIAYGLD
Sbjct  142  MREIAQAYLGNDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  201

Query  162  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  221
            +KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF  EF R
Sbjct  202  RKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVAEFNR  261

Query  222  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  281
            KHRKDI  NQRALRRLRTACERAKRTLSSSAQA IEIDSLF+G+DFNSTITRARFED+CG
Sbjct  262  KHRKDIATNQRALRRLRTACERAKRTLSSSAQAQIEIDSLFEGVDFNSTITRARFEDLCG  321

Query  282  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDE  341
            DYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGK+  KSINPDE
Sbjct  322  DYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKDLCKSINPDE  381

Query  342  AVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQ  401
            AVA+GATVQAAILSG + SEKLQDLLLLDV PLSLGLETAGGVMTTLI RNTT+PTKKSQ
Sbjct  382  AVAFGATVQAAILSGTEKSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTLPTKKSQ  441

Query  402  TFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGIL  461
            TFSTY +NQPGV IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+VTFDIDANGIL
Sbjct  442  TFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVTFDIDANGIL  501

Query  462  NVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYA  521
            NVSAVEKST KENKITITNDKGRLSQADID MVSEAEKYK EDEAN+ R+EAKN LENY 
Sbjct  502  NVSAVEKSTNKENKITITNDKGRLSQADIDLMVSEAEKYKKEDEANRIRVEAKNGLENYT  561

Query  522  YSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWL  556
            ++LR++L+DEK+K +I   D+  +++KV EV+ WL
Sbjct  562  FNLRSTLDDEKIKNQISPEDRTTIENKVKEVVSWL  596

>PYIR_15859
Length=626

 Score = 930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/595 (81%), Positives = 521/595 (88%), Gaps = 21/595 (4%)

Query  4    ATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63
            A  +G +VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  7    AQVTGQTVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  66

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEE  123
            AMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF+V+ GAGDKPQITV+FKGE+KTFQPEE
Sbjct  67   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQPEE  126

Query  124  ISSMVLIKMREDAGAIAGLNVLR-IINEPTA-----------AAIAYGLDKKGGERNVLI  171
            ISSMVLIKM+E + A  G  V   +I  P             A +  GL+  GGE NVLI
Sbjct  127  ISSMVLIKMKEISEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVIAGLN--GGEHNVLI  184

Query  172  FDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQ  231
            FDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV+ FT EFKRK +KD+T+NQ
Sbjct  185  FDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEFFTAEFKRKFKKDMTQNQ  244

Query  232  RALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPV  291
            R+LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED+C DYFRKTMEPV
Sbjct  245  RSLRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDLCADYFRKTMEPV  304

Query  292  EKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQA  351
            E+VLRDAKLSK QV+E+VLVGGSTRIPKVQQ+LSDFFNGK+  KSINPDEAVA+GATVQA
Sbjct  305  ERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSDFFNGKDLYKSINPDEAVAFGATVQA  364

Query  352  AILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQP  411
            AILSG D S +LQDLLLLDV PLSLGLETAGGVMTTLI            TFSTYADNQP
Sbjct  365  AILSGADKSSRLQDLLLLDVAPLSLGLETAGGVMTTLIP-------XXXXTFSTYADNQP  417

Query  412  GVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTG  471
            GVLIQVFEGER+MTRDN+ LGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTG
Sbjct  418  GVLIQVFEGERTMTRDNHSLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTG  477

Query  472  KENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDE  531
            KENKITITNDKGRLSQ DIDRMV+EAEKYK  DE NK R+EAKNALENYAY LRNSL +E
Sbjct  478  KENKITITNDKGRLSQEDIDRMVAEAEKYKDADERNKLRVEAKNALENYAYGLRNSLQEE  537

Query  532  KMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
            K++ K+   DKK VDDK+TE I WLDANQ+ EK+ +++KQKELEGVANP+LQKMY
Sbjct  538  KIQAKLSADDKKRVDDKITETIAWLDANQAAEKEEFDAKQKELEGVANPILQKMY  592

>H257_17322
Length=606

 Score = 916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/609 (79%), Positives = 507/609 (83%), Gaps = 73/609 (12%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+D V+QADIKHWPF+VT GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDSVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            VLIKM+E                              DAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  158  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  278  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  337
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPK                  
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPK------------------  347

Query  338  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
                        QAAILSGNDSSEKLQDLLLLDVTPL L LETAGGVM TLI RNTTVPT
Sbjct  348  ----------PWQAAILSGNDSSEKLQDLLLLDVTPLLLTLETAGGVMATLIQRNTTVPT  397

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
            KKSQTFST A+NQ GVLIQVF                 LDGIPPMPRGVP +DVTFDIDA
Sbjct  398  KKSQTFSTCANNQSGVLIQVFRW---------------LDGIPPMPRGVPHVDVTFDIDA  442

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNAL  517
            NGILNVSA+EKSTGKENKITITNDKGRLS+ DI+RMV EAEKYKSEDEANK RIEAKN L
Sbjct  443  NGILNVSAIEKSTGKENKITITNDKGRLSKDDIERMVQEAEKYKSEDEANKLRIEAKNGL  502

Query  518  ENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGV  577
            ENYAY+LRN+LNDEK++ K+ EADKK VDDKVTE I WLDANQS EK+ YE+KQKELEGV
Sbjct  503  ENYAYNLRNTLNDEKLQGKLDEADKKVVDDKVTETINWLDANQSAEKEEYEAKQKELEGV  562

Query  578  ANPVLQKMY  586
            ANP++QK+Y
Sbjct  563  ANPIMQKLY  571

>CCI40247
Length=643

 Score = 915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/617 (73%), Positives = 512/617 (83%), Gaps = 31/617 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MT+   SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT +ERLIG+AAK
Sbjct  1    MTEKAVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKF D  VQ D KHWPF+V  G  DKPQI V+ KG  K F 
Sbjct  61   NQVAMNAENTVFDAKRLIGRKFHDQAVQQDTKHWPFRVVCGPEDKPQIVVEVKGAKKMFY  120

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
             EEIS+MVL KMRE                              DAG IAG+NVLRI+NE
Sbjct  121  AEEISAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNE  180

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDNR  240

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV+HF  EFKRK+RKD+++NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNST
Sbjct  241  LVEHFLAEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNST  300

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+C DYFRKTMEPVEKVLRDAKL+K+Q+HE+VLVGGSTRIPKVQQ+LSDFFNG
Sbjct  301  ITRARFEDLCSDYFRKTMEPVEKVLRDAKLAKNQLHEIVLVGGSTRIPKVQQMLSDFFNG  360

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp-lslglETAGGVMTTLI  389
            KE  KSINPDEAVAYGATVQAAILSG     +    ++L     LS+GLETAGGVMT LI
Sbjct  361  KELYKSINPDEAVAYGATVQAAILSGGSDQSERLQNVVLLDVAPLSMGLETAGGVMTVLI  420

Query  390  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  449
            ARNTTVPT+KSQTFSTYADNQ GVLIQV+EGERSMTRDN+LLGKFNL+GIPPMPRGVPQI
Sbjct  421  ARNTTVPTRKSQTFSTYADNQSGVLIQVYEGERSMTRDNHLLGKFNLEGIPPMPRGVPQI  480

Query  450  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQ  509
            +VTF++DANGIL+V+AVEKSTGKENKITITNDKGRLS+ +IDRMV EA+ YK +DE NK 
Sbjct  481  EVTFEVDANGILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKL  540

Query  510  RIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYES  569
            R+E+KN LE+Y + +RN++ D K+   + + DKK ++ K+ + I WLD + + E+D +ES
Sbjct  541  RVESKNKLESYVFQVRNTIRDGKIAGNLSDEDKKQMESKIEDTISWLDQHSAAERDEFES  600

Query  570  KQKELEGVANPVLQKMY  586
            KQKE+E + NP+LQK Y
Sbjct  601  KQKEIESMVNPLLQKAY  617

>PPTG_19690
Length=566

 Score = 911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/565 (83%), Positives = 501/565 (89%), Gaps = 31/565 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MT+  T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTEKVT-GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPF+V  GA +KPQ+ VQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV++F QEFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAY+EIDSL DGIDFNST
Sbjct  240  LVEYFVQEFKRKYRKDMTVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLLDGIDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+C DYFRKTMEPV +VLRD+KLSK+QV E+VLVGGSTRIPKVQQLL  FFNG
Sbjct  300  ITRARFEDLCSDYFRKTMEPVAQVLRDSKLSKNQVDEIVLVGGSTRIPKVQQLLMGFFNG  359

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            K+  KSINPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAGGVMT LI 
Sbjct  360  KDLFKSINPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIP  419

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNTTVP KK+QTFSTY DNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQID
Sbjct  420  RNTTVPAKKTQTFSTYTDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQID  479

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMV++AEKYK +DE NK R
Sbjct  480  VTFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKLR  539

Query  511  IEAKNALENYAYSLRNSLNDEKMKE  535
            IE+KNALENYA+SLRNS  +EK +E
Sbjct  540  IESKNALENYAFSLRNSTREEKGQE  564

>CCA16151
Length=643

 Score = 909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/617 (74%), Positives = 522/617 (85%), Gaps = 31/617 (5%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M + T SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT +ERLIG+AAK
Sbjct  1    MVETTVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKF D  VQ D KHWPF V  G  DKPQI V+  G  K F 
Sbjct  61   NQVAMNAENTVFDAKRLIGRKFHDQTVQQDTKHWPFSVVCGPEDKPQIVVEVNGAKKMFY  120

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
             EEIS+MVL KMRE                              DAG IAG+NVLRI+NE
Sbjct  121  AEEISAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNE  180

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDNR  240

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV+HF  EFKRK+RKD+++NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNST
Sbjct  241  LVEHFLTEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNST  300

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+C DYFRKTM+PVE+VLRDAKLSK+Q++E+VLVGGSTRIPKVQQLLSDFFNG
Sbjct  301  ITRARFEDLCSDYFRKTMDPVERVLRDAKLSKNQLNEIVLVGGSTRIPKVQQLLSDFFNG  360

Query  331  KEPNKSINPDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLI  389
            KE  KSINPDEAVAYGATVQAAILSG +D SE+LQ+++LLDV PLS+GLETAGGVMT LI
Sbjct  361  KELYKSINPDEAVAYGATVQAAILSGASDQSERLQNVVLLDVAPLSMGLETAGGVMTVLI  420

Query  390  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  449
             RNTTVPT+KSQTFSTYADNQPGVLIQV+EGER+MTRDN+LLGKFNL+ IPPMPRGVPQI
Sbjct  421  PRNTTVPTRKSQTFSTYADNQPGVLIQVYEGERTMTRDNHLLGKFNLEEIPPMPRGVPQI  480

Query  450  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQ  509
            +VTF++DANGIL+V+AVEKSTGKENKITITNDKGRLS+ +IDRMV EA+ YK +DE NK 
Sbjct  481  EVTFEVDANGILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKL  540

Query  510  RIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYES  569
            R+E KN LE+Y + +RN++ D+K+ +K+ + +KK V+ K+ E I WLD N + E+D +ES
Sbjct  541  RVECKNKLESYVFHVRNTIRDDKIADKLSDEEKKQVESKIEETISWLDQNTAAERDEFES  600

Query  570  KQKELEGVANPVLQKMY  586
            KQK++E + NP+LQK Y
Sbjct  601  KQKDVEDMVNPLLQKAY  617

>HYAP_01540
Length=634

 Score = 905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/598 (81%), Positives = 510/598 (85%), Gaps = 40/598 (7%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
            T S YSVGID+GT YS VGVWQND VEIIA DQGNRT+                    VA
Sbjct  4    TMSDYSVGIDVGTMYSRVGVWQNDSVEIIAKDQGNRTSAV------------------VA  45

Query  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFD KRLIGRKFSD VVQAD+KHWPF++TSGAGDKPQITVQFKGESKTFQ EEI
Sbjct  46   MNAHNTVFDGKRLIGRKFSDAVVQADVKHWPFKLTSGAGDKPQITVQFKGESKTFQSEEI  105

Query  125  SSMVLIKMREDAGAIAGLNVLR-IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSL  183
            SSMVLIKMRE A A  G  V + +I  P     AY  D +  +R  +   L   T  VSL
Sbjct  106  SSMVLIKMREVAEAFMGKEVKKAVITVP-----AYFNDSQR-QRRRMQGPLLDSTCSVSL  159

Query  184  ----LSIEEGIFEVKA-----------TAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDIT  228
                L     ++  +A           TAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDIT
Sbjct  160  TSRRLRPSPTVWTRRAASAMCSSSTWATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDIT  219

Query  229  ENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTM  288
            ENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTM
Sbjct  220  ENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTM  279

Query  289  EPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGAT  348
            EPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGAT
Sbjct  280  EPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGAT  339

Query  349  VQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYAD  408
            VQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTFSTYAD
Sbjct  340  VQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTFSTYAD  399

Query  409  NQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEK  468
            NQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEK
Sbjct  400  NQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEK  459

Query  469  STGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSL  528
            STGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK RIEAKNALENYAY+LRN+L
Sbjct  460  STGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKIRIEAKNALENYAYNLRNTL  519

Query  529  NDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
            NDEK+K++IPE D+KA+DDKVTE I WLDANQS EK+ YE+KQKE+E VANP+LQKMY
Sbjct  520  NDEKLKDQIPEDDRKAIDDKVTETINWLDANQSAEKEEYEAKQKEVESVANPILQKMY  577

>PYVX_22981
Length=612

 Score = 903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/587 (79%), Positives = 516/587 (88%), Gaps = 18/587 (3%)

Query  2    TQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  61
            T +  +G SVGIDLGTTYSCVGVWQN+RVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  8    TSSGVTGQSVGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  67

Query  62   QVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQP  121
            QVAMNA NTVFDAKRLIGRKF+DPVVQ DI+HWPF+V++G+  KPQITVQF+GE KTFQP
Sbjct  68   QVAMNAANTVFDAKRLIGRKFNDPVVQQDIRHWPFKVSAGSDSKPQITVQFQGERKTFQP  127

Query  122  EEISSMVLIKMREDAGAIAGLNVLR-IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  180
            EEISSMVL+KMR+ A A  G  V   +I  P     AY  D    +R          T D
Sbjct  128  EEISSMVLMKMRDVAEAFIGKPVKNAVITVP-----AYFNDS---QRQ--------ATKD  171

Query  181  VSLLS-IEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRT  239
              +++ + EGIFEVKATAGDTHLGGEDFDNRLV+HF  EFKRK+RKD++E+QRALRRLRT
Sbjct  172  AGVIAGLNEGIFEVKATAGDTHLGGEDFDNRLVEHFAAEFKRKYRKDLSESQRALRRLRT  231

Query  240  ACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAK  299
            ACERAKRTLSSSAQAY+EIDSL+DG+DFN+TITRARFE+MCGDYFRKTMEPVE VLRDAK
Sbjct  232  ACERAKRTLSSSAQAYVEIDSLYDGVDFNTTITRARFEEMCGDYFRKTMEPVETVLRDAK  291

Query  300  LSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNds  359
            L K QVHEVVLVGGSTRIPKVQQLLS FFNGKEP KSINPDEAVA+GATVQAAILSG+DS
Sbjct  292  LGKGQVHEVVLVGGSTRIPKVQQLLSQFFNGKEPCKSINPDEAVAFGATVQAAILSGHDS  351

Query  360  seklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  419
            S KLQDLLLLDV PLSLGLETAGGVMTTLI RNTTVP KKSQTFSTYADNQPGVLIQVFE
Sbjct  352  SAKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTVPAKKSQTFSTYADNQPGVLIQVFE  411

Query  420  GERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  479
            GER+MTRDNNLLGKFNLD +PPMPRGVPQIDVTFDIDANGILNV+AVEKSTGKENKITIT
Sbjct  412  GERTMTRDNNLLGKFNLDALPPMPRGVPQIDVTFDIDANGILNVTAVEKSTGKENKITIT  471

Query  480  NDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPE  539
            NDKGRLSQADIDRMV+EAEKYK +DE  KQR+++KN+LENYAY LRNSLND+K+KE++ +
Sbjct  472  NDKGRLSQADIDRMVAEAEKYKQQDEVQKQRVDSKNSLENYAYGLRNSLNDDKIKEQLSD  531

Query  540  ADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
             D+KAVDD+VT+ I WLD+NQ  EKD +++KQKEL  VANP+LQKMY
Sbjct  532  NDRKAVDDQVTQTINWLDSNQMAEKDEFDAKQKELADVANPILQKMY  578

>PYIW_16873
Length=496

 Score = 816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/453 (92%), Positives = 438/453 (97%), Gaps = 0/453 (0%)

Query  134  EDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  193
            +DAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV
Sbjct  5    KDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  64

Query  194  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQ  253
            KATAGDTHLGGEDFDNRLVDHF  EFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQ
Sbjct  65   KATAGDTHLGGEDFDNRLVDHFVGEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQ  124

Query  254  AYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  313
            AYIEIDSLFDG+DFNSTITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGG
Sbjct  125  AYIEIDSLFDGVDFNSTITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGG  184

Query  314  STRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp  373
            STRIPKVQQLLSDFFNGKEP K+INPDEAVA+GATVQAAILSGND SEKLQDLLLLDVTP
Sbjct  185  STRIPKVQQLLSDFFNGKEPCKAINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTP  244

Query  374  lslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGK  433
            LSLGLETAGGVMTTLI+RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGK
Sbjct  245  LSLGLETAGGVMTTLISRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGK  304

Query  434  FNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRM  493
            FNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRM
Sbjct  305  FNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRM  364

Query  494  VSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVI  553
            V+EAEKYK+EDE+NK RIEAKN LENYAY+LRN+L+DEK+K +I E D+ A++DKVTE I
Sbjct  365  VAEAEKYKAEDESNKVRIEAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKVTETI  424

Query  554  QWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
             WLDANQS EK+ +E+KQKELEG+ANP+LQKMY
Sbjct  425  NWLDANQSAEKEEFEAKQKELEGIANPILQKMY  457

>PPTG_02120
Length=1001

 Score = 815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/441 (95%), Positives = 430/441 (98%), Gaps = 0/441 (0%)

Query  146  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  205
            R +  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE
Sbjct  521  RGLYHPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  580

Query  206  DFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  265
            DFDNRLVDHFTQEFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+
Sbjct  581  DFDNRLVDHFTQEFKRKHRKDLTHNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGV  640

Query  266  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  325
            DFNSTITRARFED+C DYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLS
Sbjct  641  DFNSTITRARFEDLCADYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLS  700

Query  326  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  385
            DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM
Sbjct  701  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM  760

Query  386  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG  445
            TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRG
Sbjct  761  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRG  820

Query  446  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  505
            VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDE
Sbjct  821  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDE  880

Query  506  ANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKD  565
            ANK RIEAKNALENYAYSLRNSLNDEKMKEKIPEADKK VDDKVTEVIQWLDANQS EK+
Sbjct  881  ANKVRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDANQSAEKE  940

Query  566  AYESKQKELEGVANPVLQKMY  586
             YESKQKELE VANPVLQK+Y
Sbjct  941  EYESKQKELESVANPVLQKVY  961

>PHALS_04330
Length=785

 Score = 781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/442 (92%), Positives = 410/442 (93%), Gaps = 30/442 (7%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
            + SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF+VTSGAGDKPQI VQFKGESKTFQPEEI
Sbjct  64   MNAHNTVFDAKRLIGRKFSDPLVQADIKHWPFKVTSGAGDKPQIVVQFKGESKTFQPEEI  123

Query  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  364  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  423

Query  395  VPTKKSQTFSTYADNQPGVLIQ  416
            VPTKKSQTFSTYADNQPGVLIQ
Sbjct  424  VPTKKSQTFSTYADNQPGVLIQ  445

>PHYKE_6984
Length=450

 Score = 779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/450 (90%), Positives = 414/450 (92%), Gaps = 31/450 (7%)

Query  1    MTQATTS-GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  59
            M Q TTS GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA
Sbjct  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            KNQVAMNAHNTVFDAKRLIGRKFSDP+VQ+DIKHWPF+++SGAGDKPQITVQFKGESKTF
Sbjct  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
            QPEEISSMVLIKMRE                              DAGAIAG+NVLRIIN
Sbjct  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  269
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300

Query  270  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  329
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360

Query  330  GKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  389
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  361  GKEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  420

Query  390  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  419
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450

>PYAR_18354
Length=1084

 Score = 692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/611 (59%), Positives = 453/611 (74%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  30   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  89

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  PF + +  G KP I V  KGE K F PEEIS+
Sbjct  90   PEKTLFDVKRLIGRPYNDKSVQADKKLLPFDIVNKDG-KPFIQVTIKGEKKQFSPEEISA  148

Query  127  MVLIKMR------------------------------EDAGAIAGLNVLRIINEPTAAAI  156
            MVL KM+                              +DAG IAG+ V RIINEPTAAAI
Sbjct  149  MVLSKMKTIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  208

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LLSI+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  209  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLSIDAGVFEVLATNGDTHLGGEDFDQRVMQYF  268

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++RAR
Sbjct  269  IKKWKKDKNIDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALSRAR  328

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  329  FEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  388

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLSLG+ET GGVMT LI RNT +
Sbjct  389  GVNPDEAVAFGAAVQGGILGGE-QDDTNKDILLIDVAPLSLGIETVGGVMTKLINRNTVI  447

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGERSMT+DN +LGKF L G+PP PRGVPQI+V+F++
Sbjct  448  PTKKSQTFSTYQDNQPAVLIQVFEGERSMTKDNRMLGKFELTGLPPAPRGVPQIEVSFEL  507

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL V A +K TGK  KITIT DKGRLSQ +++RMV EAE++  ED+  K RI+ +N
Sbjct  508  DANGILQVGAEDKGTGKAEKITITADKGRLSQEEVERMVKEAEEFADEDKKIKDRIDGRN  567

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALE Y YSL+NS+ D K+ +KI E DK++V   V + + WL+ NQ  +KD +E+KQKE+E
Sbjct  568  ALEGYLYSLKNSVED-KLADKIEEDDKESVLKAVQDAMDWLEDNQESDKDDFEAKQKEVE  626

Query  576  GVANPVLQKMY  586
             + NP++ K+Y
Sbjct  627  KIVNPIMSKVY  637

>PYU1_G004098
Length=656

 Score = 689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/611 (59%), Positives = 451/611 (74%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KGE K F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRGYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGEKKHFSPEEVSA  146

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            M+L KM++                              DAG IAGL+V RIINEPTAAAI
Sbjct  147  MILTKMKQTAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAI  206

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRVMQFF  266

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKSVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  326

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G  + +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-TDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL V A +K TGK  KITIT +KGRLSQ +IDRMV EA +   ED+  K RI+ +N
Sbjct  506  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  565

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
             LE Y YSL+N++ D KM +KI E DK AV   V + + WL+ NQ  +K+ +E KQKE+E
Sbjct  566  GLEGYLYSLKNTVED-KMADKIEEDDKDAVLKAVQDAMDWLEDNQEADKEDFEGKQKEVE  624

Query  576  GVANPVLQKMY  586
             V NP++ K+Y
Sbjct  625  KVVNPIMAKVY  635

>PHALS_00833
Length=652

 Score = 689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/611 (58%), Positives = 456/611 (75%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEII NDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIPNDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVVIKGEKRQFAPEEVSA  146

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM++                              DAG IAGL V RIINEPTAAAI
Sbjct  147  MVLSKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    DI+ ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNIDISSDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALE Y YSL+N++ +EK+++K+ + DK  V + V + + WL+ NQ  +K+ YE+KQKE+E
Sbjct  566  ALEGYLYSLKNNV-EEKLEDKLNDDDKDTVLNAVQDAMDWLEDNQEADKEDYEAKQKEVE  624

Query  576  GVANPVLQKMY  586
             + NP++ K+Y
Sbjct  625  KLVNPIMSKVY  635

>H310_09434
Length=658

 Score = 689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/611 (59%), Positives = 458/611 (75%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
              NT+FD KRLIGR ++D  VQAD K  PF + +  G +P I V+ KGE+K F PEE+S+
Sbjct  89   PENTLFDVKRLIGRSYNDKSVQADKKLLPFHIVNKDG-RPFIEVKIKGEAKQFSPEEVSA  147

Query  127  MVLIKMR------------------------------EDAGAIAGLNVLRIINEPTAAAI  156
            M+L KM+                              +DAG IAGL V RIINEPTAAAI
Sbjct  148  MILTKMKTIAENYLGKEVHDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD R++  F
Sbjct  208  AYGIDKKAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFDQRIMQFF  267

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             ++++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF+ T+TRAR
Sbjct  268  IKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDFDETLTRAR  327

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ DFFNGKEP++
Sbjct  328  FEELNNDLFKKTLTPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFFNGKEPSR  387

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             INPDEAVAYGA VQ  IL G  +   L ++LLLDV PLSLG+ET GGVMT +I RNT V
Sbjct  388  GINPDEAVAYGAAVQGGILGGE-NDSNLNEILLLDVAPLSLGIETVGGVMTKIINRNTVV  446

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP V IQVFEGER+MT+DN++LGKF L GIPP PRGVPQI+VTF++
Sbjct  447  PTKKSQTFSTYQDNQPAVSIQVFEGERAMTKDNHILGKFELTGIPPAPRGVPQIEVTFEV  506

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK  KITIT +KGRLSQ +IDRMV EAE+   ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKDRIDGRN  566

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            +LE Y Y+L+N++ D K+ +KI EADK  +   V E + WLD NQ  +K+ ++++QK +E
Sbjct  567  SLEGYLYNLKNNVED-KLADKIEEADKDTLLKAVQEAMDWLDENQEADKEDFDAQQKAIE  625

Query  576  GVANPVLQKMY  586
             +ANP++ K+Y
Sbjct  626  KIANPIMAKVY  636

>PYIW_21755
Length=658

 Score = 688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/611 (59%), Positives = 448/611 (73%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  P+ + +  G KP I V  KGE KTF PEE+S+
Sbjct  89   PEQTLFDVKRLIGRGYNDKSVQADKKLLPYNIINKDG-KPLIEVSVKGEKKTFSPEEVSA  147

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            M+L KM++                              DAG IAG+ V RIINEPTAAAI
Sbjct  148  MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  207

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQFF  267

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  327

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    E  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDELTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL V A +K TGK  KITIT +KGRLSQ +IDRMV EA +   ED+  K RI+ +N
Sbjct  507  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  566

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
             LE Y YSL+NS+ D K+ +KI E DK  V   V + + WL+ NQ  +K+ +E+KQKE+E
Sbjct  567  GLEGYLYSLKNSVED-KLADKIEEDDKDTVLKSVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  576  GVANPVLQKMY  586
               NP++ K+Y
Sbjct  626  KAVNPIMAKVY  636

>PHALS_01338
Length=383

 Score = 687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/379 (88%), Positives = 345/379 (91%), Gaps = 31/379 (8%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MTQAT SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQAT-SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMN+ NTVFDAKRLIGRK+SDPVV+ADIKHWPF+VT+G GDKPQITVQFKGE+KTFQ
Sbjct  60   NQVAMNSSNTVFDAKRLIGRKYSDPVVKADIKHWPFKVTAGPGDKPQITVQFKGETKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAYIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LVDHF QEFKRKHRKD+++NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  240  LVDHFVQEFKRKHRKDLSQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359

Query  331  KEPNKSINPDEAVAYGATV  349
            KEPNKSINPDEAVAYGAT+
Sbjct  360  KEPNKSINPDEAVAYGATI  378

>PYVX_16738
Length=658

 Score = 686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/611 (59%), Positives = 449/611 (73%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+ +    G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYADKSVQADKKLLPYHIADKQG-KPFIEVTVKGEKRQFAPEEVSA  146

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM++                              DAG IAG+ V RIINEPTAAAI
Sbjct  147  MVLTKMKQIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  206

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKSVDIGSDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  326

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQ L+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQTLIKDYFNGKEPSR  386

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    E  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGG-ADDELTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL V A +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K+RI+ +N
Sbjct  506  DANGILQVGAEDKGTGKAESITITAEKGRLSQEEIDRMVQEAAEFADEDKLVKERIDGRN  565

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALE Y YSL+N++ D K+ +KI E DK  V   V + + WL+ NQ   K+ +++KQKE+E
Sbjct  566  ALEGYLYSLKNNVED-KLADKIDEDDKDTVLTAVQDAMDWLEDNQEANKEDFDAKQKEVE  624

Query  576  GVANPVLQKMY  586
             V NP++ K+Y
Sbjct  625  KVVNPIMAKVY  635

>PYAP_13341
Length=657

 Score = 686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/611 (58%), Positives = 454/611 (74%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KGE+K F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPFIQVTIKGENKLFAPEEVSA  147

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM++                              DAG I+G+ V RIINEPTAAAI
Sbjct  148  MVLTKMKQIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTISGMTVQRIINEPTAAAI  207

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    DI +++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++RAR
Sbjct  268  IKKWKKDKSIDIGKDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALSRAR  327

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLSLG+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDVTKDILLIDVVPLSLGIETVGGVMTKLINRNTVI  446

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+V+F++
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERTMTKDNRLLGKFELTGLPPAPRGVPQIEVSFEL  506

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL V A +K TGK  KITIT +KGRLSQ +I+RMV EAE++  ED+  K RI+ +N
Sbjct  507  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIERMVKEAEEFADEDKKVKDRIDGRN  566

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
             LE Y YSL+N++ D K+ +KI E DK+ V   V + + WL+ NQ  +K+ +E+KQKE+E
Sbjct  567  GLEGYLYSLKNNVED-KLADKIDEDDKETVLKAVQDAMDWLEDNQDSDKEDFEAKQKEVE  625

Query  576  GVANPVLQKMY  586
             V NP++ K+Y
Sbjct  626  KVVNPIMAKVY  636

>PHYSO_286376
Length=660

 Score = 682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/611 (59%), Positives = 457/611 (75%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVEVKGEKRQFAPEEVSA  147

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM++                              DAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKSQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  ILSG    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILSGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  566

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALE Y YSL+N++ +EK+++KI E DK  V   V + + WL+ NQ  +K+ +E+KQKE+E
Sbjct  567  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  576  GVANPVLQKMY  586
             + NP++ K+Y
Sbjct  626  KLVNPIMSKVY  636

>PHYCA_510696
Length=659

 Score = 681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/611 (59%), Positives = 456/611 (75%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYEIVNKEG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM++                              DAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALE Y YSL+N++ +EK+++KI E DK  V   V + + WL+ NQ  +K+ +E+KQKE+E
Sbjct  566  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  624

Query  576  GVANPVLQKMY  586
             + NP++ K+Y
Sbjct  625  KLVNPIMSKVY  635

>PPTG_08245
Length=658

 Score = 680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/611 (59%), Positives = 455/611 (74%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+ + +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYNLVNKDG-KPFIEVEVKGEKRQFAPEEVSA  147

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM++                              DAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  566

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALE Y YSL+N++ +EK+++KI E DK  V   V + + WL+ NQ  +K+ +E+KQKE+E
Sbjct  567  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  576  GVANPVLQKMY  586
             + NP++ K+Y
Sbjct  626  KLVNPIMSKVY  636

>PHYRA_71042
Length=654

 Score = 678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/611 (58%), Positives = 455/611 (74%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  25   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  84

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQ+D K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  85   PEKTLFDVKRLIGRKYNDKSVQSDKKLLPYEIINKDG-KPFIQVEVKGEKREFAPEEVSA  143

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM++                              DAG IAGL V RIINEPTAAAI
Sbjct  144  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  203

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  204  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  263

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  264  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  323

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  324  FEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  383

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  384  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  442

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  443  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  502

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  503  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  562

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALE Y YSL+N++ +EK+++KI E DK  V   V + + WL+ NQ  +K+ +E KQKE+E
Sbjct  563  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEEKQKEVE  621

Query  576  GVANPVLQKMY  586
             + NP++ K+Y
Sbjct  622  KLVNPIMSKVY  632

>HYAP_01005
Length=660

 Score = 677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/611 (58%), Positives = 456/611 (75%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQ+D K  P+++ +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  127  MVLIKMR------------------------------EDAGAIAGLNVLRIINEPTAAAI  156
            MVL KM+                              +DAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +++RAR
Sbjct  268  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTESLSRAR  327

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRN  566

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            +LE Y Y+L+N++ + K+ +KI E DK  V   V + + WL+ NQ ++K+ YE+KQKE+E
Sbjct  567  SLEGYLYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVE  625

Query  576  GVANPVLQKMY  586
             V NP++ K+Y
Sbjct  626  KVVNPIMSKVY  636

>HYAP_01004
Length=660

 Score = 677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/611 (58%), Positives = 456/611 (75%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQ+D K  P+++ +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  127  MVLIKMR------------------------------EDAGAIAGLNVLRIINEPTAAAI  156
            MVL KM+                              +DAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +++RAR
Sbjct  268  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTESLSRAR  327

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRN  566

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            +LE Y Y+L+N++ + K+ +KI E DK  V   V + + WL+ NQ ++K+ YE+KQKE+E
Sbjct  567  SLEGYLYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVE  625

Query  576  GVANPVLQKMY  586
             V NP++ K+Y
Sbjct  626  KVVNPIMSKVY  636

>PHYKE_7992
Length=657

 Score = 675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/611 (58%), Positives = 449/611 (73%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+ + +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYTDKSVQADKKLLPYDLINKDG-KPFIQVEVKGEKRQFAPEEVSA  146

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM++                              DAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQDEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            ALE Y YSL+N++ ++   +   E DK  +   V + + WL+ NQ  +K+ YE KQKE+E
Sbjct  566  ALEGYLYSLKNNVEEKLEDKLD-EDDKDTITTAVQDAMDWLEDNQEADKEDYEEKQKEVE  624

Query  576  GVANPVLQKMY  586
             + NP++ KMY
Sbjct  625  KLVNPIMSKMY  635

>PYU1_G004097
Length=663

 Score = 671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/608 (58%), Positives = 453/608 (75%), Gaps = 35/608 (6%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMNAHN  69
            +GIDLGTTYSCVGV+++ +V+IIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N   
Sbjct  36   IGIDLGTTYSCVGVFKDGKVDIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATINPEK  95

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KG++K F PEEIS+MVL
Sbjct  96   TIFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGQTKLFSPEEISAMVL  154

Query  130  IKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
             KM++                              DAG IAGL+V RIINEPTAAAIAYG
Sbjct  155  GKMKQIAEAYLGRDVRDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAIAYG  214

Query  160  LDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
            +DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F ++
Sbjct  215  IDKKAQGEKNVLVFDLGGGTFDVTLLAIDNGVFEVLATNGDTHLGGEDFDQRVMQFFIKK  274

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            +K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF+ T+TRARFE 
Sbjct  275  WKQDKGVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLNGEDFSETLTRARFEK  334

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  D F+KT+ PVEKVL+DA L KSQV E+VLVGGSTRIPKVQQ++ D+FNGKEP++ +N
Sbjct  335  LNEDLFKKTLGPVEKVLKDAGLKKSQVDEIVLVGGSTRIPKVQQMIKDYFNGKEPSRGVN  394

Query  339  PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  398
            PDEAVAYGA +Q  IL G+   EKLQDL+L+DV PLS G+ET GGVMT LI RNT +PTK
Sbjct  395  PDEAVAYGAAIQGGILGGD-QDEKLQDLVLIDVVPLSQGIETVGGVMTKLINRNTAIPTK  453

Query  399  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  458
            KSQ FST+ DNQ  V I+VFEGER++ + N LLGKF+L G+PP PRGVPQI+VTF+IDAN
Sbjct  454  KSQVFSTHVDNQAAVSIKVFEGERTLVKHNRLLGKFDLAGLPPAPRGVPQIEVTFEIDAN  513

Query  459  GILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALE  518
            GIL VSA +K TGK  KITIT +KGRLSQ +I+RMV +A ++  ED+  K+RIE+KN+LE
Sbjct  514  GILQVSAQDKGTGKTEKITITAEKGRLSQEEIERMVQDAAEHAEEDKKVKERIESKNSLE  573

Query  519  NYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVA  578
             Y YS +N++ D K+ +KI E DK  V   V + + WLD N+  +K+ +E KQK++E V 
Sbjct  574  TYLYSAKNTVED-KLSDKIEEDDKGIVLQAVKDAMDWLDDNEDADKEDFEGKQKDVEKVV  632

Query  579  NPVLQKMY  586
            NP++ K+Y
Sbjct  633  NPIMAKVY  640

>PITG_00527
Length=656

 Score = 671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/611 (58%), Positives = 456/611 (75%), Gaps = 35/611 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MVL KM++                              DAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  157  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  275
             +++K+  + D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKKIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  276  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  335
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  336  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKRVKDRIDGRN  565

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
             LE Y YSL+N++ +EK+++KI E DK  V   V + + WL+ NQ  +K+ +E+KQKE+E
Sbjct  566  GLEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  624

Query  576  GVANPVLQKMY  586
             + NP++ K+Y
Sbjct  625  KLVNPIMSKVY  635

>SDRG_03564
Length=658

 Score = 666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/612 (58%), Positives = 460/612 (75%), Gaps = 36/612 (6%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
              NT+FD KRLIGR+++D  VQAD K  P+++ +  G +P I V  KGE+KTF  EE+S+
Sbjct  89   PENTLFDVKRLIGRQYNDKSVQADKKLLPYEIVNKEG-RPYIQVIVKGETKTFSAEEVSA  147

Query  127  MVLIKMR------------------------------EDAGAIAGLNVLRIINEPTAAAI  156
            M+L KM+                              +DAG IAGL V RIINEPTAAAI
Sbjct  148  MILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  157  AYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD R++  
Sbjct  208  AYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFDQRVMQF  267

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            F ++++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF+ T+TRA
Sbjct  268  FIKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDFDETLTRA  327

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
            RFE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ DFFNGKEP+
Sbjct  328  RFEELNNDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFFNGKEPS  387

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            + INPDEAVAYGA VQ  IL+G  + E  +D+LLLDV PLSLG+ET GGVMT +I RNT 
Sbjct  388  RGINPDEAVAYGAAVQGGILAG-VNDESTKDILLLDVAPLSLGIETVGGVMTKIINRNTV  446

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VPTKKSQTFSTY DNQP V IQV+EGER+MT+DN++LGKF L GIPP PRGVPQI+VTF+
Sbjct  447  VPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQIEVTFE  506

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            +DANGIL VSA +K TGK  KITIT +KGRLSQ +IDRMV EAE+   ED+  K RI+ +
Sbjct  507  VDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKDRIDGR  566

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            N+LE Y Y+L+N++ ++K+ +KI + DK  V   V E + WLD NQ  +K+ ++++QK +
Sbjct  567  NSLEGYLYNLKNNV-EDKLADKIDDDDKDTVLKAVQEAMDWLDENQEADKEDFDAQQKAV  625

Query  575  EGVANPVLQKMY  586
            E V NP++ K+Y
Sbjct  626  EKVVNPIMSKVY  637

>CCI50234
Length=665

 Score = 662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/617 (57%), Positives = 447/617 (72%), Gaps = 35/617 (6%)

Query  2    TQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAK  60
            T +  +G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF     RLIGDAAK
Sbjct  29   TGSGMTGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDATGTRLIGDAAK  88

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQ   N   T+FD KRLIGRKF+D  VQAD K  P+++ +  G KP I V  KGE K F 
Sbjct  89   NQAVHNPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTVKGEQKVFA  147

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEIS+MVL KM++                              DAG+IAGL V RIINE
Sbjct  148  PEEISAMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINE  207

Query  151  PTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            PTAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD 
Sbjct  208  PTAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQ  267

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  269
            R++  F +++ ++   +I +++RA++++R   ER KR LS++ QA IE++SL DGIDF+ 
Sbjct  268  RVMQFFIKKWNKEKTIEIEKDKRAVQKIRREAERVKRALSTNTQARIEVESLIDGIDFSD  327

Query  270  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  329
             ++RA FE +  D FRKT+ PV+KVL+DA L KS+V EVVLVGGSTRIPKVQ+LL  +FN
Sbjct  328  NLSRALFEKLNNDLFRKTLAPVDKVLKDAGLKKSEVDEVVLVGGSTRIPKVQELLKAYFN  387

Query  330  GKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  389
            GKE N+ +NPDEAVAYGA VQ  IL G    +  +DLLL+DV PLS G+ET GGVMT +I
Sbjct  388  GKELNRGVNPDEAVAYGAAVQGGILGGE-QDDLNKDLLLIDVIPLSQGIETVGGVMTKII  446

Query  390  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  449
             RNT +PTKKSQ FST +DNQ  V I V EGER+M +DN LLGKF L GIPP PRGVPQI
Sbjct  447  NRNTVIPTKKSQVFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQI  506

Query  450  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQ  509
            +VTF++DANGIL VSA +K TGK  KITIT +KGRLS+ +I RMV EAE++  ED+  K+
Sbjct  507  EVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSEEEIQRMVQEAEEFADEDKRIKE  566

Query  510  RIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYES  569
            RI+ +NALE Y Y+L++ ++D K+ +KI E DK+ V + V + + WL+ NQ  +K  +E+
Sbjct  567  RIDGRNALEGYLYNLKSQVDD-KLADKIEEDDKETVSNAVQDALDWLEDNQEADKPDFEA  625

Query  570  KQKELEGVANPVLQKMY  586
            KQKE+E + NP++ K+Y
Sbjct  626  KQKEVEKIVNPIMAKLY  642

>CCA24936
Length=661

 Score = 659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/612 (57%), Positives = 443/612 (72%), Gaps = 35/612 (6%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAM  65
            +G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF     R+IGDAAKNQ   
Sbjct  30   TGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDVTGTRMIGDAAKNQAIH  89

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            N   T+FD KRLIGRKF+D  VQAD K  P+++ +  G KP I V  K E K F PEEIS
Sbjct  90   NPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTIKDEQKVFAPEEIS  148

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            +MVL KM++                              DAG+IAGL V RIINEPTAAA
Sbjct  149  AMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEPTAAA  208

Query  156  IAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            IAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  
Sbjct  209  IAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQF  268

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            F +++ ++ + +I +++RA+++LR   ER KR LS+  QA +E++SL DG DF+  ++RA
Sbjct  269  FIKKWNKEKKINIEQDKRAIQKLRRESERVKRALSTLPQARLEVESLIDGQDFSDVLSRA  328

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
             FE +  D FRKT+ PVEKVL+DA L KS++ EVVLVGGSTRIPKVQ+LL  FFNGKE N
Sbjct  329  MFEKLNNDLFRKTLAPVEKVLKDAGLKKSEIDEVVLVGGSTRIPKVQELLKAFFNGKELN  388

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            + +NPDEAVAYGA VQ  IL G    +  +DLLL+DV PLS G+ET GGVMT +I RNT 
Sbjct  389  RGVNPDEAVAYGAAVQGGILGGE-QDDLNKDLLLIDVIPLSQGIETVGGVMTKIINRNTV  447

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            +PTKK+Q FST +DNQ  V I V EGER+M +DN LLGKF L GIPP PRGVPQI+VTF+
Sbjct  448  IPTKKAQLFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQIEVTFE  507

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            +DANGIL VSA +K TGK  K+TIT +KGRLS+ +I RMV EAE++  ED+  K+RI+ +
Sbjct  508  VDANGILQVSAEDKGTGKAEKVTITAEKGRLSEEEIQRMVQEAEEFADEDKRIKERIDGR  567

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            NALE Y Y+L++ + DEK+ EKI E DK+ V + V + + WL+ NQ  +K  +E+KQKE+
Sbjct  568  NALEGYLYNLKSQV-DEKLAEKIEEDDKETVTNAVQDALDWLEDNQEADKADFEAKQKEV  626

Query  575  EGVANPVLQKMY  586
            E V NP++ K+Y
Sbjct  627  EKVVNPIMAKLY  638

>PHYRA_47873
Length=396

 Score = 644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/357 (94%), Positives = 349/357 (98%), Gaps = 0/357 (0%)

Query  230  NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTME  289
            NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTME
Sbjct  1    NQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTME  60

Query  290  PVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATV  349
            PVEKVLRDAKLSKSQV+EVVLVGGSTRIPKVQQLLS+FFNGKEPNKSINPDEAVAYGATV
Sbjct  61   PVEKVLRDAKLSKSQVNEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATV  120

Query  350  QAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADN  409
            QAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK+QTFSTYADN
Sbjct  121  QAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADN  180

Query  410  QPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  469
            QPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKS
Sbjct  181  QPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  240

Query  470  TGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLN  529
            TGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANK RIEAKNALENYAYSLRNSLN
Sbjct  241  TGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN  300

Query  530  DEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
            DEK+KE+IPEADKK VDDKVTE IQWLDA+QS E + YESKQKELEGVANP+LQKMY
Sbjct  301  DEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANPILQKMY  357

>SDRG_05777
Length=786

 Score = 622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/605 (56%), Positives = 427/605 (71%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAAS  247

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDP+V+ D  H+PF++  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  156  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            VD    EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  428  VDFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSST  487

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIPKVQ +LS  F G
Sbjct  488  MTRAKFESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGG  547

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIK  606

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P KK++ ++T +D Q  V + ++EGER+    NN LG+F + G+    RG PQ++
Sbjct  607  RNTAIPIKKTRVYTTESDYQTQVNVVIYEGERACVDHNNKLGEFTISGLERAKRGEPQVE  666

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K T  + + TI+N+ GRLSQADIDRMV EAEK+K ED    ++
Sbjct  667  VTFEIDANGILNVSARDKKTNAKAETTISNNHGRLSQADIDRMVEEAEKFKKEDAEALKK  726

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+N+LE++ Y         +  E   E    A ++ + E  +WL+ ++       E K
Sbjct  727  IEARNSLESFIY---------RALELTREKGDAAAENTIREAREWLEDHEDATLRELEEK  777

Query  571  QKELE  575
            ++ LE
Sbjct  778  KRVLE  782

>SPRG_10519
Length=782

 Score = 622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/605 (56%), Positives = 423/605 (70%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A 
Sbjct  183  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  242

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDP+V+ D  H+PF++  G GDKP I V FKGE K F PEEIS
Sbjct  243  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGEGDKPLIQVTFKGEEKNFSPEEIS  302

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  303  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  362

Query  156  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  363  LAYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  422

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            VD+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  423  VDYLITEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSST  482

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++T E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  F G
Sbjct  483  MTRAKFESLNEECFKRTEETVLKVLADANMQPGDITELVLVGGSTRIPKVQNMLSAVFGG  542

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI 
Sbjct  543  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIK  601

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P KK++ ++T  D Q    + +FEGER+   DNN LG+F + GI    RG PQI+
Sbjct  602  RNTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISGIERAKRGEPQIE  661

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGIL+VSA +K TG +N  TI+N++GRL+Q DIDRMV EAEK+K +D    +R
Sbjct  662  VTFEIDANGILHVSARDKKTGAKNATTISNNRGRLTQQDIDRMVEEAEKFKKDDAQMLKR  721

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            I+A+N LE Y Y         +  E   + +  A    + E   W+D N+ L     E K
Sbjct  722  IDARNDLEGYLY---------RALEAASKKNDAAAQTALREARDWMDDNEELTVRELEDK  772

Query  571  QKELE  575
            ++ LE
Sbjct  773  RRVLE  777

>CCA20828
Length=787

 Score = 621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/605 (56%), Positives = 424/605 (70%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTD+ERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDTERLIGEAAKIQAAS  247

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            N  NTVFDAKR+IGR F+D  VQ D +H+PF++ SG GDKP I V++K E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEYKKETKQFTPEEIS  307

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            +MVL +M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  308  AMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAA  367

Query  156  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGEDFDN +
Sbjct  368  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGEDFDNNM  427

Query  212  VDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            VD+  QEFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+GIDF+ T
Sbjct  428  VDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEGIDFSLT  487

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ LLS  FNG
Sbjct  488  VTRAKFESLNEELFKRCEETVLKVLADAAMKPGDISEIVLVGGSTRIPKVQNLLSGVFNG  547

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  606

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ 
Sbjct  607  RNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISGIERARRGEPQVK  666

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVS+AEK+K +D     R
Sbjct  667  VTFEIDANGILNVSATDKKTGAKAETTISNNRGRLSQEDIDRMVSDAEKFKKDDAEMLAR  726

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+N+LE + Y   N+ N     EK     + A+ D      +WLD ++       E K
Sbjct  727  IEARNSLEQFIYRALNNGN-----EKCEAGAENALRD----AREWLDDHEEATLRELEDK  777

Query  571  QKELE  575
            ++ LE
Sbjct  778  KRTLE  782

>PYIW_26567
Length=564

 Score = 620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/540 (60%), Positives = 404/540 (75%), Gaps = 34/540 (6%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQV  63
            T+ G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ 
Sbjct  27   TSRGPIIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQA  86

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEE  123
             +N   T+FD KRLIGR +SD  VQAD K  P+ + +  G KP I V  KGE K F PEE
Sbjct  87   TINPEKTIFDVKRLIGRDYSDKSVQADKKLLPYHIVNKDG-KPMIEVLIKGEKKLFSPEE  145

Query  124  ISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTA  153
            IS+M+L KM++                              DAG IAGL V RIINEPTA
Sbjct  146  ISAMILTKMKQIAESYLGREVHDAIVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTA  205

Query  154  AAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            AAIAYG+DK+  GE++VL+FDLGGGTFDV+LL+IE G+FEV AT GDTHLGGEDFD R++
Sbjct  206  AAIAYGIDKQSEGEKHVLVFDLGGGTFDVTLLAIEGGVFEVLATNGDTHLGGEDFDQRVM  265

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  272
              F +++K+    DI  ++RAL++LR   ER KR LS+  QA +EIDSL DG DF+ T++
Sbjct  266  QFFIKKWKKDRGIDIGSDKRALQKLRREAERVKRALSTQTQARLEIDSLLDGEDFSETLS  325

Query  273  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  332
            RARFE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIPKVQQL+ DFFNGKE
Sbjct  326  RARFEKLNEDLFKKTLTPVEKVLKDAGIKKSEVDEIVLVGGSTRIPKVQQLIKDFFNGKE  385

Query  333  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  392
            P++ +NPDEAVAYGA VQ  IL G  + + L D++L+DV PLS G+ET GGVMT LI RN
Sbjct  386  PSRGVNPDEAVAYGAAVQGGIL-GGMNQKDLGDIVLIDVVPLSQGIETVGGVMTKLINRN  444

Query  393  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  452
            T +P KKSQ FST+ DNQP V I+V+EGER++ +DN+LLGKF+L GIPP PRG+PQI+VT
Sbjct  445  TAIPNKKSQVFSTHVDNQPAVSIKVYEGERTLVKDNHLLGKFDLTGIPPAPRGIPQIEVT  504

Query  453  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIE  512
            F+IDANGIL VSA +K TGK  KITIT +KGRLSQA+IDR++ EAE++  ED+  K+RI+
Sbjct  505  FEIDANGILQVSAEDKGTGKAEKITITAEKGRLSQAEIDRIIEEAEQFAEEDKKVKERID  564

>CCI46091
Length=787

 Score = 620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/605 (56%), Positives = 421/605 (70%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTDSERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDSERLIGEAAKIQAAS  247

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            N  NTVFDAKR+IGR F+D  VQ D +H+PF++ SG GDKP I V+FK E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEFKKETKQFTPEEIS  307

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            +MVL +M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  308  AMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAA  367

Query  156  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGEDFDN +
Sbjct  368  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGEDFDNNM  427

Query  212  VDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            VD+  QEFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+GIDF+ T
Sbjct  428  VDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEGIDFSLT  487

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DA +   ++ E+VLVGGSTRIPKVQ LLS  F G
Sbjct  488  VTRAKFESLNEELFKRCEETVLKVLADAAMKPDEISEIVLVGGSTRIPKVQNLLSAVFGG  547

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  606

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ 
Sbjct  607  RNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISGIERARRGEPQVK  666

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVS+AEK+K +D     R
Sbjct  667  VTFEIDANGILNVSATDKKTGAKAETTISNNRGRLSQEDIDRMVSDAEKFKKDDAEMLSR  726

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+N LE + Y   N          + E    A  + + +  +WLD ++       E K
Sbjct  727  IEARNGLEQFIYRAINI---------VQEKGDAATGNALRDAREWLDDHEDATLRELEEK  777

Query  571  QKELE  575
            ++ LE
Sbjct  778  KRMLE  782

>H257_00007
Length=787

 Score = 619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/607 (55%), Positives = 428/607 (71%), Gaps = 46/607 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANAEGNRTTPSWVAFNETERLIGEAAKLQAAS  248

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDP+V+ D  H+PF++T G GDKP I V F+GE+K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITKGEGDKPLIEVSFRGEAKSFTPEEIS  308

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  156  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  428

Query  213  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  271
            D+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  429  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  488

Query  272  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  331
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  489  TRAKFESLNDECFKRTEETVLKVLQDANMEPGQITELVLVGGSTRIPKVQNMLSGLFGGK  548

Query  332  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  391
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  392  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  451
            NT +P KK++ ++T  D Q    + ++EGER+   DNN LG+F + GI    RG P+++V
Sbjct  608  NTAIPVKKTRIYTTEEDFQTTEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEV  667

Query  452  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRI  511
            TF+IDANGIL+VS  +K TG +N+ TI+N++GRLSQ DIDRMV EAEKYK  D    +RI
Sbjct  668  TFEIDANGILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRI  727

Query  512  EAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQ  571
            EA+N LE + Y         +  E   +  + A ++ + E   WL+ +        E K+
Sbjct  728  EARNELEGFIY---------RYLEVATKKGEAAAENLLRETRDWLEDHTEATVKELEDKK  778

Query  572  KELEGVA  578
            + LE V 
Sbjct  779  RALERVC  785

>H310_14759
Length=787

 Score = 619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/607 (55%), Positives = 426/607 (70%), Gaps = 46/607 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  248

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDP+V+ D  H+PF+++ G GDKP I V F+GE K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKISKGEGDKPLIQVTFRGEDKSFTPEEIS  308

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENFLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  156  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDSNMV  428

Query  213  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  271
            D    EFKRK+R  D T + R++RRLRTACE AKR LS++  A IE+D+LF+G+DF+ST+
Sbjct  429  DFLVTEFKRKNRNLDPTSSARSMRRLRTACESAKRMLSTTTSATIEVDALFEGVDFSSTM  488

Query  272  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  331
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS+ F GK
Sbjct  489  TRAKFESLNEECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQTMLSNLFGGK  548

Query  332  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  391
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  392  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  451
            NT +P KK++ ++T  D Q    + ++EGER+   DNN LG+F + GI    RG P+++V
Sbjct  608  NTAIPVKKTRIYTTEEDFQTSEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEV  667

Query  452  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRI  511
            TF+IDANGIL+VS  +K TG +N+ TI+N++GRLSQ DIDRMV EAEKYK  D    +RI
Sbjct  668  TFEIDANGILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRI  727

Query  512  EAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQ  571
            EA+N LE + Y         +  E   +  +   ++ + +   WLD +        E K+
Sbjct  728  EARNDLEGFIY---------RYLEVASKKGEAQAENALRDARDWLDEHAEATVKELEDKK  778

Query  572  KELEGVA  578
            + LE V 
Sbjct  779  RALERVC  785

>H257_18885
Length=786

 Score = 618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/604 (55%), Positives = 429/604 (71%), Gaps = 46/604 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  247

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDP+V+ D  H+PF++T+G  DKP I V FKGE+K+F PEEIS
Sbjct  248  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITAGDDDKPLIEVTFKGEAKSFTPEEIS  307

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  156  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  368  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  427

Query  213  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  271
            D+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  428  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  487

Query  272  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  331
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  488  TRAKFESLNDECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQNMLSGLFGGK  547

Query  332  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  391
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI R
Sbjct  548  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKR  606

Query  392  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  451
            NT +P KK++ ++T AD Q  V + ++EGER+    NN LG+F + GI    RG PQ++V
Sbjct  607  NTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKRGEPQVEV  666

Query  452  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRI  511
            TF+IDANGILNVSA +K T  + + TI+++ GRLSQ DIDRMV++AEKYK +D    ++I
Sbjct  667  TFEIDANGILNVSAKDKKTHAKAETTISSNGGRLSQEDIDRMVADAEKYKKDDAEVLRKI  726

Query  512  EAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQ  571
            EA+N LE + Y         +  E   E      ++ + E  +WL+ ++       E K+
Sbjct  727  EARNNLEGFIY---------RALEIAREKGDSQAENTIREAREWLEDHEEATLRELEDKK  777

Query  572  KELE  575
            + LE
Sbjct  778  RLLE  781

>HYAP_12660
Length=786

 Score = 617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/605 (55%), Positives = 425/605 (70%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF DSERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD VV+ D KH+PF++  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFKIKEGDDDKVLIEVEFKGEKKSFTPEEIS  306

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL++M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  366

Query  156  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKVCNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLAEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPENVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG + + TI+N++GRL+Q DIDRMV+EA+K+K +D    +R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLTQEDIDRMVAEADKFKKDDAEMLRR  725

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+N LE + Y         +  E+  E     V+  + +   WL+ ++       E K
Sbjct  726  IEARNDLEQFIY---------RAIEQAREKGDTTVESAIRDARDWLEDHEEATLRELEDK  776

Query  571  QKELE  575
            ++ LE
Sbjct  777  KRMLE  781

>PYIW_22144
Length=633

 Score = 616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/605 (56%), Positives = 429/605 (71%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR F+D +V+ D KH+PF++  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  156  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V++   EFKRK+R  D + + RA+RRL TACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSSSPRAMRRLHTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL+DA +   ++ E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLQDANMKPGEITELVLVGGSTRIPKVQTMLSGLFNG  393

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG   + TI+N+ GRLSQ+DIDRMV++AEK+K +D    +R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDDAELLRR  572

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+NALE Y Y     L+ EK    +  A + A D        WL+ ++       E K
Sbjct  573  IEARNALEQYIYRAI-ELSREKGDANVETAIRDARD--------WLEDHEEATLRELEDK  623

Query  571  QKELE  575
            ++ LE
Sbjct  624  KRALE  628

>PITG_11913
Length=786

 Score = 614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/552 (59%), Positives = 405/552 (73%), Gaps = 38/552 (7%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD VV+ D KH+PF +  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDEDKVLIEVEFKGEKKSFTPEEIS  306

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL++M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  156  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLSEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D    +R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  511  IEAKNALENYAY  522
            IEA+N LE + Y
Sbjct  726  IEARNDLEQFIY  737

>PYIR_24387
Length=633

 Score = 614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/605 (55%), Positives = 426/605 (70%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR F+D +V+ D KH+PF++  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  156  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLSDANMKPEDITELVLVGGSTRIPKVQTMLSGLFNG  393

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG   + TI+N+ GRLSQ+DIDRMV++AEK+K +D    +R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDDAELLRR  572

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+N+LE Y Y         +  E   E     V+  + +   WL+ ++       E K
Sbjct  573  IEARNSLEQYIY---------RAIEIAREKGDANVETAIRDARDWLEDHEEATLRELEDK  623

Query  571  QKELE  575
            ++ LE
Sbjct  624  KRVLE  628

>PYVX_18121
Length=633

 Score = 613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/605 (55%), Positives = 422/605 (70%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD VV+ D  H+PF++  G  +K  I V+FKGE+K F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFSDEVVKKDATHFPFKIVEGDDNKVLIEVEFKGEAKRFTPEEIS  153

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL++M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  154  SMVLLRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  213

Query  156  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  274  VEHLLTEFKRKNRSLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  333

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DA +    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  334  VTRAKFESLNEELFKRCEETVLKVLSDANMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  393

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDSNNKLGEFNISGIERAKRGEPQVE  512

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG   + TI+N++GRL+Q DIDRMV EAEK+K +D    +R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVQEAEKFKKDDAEMLRR  572

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+N LE + Y         +  E   E     V++ + +   WL+ ++       E K
Sbjct  573  IEARNDLEQFIY---------RAIETAREKGDANVENAIRDARDWLEDHEEATLRELEDK  623

Query  571  QKELE  575
            ++ LE
Sbjct  624  KRMLE  628

>PPTG_03121
Length=786

 Score = 613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/605 (55%), Positives = 424/605 (70%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD VV+ D  H+PF++  G  DK  I V+FKGE+K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFKIKEGDDDKVLIEVEFKGENKSFTPEEIS  306

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL++M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  156  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D    +R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+N LE + Y         +  E   E     V+  + +   WL+ ++       E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNVESAIRDARDWLEDHEEATLRELEDK  776

Query  571  QKELE  575
            ++ LE
Sbjct  777  KRMLE  781

>PHYRA_78193
Length=786

 Score = 611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/552 (59%), Positives = 405/552 (73%), Gaps = 38/552 (7%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD VV+ D KH+PF +  G  DK  I V+FKG+ K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDDDKVLIEVEFKGDKKSFTPEEIS  306

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL++M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  156  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGTACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  + V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEDTVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D    +R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  511  IEAKNALENYAY  522
            IEA+N LE + Y
Sbjct  726  IEARNDLEQFIY  737

>PHYKE_10815
Length=786

 Score = 610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/552 (59%), Positives = 404/552 (73%), Gaps = 38/552 (7%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF DSERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEMVKKDAKHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL++M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQKIGQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  156  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  427  VEHLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  486

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVTKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D    +R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  511  IEAKNALENYAY  522
            IEA+N LE + Y
Sbjct  726  IEARNDLEQFIY  737

>PHALS_02079
Length=786

 Score = 610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/552 (59%), Positives = 403/552 (73%), Gaps = 38/552 (7%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  246

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NT+FDAKR+IGR FSD VV+ D  H+PF +  G  DK  I V FKGE K+F PEEIS
Sbjct  247  NATNTIFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVDFKGEKKSFTPEEIS  306

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL++M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQNISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  156  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LSS+  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLSEFKRKNRNMDPSTSARAMRRLRTACESAKRMLSSTTSASVEVDSLFEGVDFSST  486

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D    +R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  511  IEAKNALENYAY  522
            IEA+N LE + Y
Sbjct  726  IEARNDLEQFIY  737

>PYAP_22238
Length=633

 Score = 610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/605 (55%), Positives = 424/605 (70%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF DSERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAS  93

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            N  NTVFDAKR+IGR FSD +V+ D  H+PF++T G  +K  I V+FKGE+K+F PEEIS
Sbjct  94   NPSNTVFDAKRIIGRNFSDEIVKKDATHFPFKITEGDDNKVLIQVEFKGETKSFTPEEIS  153

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  213

Query  156  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G+     NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGQSGKGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  273

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            VD+   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VDYLLSEFKRKNRGLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSTT  333

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRA+FE +  + F++  E V KVL DA +    + EVVLVGGSTRIPKVQ +LS  F G
Sbjct  334  ITRAKFESLNEELFKRCEETVVKVLSDANMKPEDITEVVLVGGSTRIPKVQTMLSAQFGG  393

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDANNKLGEFNISGIERAKRGEPQVE  512

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG   + TI+N++GRL+Q DIDRMV+EAEKYK +D    ++
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVAEAEKYKKDDAELLRK  572

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+N LE + Y         +  E   E  +   ++ + +   WL+ ++       E K
Sbjct  573  IEARNELEQFIY---------RAIEIAREKGETEAENAIRDARDWLEDHEDASLRELEDK  623

Query  571  QKELE  575
            ++ LE
Sbjct  624  KRMLE  628

>SPRG_00333
Length=615

 Score = 608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/612 (54%), Positives = 427/612 (70%), Gaps = 79/612 (13%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
              NT+FD KRLIGR+++D  VQAD K  PF++ +  G +P I V+ KGE+KTF  EE+S+
Sbjct  89   PENTLFDVKRLIGRQYNDKSVQADKKLLPFEIINKEG-RPYIQVKVKGETKTFSAEEVSA  147

Query  127  MVLIKMR------------------------------EDAGAIAGLNVLRIINEPTAAAI  156
            M+L KM+                              +DAG IAGL V RIINEPTAAAI
Sbjct  148  MILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  157  AYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD R++  
Sbjct  208  AYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFDQRVMQF  267

Query  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274
            F ++++++ + DI+ ++RAL++LR   E+  R                            
Sbjct  268  FIKKWQKQKKIDISSDKRALQKLRREAEQDAR----------------------------  299

Query  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334
                           PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ DFFNGKEP+
Sbjct  300  ---------------PVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFFNGKEPS  344

Query  335  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  394
            + INPDEAVAYGA VQ  IL+G  + +  +D+LLLDV PLSLG+ET GGVMT +I RNT 
Sbjct  345  RGINPDEAVAYGAAVQGGILAG-VNDDGTKDILLLDVAPLSLGIETVGGVMTKIINRNTV  403

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VPTKKSQTFSTY DNQP V IQV+EGER+MT+DN++LGKF L GIPP PRGVPQI+VTF+
Sbjct  404  VPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQIEVTFE  463

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            +DANGIL VSA +K TGK  KITIT +KGRLSQ +IDRMV EAE+   ED+  K RI+ +
Sbjct  464  VDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKDRIDGR  523

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            N+LE Y Y+L+N++ D K+ +KI + DK  V   V E + WLD NQ  +K+ ++++QK +
Sbjct  524  NSLEGYLYNLKNNVED-KLADKIDDEDKDTVLKAVQEAMDWLDENQEADKEDFDAQQKAV  582

Query  575  EGVANPVLQKMY  586
            E V NP++ K+Y
Sbjct  583  EKVVNPIMSKVY  594

>PYU1_G001540
Length=633

 Score = 608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/605 (55%), Positives = 423/605 (70%), Gaps = 47/605 (8%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  93

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NAHNTVFDAKR+IGR F+D +V+ D KH+PF++  G  +K  I V+FKGE K F PEEIS
Sbjct  94   NAHNTVFDAKRIIGRNFNDEIVKKDAKHFPFKIVEGDDNKVLIEVEFKGEQKRFTPEEIS  153

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  156  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGNNGQKTNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  273

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLADANMKPEDITELVLVGGSTRIPKVQTMLSSLFNG  393

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG   + TI+ + GRLSQ DIDRMV+EAEK+K +D    +R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISQNAGRLSQDDIDRMVAEAEKFKKDDAELLRR  572

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESK  570
            IEA+N LE + Y         +  +   E     V+  + +   WL+ ++       E K
Sbjct  573  IEARNDLEQFIY---------RAIDIAREKGDSNVETSIRDARDWLEEHEEATLRELEDK  623

Query  571  QKELE  575
            ++ LE
Sbjct  624  KRSLE  628

>PHYCA_509820
Length=786

 Score = 604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/552 (59%), Positives = 402/552 (73%), Gaps = 38/552 (7%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSD VV+ D  H+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL++M+E                              DAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  156  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            IAYGLD   G      NVLIFDLGGGTFDVSLLSIEEGIF VK+T GDT+LG EDFDN +
Sbjct  367  IAYGLDTNAGTDGKACNVLIFDLGGGTFDVSLLSIEEGIFGVKSTGGDTYLGSEDFDNNM  426

Query  212  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  451  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D    +R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  511  IEAKNALENYAY  522
            IEA+N LE + Y
Sbjct  726  IEARNDLEQFIY  737

>PHYRA_47865
Length=381

 Score = 600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/337 (93%), Positives = 328/337 (97%), Gaps = 0/337 (0%)

Query  250  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  309
            SSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTMEPVEKVLRDAKLSKSQV+EVV
Sbjct  2    SSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTMEPVEKVLRDAKLSKSQVNEVV  61

Query  310  LVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdllll  369
            LVGGSTRIPKVQQLLS+FFNGKEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLL
Sbjct  62   LVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLL  121

Query  370  dvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN  429
            DVTPLSLGLETAGGVMTTLIARNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+
Sbjct  122  DVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNH  181

Query  430  LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAD  489
            LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+D
Sbjct  182  LLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSD  241

Query  490  IDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKV  549
            IDRMV+EAEKYKSED+ANK RIEAKNALENYAYSLRNSLNDEK+KE+IPEADKK VDDKV
Sbjct  242  IDRMVAEAEKYKSEDKANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKV  301

Query  550  TEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
            TE I WLDANQS E + YESKQKELEGVANP+LQKMY
Sbjct  302  TETINWLDANQSAETEEYESKQKELEGVANPILQKMY  338

>SPRG_10477
Length=762

 Score = 585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/599 (54%), Positives = 409/599 (68%), Gaps = 58/599 (10%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIGDAAK Q A NA NT
Sbjct  184  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAASNATNT  243

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
            VFDAKR+IGR FSDP+V+ D  H+PF++  G  DKP I V FKGE K F PEEISSMVL 
Sbjct  244  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDDDKPLIQVSFKGEDKRFTPEEISSMVLT  303

Query  131  KMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYGL  160
            +M+E                              DAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  304  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  363

Query  161  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  216
            D   G    + N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLG +  D  L     
Sbjct  364  DTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGVQAQDKGL-----  418

Query  217  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  276
                     D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+TRA+F
Sbjct  419  ---------DPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSSTMTRAKF  469

Query  277  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  336
            E +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIPKVQ +LS  F GKE +KS
Sbjct  470  ESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGGKELSKS  529

Query  337  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  396
            INPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P
Sbjct  530  INPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIP  588

Query  397  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  456
             KK++ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ VTF+ID
Sbjct  589  VKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGIERAKRGEPQVQVTFEID  648

Query  457  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNA  516
            ANGILNVSA++K T  + + TI N+ GRL+Q DIDRMV++AEK+K +D    ++IEA+N+
Sbjct  649  ANGILNVSALDKKTNAKAETTINNNNGRLTQEDIDRMVADAEKFKKDDAEVLKKIEARNS  708

Query  517  LENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
            LE++ Y         +  E   E    A ++ + E  +WL+ ++       E K++ LE
Sbjct  709  LESFIY---------RALELTREKGDAAAENTIREAREWLEDHEDATLRELEEKKRVLE  758

>PHYRA_41888
Length=586

 Score = 574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/353 (79%), Positives = 301/353 (85%), Gaps = 31/353 (9%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MT++ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTESVT-GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFD KRLIGRKF+DP VQ+DI+HWPF+V  G  +KP++ VQFKGE  TFQ
Sbjct  60   NQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVL+KMRE                              DAG IAGLNVLRIINE
Sbjct  120  PEEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR  239

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV+ F QEFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNST
Sbjct  240  LVEFFVQEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNST  299

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
            ITRARFED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPKVQQ 
Sbjct  300  ITRARFEDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPKVQQF  352

 Score = 304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 169/192 (88%), Gaps = 0/192 (0%)

Query  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454
            VP KK+Q+FSTYADNQ GVLIQVFEGERSMT DN+LLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  364  VPAKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFD  423

Query  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            +D NGILNVSAVEKSTGKENKI ITNDKGRLSQ++I+RMV +AEKYK +DE NK RIE+K
Sbjct  424  VDVNGILNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLRIESK  483

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            NALENYA+SLR+S  DEK+  K+ + DKK ++DKV E + WLDANQ+  K+ +++KQ+EL
Sbjct  484  NALENYAFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAKQQEL  543

Query  575  EGVANPVLQKMY  586
            EGV NP++QK+Y
Sbjct  544  EGVTNPIMQKIY  555

>PYIR_16737
Length=511

 Score = 551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/454 (62%), Positives = 355/454 (78%), Gaps = 3/454 (1%)

Query  134  EDAGAIAGLNVLRIINEPTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFE  192
            +DAG IAG+ V RIINEPTAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE
Sbjct  38   KDAGTIAGMTVQRIINEPTAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFE  97

Query  193  VKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA  252
            V AT GDTHLGGEDFD R++  F +++K+    DI  ++RAL++LR   ER KR LS+ A
Sbjct  98   VLATNGDTHLGGEDFDQRIMQFFIKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQA  157

Query  253  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  312
            QA +EI+SL DG DF  +++RARFE +  D F+KT+ PVEKVL+DA L KS+V E+VLVG
Sbjct  158  QARLEIESLLDGEDFTESLSRARFEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVG  217

Query  313  GSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvt  372
            GSTRIPKVQQL+ D+FNGKEP++ +NPDEAVAYGA VQ  IL G    +  +D+LL+DV 
Sbjct  218  GSTRIPKVQQLIKDYFNGKEPSRGVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVV  276

Query  373  plslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLG  432
            PLS G+ET GGVMT LI RNT +PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLG
Sbjct  277  PLSQGIETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLG  336

Query  433  KFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDR  492
            KF L G+PP PRGVPQI+VTF+IDANGIL V A +K TGK  KITIT +KGRLSQ +IDR
Sbjct  337  KFELTGLPPAPRGVPQIEVTFEIDANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDR  396

Query  493  MVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEV  552
            MV EA +   ED+  K RI+ +N LE Y YSL+N+++D K+ +KI E DK +V   V + 
Sbjct  397  MVQEAAENAEEDKKVKDRIDGRNGLEGYLYSLKNTVDD-KLADKIEEDDKDSVLKAVQDA  455

Query  553  IQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
            + WL+ NQ  +K+ +E+KQKE+E + NP++ K+Y
Sbjct  456  MDWLEDNQEADKEDFEAKQKEVEKIVNPIMAKVY  489

>PHYRA_72238
Length=601

 Score = 524 bits (1350),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 294/613 (48%), Positives = 392/613 (64%), Gaps = 56/613 (9%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M  +T  G  VGIDLGTT++ VGVWQN+RVEI+ +  G+ +TPSYVAFT++ RLIG AAK
Sbjct  1    MVLSTPEGPVVGIDLGTTFARVGVWQNNRVEIVPSCDGSYSTPSYVAFTETSRLIGHAAK  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
             Q+  NA NTVF   +L+GRKFSDP VQ  +KHWPF+V  G  D P++ VQF+GE+KTFQ
Sbjct  61   YQLTRNARNTVFGMNQLVGRKFSDPEVQRSMKHWPFKVICGQNDNPEVEVQFRGETKTFQ  120

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            P EI +M+L ++RE                              DAG IAGLNVLR +N 
Sbjct  121  PVEILAMLLAELRELAEKHTGKTVKEVVLTVPSCFNHSQRRAMKDAGEIAGLNVLRFVNP  180

Query  151  PTAAAIAYGLDK--KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  208
             TAA+IAYG DK    GE +VL+FDLGGG  DVS+++IE+GI+EVKA   D  LGG+  D
Sbjct  181  ATAASIAYGFDKDWTDGEHDVLVFDLGGGMLDVSVVTIEQGIYEVKAAVTDARLGGQVLD  240

Query  209  NRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  268
            NRLV+H   +F+R H K++  N RA+ RLR ACE+AKR LSSS + YIE+D+L DGID+ 
Sbjct  241  NRLVEHCVTDFERVHDKNLRVNLRAITRLRLACEQAKRALSSSTETYIELDALHDGIDYY  300

Query  269  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  328
            +TITRA  E++  D F K ++ V+KVLRDA+++K +V EVV+ GGS R PK+ QLL DFF
Sbjct  301  ATITRAEMENLSADLFDKALQLVQKVLRDARVAKDRVREVVVGGGSARSPKMLQLLKDFF  360

Query  329  NGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL  388
            + K  +  I PDE  A+G TVQAAIL+   +S  L D ++LDVTPLSL  E  G     +
Sbjct  361  SDKALSSPIRPDEGAAFGVTVQAAILNC-VASPTLYDFIMLDVTPLSLWAEVDGTNSLVV  419

Query  389  IARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ  448
            I R+TTVPTK++  FST  DNQ  + +++FEGE S    N LLG   +D IP  PRG  +
Sbjct  420  IYRHTTVPTKRTVPFSTSEDNQAVMRVRIFEGEHSDMSANCLLGTIEVDNIPLKPRGESE  479

Query  449  IDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK  508
            I+VT DI+A+ I+NVS  E STG E  ++I                         D   +
Sbjct  480  IEVTLDINADDIVNVSVKEISTGLEKNLSI-----------------------GTDAREE  516

Query  509  QRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYE  568
             R+ +K ALE+YA ++ +S      + K   AD +A+ D  T+ + WL+ N S EK+A++
Sbjct  517  LRLGSKTALESYANAVCSSATANIAELKRSIADMQAIKDSATDTLHWLNGNHSAEKEAFD  576

Query  569  SKQKELEGVANPV  581
             K+++LE VA PV
Sbjct  577  VKRQKLEEVATPV  589

>H310_02604
Length=312

 Score = 511 bits (1316),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 250/296 (84%), Positives = 261/296 (88%), Gaps = 30/296 (10%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNA  67
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSM  127
             NTVFDAKRLIGRKF+DPV+QADIKHWPF+VT GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            VLIKM+E                              DAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  158  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGG+DFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGKDFDNRLVDHFTA  245

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  273
            EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT+
Sbjct  246  EFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITQ  301

>PYAR_19930
Length=625

 Score = 491 bits (1265),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 281/518 (54%), Positives = 349/518 (67%), Gaps = 67/518 (13%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D E             
Sbjct  168  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDQE-------------  214

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
                      RLIG            +    Q  S   +  Q T                
Sbjct  215  ----------RLIG------------EAAKIQAASNPTNTRQST----------------  236

Query  126  SMVLIKMREDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGER----NVLIFDLGGGTFDV  181
                    +DAGAIAGL+V RIINEPTAAA+AYGLD   G+     NVLIFDLGGGTFDV
Sbjct  237  --------KDAGAIAGLDVKRIINEPTAAALAYGLDTNAGQSGAGVNVLIFDLGGGTFDV  288

Query  182  SLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRK-DITENQRALRRLRTA  240
            S+LSIE GIFEVK+T GDTHLGGEDFD+ LVD    EFKRK++  D T + RA+RRLRTA
Sbjct  289  SILSIENGIFEVKSTGGDTHLGGEDFDSNLVDFLVTEFKRKNKGLDPTGSARAMRRLRTA  348

Query  241  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL  300
            CE AKR LS++  A +E+DSLF+G+DF+ST+TRA+ E +  D F++  E V+KVL DAK+
Sbjct  349  CESAKRMLSTTTSAAVEVDSLFEGVDFSSTLTRAKLESLNEDLFKRCEETVQKVLADAKM  408

Query  301  SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdss  360
                + EVVLVGGSTRIPKVQ LLS  F GKE +KSINPDEAVAYGA VQ AILSG   +
Sbjct  409  KPDDITEVVLVGGSTRIPKVQSLLSALFGGKELSKSINPDEAVAYGAAVQGAILSG-IRN  467

Query  361  eklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG  420
            +    LLL+DVTPLSLG+ET G VM+ LI RNT +P +K++ ++T  D Q  V + ++EG
Sbjct  468  DATNSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEG  527

Query  421  ERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  480
            ER+    NN LG+FN+ GI    RG PQ++VTF+IDANGILNVSA +K TG   + TI+N
Sbjct  528  ERAHVDSNNKLGEFNISGIERAKRGEPQVEVTFEIDANGILNVSARDKKTGARAETTISN  587

Query  481  DKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALE  518
            ++GRL+Q DIDRMVS+AEK+K +D    ++IEA+N LE
Sbjct  588  NRGRLTQEDIDRMVSDAEKFKKDDAELLRKIEARNELE  625

>PYVX_15051
Length=632

 Score = 470 bits (1209),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 276/584 (47%), Positives = 357/584 (61%), Gaps = 52/584 (9%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  ++ ERL+G  A
Sbjct  1    MFSAAAGAEVIGIDLGTTNSCVAVMEGKAPRVIENSEGARTTPSVVAILENDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF+D   Q   K   +++ SG   K    V+ KG  K +
Sbjct  61   KRQAVTNPQNTFYAVKRLIGRKFTDKETQEVSKVVSYEIVSGPNGK-DAWVEAKG--KKY  117

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
             P +I SMVL KM+E                              DAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETAEGFLGKSITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYGLDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD 
Sbjct  178  EPTAAALAYGLDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDE  236

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  266
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVSEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  267  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
                N  ITRA FE +  +   +T+ P +K ++DA L K  ++EV+LVGG +R+PKVQQ 
Sbjct  295  PKHLNMKITRATFEKLVANLIDRTIGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQS  354

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            + DFF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEDFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAP  468

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSE  503
            RGVPQI+V FDIDANGI+NVSA +K+T KE  I I +  G LS +DI+RMV EAE     
Sbjct  469  RGVPQIEVAFDIDANGIVNVSARDKATNKEQSIVIQSSGG-LSDSDIERMVQEAEMNAEA  527

Query  504  DEANKQRIEAKNALENYAYSLRNSL--NDEKMKEKIPEADKKAV  545
            D+  K+ IE+KN  ++ AY++  +L  +++K+ ++  E  K AV
Sbjct  528  DQKRKELIESKNEADSVAYNVEKTLKEHEDKLDDETKEQVKTAV  571

>PYAP_19738
Length=648

 Score = 469 bits (1208),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 282/613 (46%), Positives = 366/613 (60%), Gaps = 55/613 (9%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAHN  69
            +GIDLGTT SCV V +     +I N +G RTTPS VA  ++ ERL+G  AK Q   N  N
Sbjct  29   IGIDLGTTNSCVAVMEGKTPRVIENAEGARTTPSVVAILENDERLVGMPAKRQAVTNPDN  88

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            T +  KRLIGRKF D   Q   K   +++  G   K    V+ KG  K + P +I SMVL
Sbjct  89   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVPGPNGK-DAWVEAKG--KKYSPSQIGSMVL  145

Query  130  IKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
             KM+E                              DAG IAGL+VLRIINEPTAAA+AYG
Sbjct  146  TKMKETADSFLGKSVSQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  205

Query  160  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  219
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EF
Sbjct  206  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVAEF  264

Query  220  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  273
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  265  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  322

Query  274  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  333
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PKVQQ + +FF GK+P
Sbjct  323  ATFEKLVSGLVERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFF-GKKP  381

Query  334  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  393
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  382  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  436

Query  394  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  453
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+VTF
Sbjct  437  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVTF  496

Query  454  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEA  513
            DIDANGI+NVSA +KSTGKE  I I +  G LS ADI+RMV EAE     D+  K  IEA
Sbjct  497  DIDANGIVNVSARDKSTGKEQSIVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIEA  555

Query  514  KNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKE  573
            KN  ++ AY+   +L     KE   + D +  +   T +     A +  + DA ++  +E
Sbjct  556  KNEADSVAYTTEKTL-----KEHEDKVDGETAEQVKTAIQNLRTAAEGEDADAIKTAVEE  610

Query  574  LEGVANPVLQKMY  586
            ++ ++  + + +Y
Sbjct  611  VQKLSMKIGEAVY  623

>PYU1_G003754
Length=650

 Score = 469 bits (1208),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 283/625 (45%), Positives = 367/625 (59%), Gaps = 60/625 (10%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  A
Sbjct  20   MFSAAAGSEVIGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPA  79

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +++ SG   K    V+ KG  K +
Sbjct  80   KRQAVTNPENTFYAVKRLIGRKFQDKETQEVSKVVSYKIVSGPNGK-DAWVEAKG--KKY  136

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
             P +I SMVL KM+E                              DAG IAGL+VLRIIN
Sbjct  137  SPSQIGSMVLTKMKETADGFLGKSVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  196

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  197  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  255

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  266
             L+     EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  256  ELLRFLVGEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  313

Query  267  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
                N  ITRA+FE + G    +TM P +K ++DA L K  ++EV+LVGG +R+PKVQ  
Sbjct  314  PKHLNMKITRAQFEKLVGHLIERTMTPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTS  373

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            + +FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  374  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  427

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP P
Sbjct  428  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  487

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSE  503
            RGVPQI+V+FDIDANGI+NV+A +K+TGKE  I I +  G LS ADI+RMV+EAE     
Sbjct  488  RGVPQIEVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG-LSDADIERMVAEAEMNAEA  546

Query  504  DEANKQRIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVI  553
            D+  K+ IEAKN  ++ +Y+   +L +          E++K  +     KA  +   E+ 
Sbjct  547  DQKRKELIEAKNEADSVSYTTEKTLKEHEDKLDKETVEQVKAGLENLRTKAEGENAEEIK  606

Query  554  QWLDANQSLEKDAYESKQKELEGVA  578
              L+  Q L     E+  K  +G A
Sbjct  607  AALEEVQKLSLKIGEAVYKNQQGAA  631

>PHYSO_525429
Length=610

 Score = 466 bits (1200),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 271/599 (45%), Positives = 375/599 (63%), Gaps = 54/599 (9%)

Query  17   TTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTVFDAKR  76
            TT   VGVW N+ V ++ +D   R  PS+VAFTD+ERL+GD AK QVA N +NTVF   R
Sbjct  3    TTCLRVGVWVNNNVAVLTSD---RPLPSFVAFTDTERLVGDVAKRQVATNVNNTVFGTTR  59

Query  77   LIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMRE--  134
            LIGRKFSD  VQ D+KHWPF+V  G  D P + VQ  G++KTF+P EI +M+L + RE  
Sbjct  60   LIGRKFSDLEVQEDLKHWPFKVVGGPNDGPLVEVQAAGQTKTFRPVEILAMLLAEARETV  119

Query  135  ----------------------------DAGAIAGLNVLRIINEPTAAAIAYGLDKK--G  164
                                        DAGA+AGLNV R+I+  TAAAIA+GL+ K   
Sbjct  120  ETHLGKRVENAVVTVPASFNYAQRQAIKDAGAVAGLNVARLISASTAAAIAHGLENKTKA  179

Query  165  GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHR  224
            G+RN+L+ DLGGGT DVSL++IEE I+EV ATAG+ HLGGEDFD+RLV+H   EFKR HR
Sbjct  180  GQRNLLVLDLGGGTLDVSLVAIEEEIYEVLATAGNAHLGGEDFDSRLVEHCVAEFKRMHR  239

Query  225  KDITENQRALRRLRTACERAKRTLSS--SAQAYIEIDSLFDGIDFNSTITRARFEDMCGD  282
            KD++ N RA+ RLR ACE AKR L +  S +  IE+D+L++GIDF++ ITRA+FE +C D
Sbjct  240  KDLSTNARAMMRLRMACESAKRALFAPESVEKLIELDALYEGIDFHTKITRAQFEKLCAD  299

Query  283  YFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEA  342
                 M PV++VL DA + +S+V EVV+VGGS RI KV++LL +FFNGK+  +S + +E 
Sbjct  300  LSDDIMLPVQQVLSDASVLRSKVDEVVMVGGSMRITKVEELLKEFFNGKKIIRSRHEEEL  359

Query  343  VAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT-LIARNTTVPTKKSQ  401
               GAT+ AA+L+   S  K  +  +L                T+ +I R+TT+PT+K++
Sbjct  360  NVLGATMHAAMLTDELSVIKPLEEFMLLDVTPLSLGVKIDDTNTSVMIPRSTTIPTRKTR  419

Query  402  TFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGIL  461
            TFST  DNQ  V I++ EGE     DN ++GK   DG+P  PRG  +I+VT ++DANG +
Sbjct  420  TFSTSQDNQSVVQIELLEGEDG---DNRVIGKLKGDGLPLEPRGEFKIEVTVEVDANGCI  476

Query  462  NVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYA  521
             V   ++STG+  K+ ++ D   LS  +IDRM     K  S+ E           LENYA
Sbjct  477  TVLIADESTGQSKKLEVSGDC--LSALEIDRMRKSVMKDASKIE-----------LENYA  523

Query  522  YSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANP  580
             S+R++      + K    + +AV+++ TE + WL+ N S+ +   + K+++LE  A P
Sbjct  524  NSVRSTAAKRIAELKRSIEEMQAVEEQATETLHWLNRNHSVGRADIDVKRRKLEEAATP  582

>PHYKE_9008
Length=650

 Score = 467 bits (1201),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 284/624 (46%), Positives = 371/624 (59%), Gaps = 64/624 (10%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  A
Sbjct  18   MFSAAAGSEVIGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAIIDNDERLVGMPA  77

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKFSD   Q   K   +++  G   K    V+ KG+   +
Sbjct  78   KRQAVTNPENTFYAVKRLIGRKFSDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--Y  134

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
             P +I SMVL KM+E                              DAG IAGL+VLRIIN
Sbjct  135  SPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  194

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  195  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  253

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  266
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  254  ELLRYLVDEFKKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  311

Query  267  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
                N  ITRA FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  
Sbjct  312  PKHLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTT  371

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            + DFF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  372  VEDFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  425

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP P
Sbjct  426  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAP  485

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSE  503
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS A+I++MV++AE   + 
Sbjct  486  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAA  544

Query  504  DEANKQRIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVI  553
            D+  K+ IEAKN  ++ AY    +L +          EK+K  + +  KKA  +   E+ 
Sbjct  545  DQERKELIEAKNDADSTAYQTEKTLKEHEDKIDAETVEKVKAALADLQKKAEGENTEEIK  604

Query  554  QWLDANQSLE----KDAYESKQKE  573
              L+  Q L     +  Y+S+Q E
Sbjct  605  AALEEVQKLSMKIGEAVYKSQQGE  628

>H310_06631
Length=651

 Score = 460 bits (1184),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 271/610 (44%), Positives = 364/610 (60%), Gaps = 60/610 (10%)

Query  4    ATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQ  62
            A +    +GIDLGTT SCV V +     +I N +G+RTTPS VA  ++ ERL+G  AK Q
Sbjct  21   AASGAEVIGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQ  80

Query  63   VAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQIT-VQFKGESKTFQP  121
               N  NT++  KRLIGRK+ D   Q   K   +++ +G    P  T    + + + + P
Sbjct  81   AVTNPFNTLYAVKRLIGRKYQDKETQDVSKVVSYKIVAG----PNGTDAWVEAQGQKYSP  136

Query  122  EEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEP  151
             +I SMVL KM+E                              DAG IAGL+VLRIINEP
Sbjct  137  SQIGSMVLTKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEP  196

Query  152  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            TAAA+AYGLDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L
Sbjct  197  TAAALAYGLDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEEL  255

Query  212  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID-----  266
            + H   EFKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D     
Sbjct  256  LRHLVSEFKRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPK  313

Query  267  -FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  325
              N  ITRA+FE + G    +T+ P +K ++DA ++K +++EV+LVGG +R+PKVQ  + 
Sbjct  314  HLNIKITRAQFEKLVGHLIERTLNPCKKCVKDAGVTKEEINEVILVGGMSRMPKVQTSVE  373

Query  326  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  385
            +FF GK P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV 
Sbjct  374  EFF-GKRPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVF  427

Query  386  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG  445
            T LI RNTT+PTKKSQ FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG
Sbjct  428  TKLIPRNTTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRG  487

Query  446  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  505
            +PQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+ +I+RMV EAE     D 
Sbjct  488  IPQIEVSFDIDANGIVNVGARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADA  546

Query  506  ANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKD  565
              K+ IEAKN  ++  Y+   +L + + K         A+ D V   +Q +    ++EKD
Sbjct  547  KRKELIEAKNEADSLVYTTEKTLTEHEAKL------DAALVDSVKASLQGV--RDAIEKD  598

Query  566  AYESKQKELE  575
              E+ +  LE
Sbjct  599  DLETLKAALE  608

>PITG_15786
Length=633

 Score = 459 bits (1182),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 280/624 (45%), Positives = 370/624 (59%), Gaps = 64/624 (10%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  A
Sbjct  1    MFSAAAGSEVIGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +++  G   K    V+ KG+   +
Sbjct  61   KRQAVTNPENTFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--Y  117

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
             P +I SMVL KM+E                              DAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  178  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  236

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  266
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVNEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  267  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
                N  ITRA FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  
Sbjct  295  PKHLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTT  354

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            + +FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  468

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSE  503
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+A+I++MV++AE   + 
Sbjct  469  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAA  527

Query  504  DEANKQRIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVI  553
            D+  K+ IEAKN  ++  YS   +L +          E++K  + +   K+  D   E+ 
Sbjct  528  DQQRKELIEAKNDADSTLYSTEKTLKEHEDKIDAETLEQVKTALTDLRTKSEGDNTEEIK  587

Query  554  QWLDANQSLE----KDAYESKQKE  573
              L+  Q L     +  Y+S+Q E
Sbjct  588  AALEEVQKLSMKIGEAVYKSQQGE  611

>PPTG_18274
Length=648

 Score = 459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 280/624 (45%), Positives = 369/624 (59%), Gaps = 64/624 (10%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  A
Sbjct  17   MFSAAAGSEVIGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPA  76

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +++  G   K    V+ KG    +
Sbjct  77   KRQAVTNPENTFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGTK--Y  133

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
             P +I SMVL KM+E                              DAG IAGL+VLRIIN
Sbjct  134  SPSQIGSMVLTKMKETADGFLGKPVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  193

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  194  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  252

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  266
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  253  ELLRYLVDEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  310

Query  267  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
                N  ITRA FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  
Sbjct  311  PKHLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTT  370

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            + +FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  371  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  424

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP P
Sbjct  425  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  484

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSE  503
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+A+I++MV++AE   + 
Sbjct  485  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAA  543

Query  504  DEANKQRIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVI  553
            D+  K+ IEAKN  ++  YS   +L +          EK+K  + +   K+  D   E+ 
Sbjct  544  DQQRKELIEAKNEADSTLYSTEKTLKEHEDKIDAETLEKVKAALADLRTKSEGDNTEEIK  603

Query  554  QWLDANQSLE----KDAYESKQKE  573
              L+  Q +     +  Y+S+Q E
Sbjct  604  AALEEVQKMSMKIGEAVYKSQQGE  627

>H257_01277
Length=652

 Score = 459 bits (1180),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 260/561 (46%), Positives = 346/561 (62%), Gaps = 50/561 (9%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAHN  69
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  ++ ERL+G  AK Q   N +N
Sbjct  28   IGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPYN  87

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            T++  KRLIGRKF D   Q   K   +++ +G  +     V+ +G+   + P +I SMVL
Sbjct  88   TLYAVKRLIGRKFQDKETQEVAKVVSYKIVAGT-NGTDAWVEAQGQK--YSPSQIGSMVL  144

Query  130  IKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
             KM+E                              DAG IAGL+VLRIINEPTAAA+AYG
Sbjct  145  TKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  204

Query  160  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  219
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H   EF
Sbjct  205  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHLVSEF  263

Query  220  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  273
            KR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  ITR
Sbjct  264  KRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKITR  321

Query  274  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  333
            A+FE +      +T+ P +K ++DA ++K +++EV+LVGG +R+PKVQ  + +FF GK P
Sbjct  322  AQFEKLVNHLIERTLNPCKKCVKDAGVTKDEINEVILVGGMSRMPKVQTSVEEFF-GKRP  380

Query  334  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  393
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  381  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  435

Query  394  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  453
            T+PTKKSQ FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG+PQI+V+F
Sbjct  436  TIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRGIPQIEVSF  495

Query  454  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEA  513
            DIDANGI+NV A +K+TGKE  I I +  G LS+ +I+RMV EAE     D   K+ IEA
Sbjct  496  DIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEDEIERMVREAEVNAEADAKRKELIEA  554

Query  514  KNALENYAYSLRNSLNDEKMK  534
            KN  ++  Y+   +L + + K
Sbjct  555  KNEADSLVYTTEKTLTEHEAK  575

>PHYRA_71123
Length=633

 Score = 457 bits (1177),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 279/624 (45%), Positives = 369/624 (59%), Gaps = 64/624 (10%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  A
Sbjct  1    MFSAAAGSEVIGIDLGTTNSCVAVMEGKAARVIENSEGARTTPSVVAILDNDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +++  G   K    V+ KG  K +
Sbjct  61   KRQAVTNPENTFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKY  117

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
             P +I SMVL KM+E                              DAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  178  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  236

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  266
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVDEFKKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  267  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
                N  ITRA FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  
Sbjct  295  PKHLNMKITRATFEQLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTT  354

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            + +FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAP  468

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSE  503
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+++I++MV++AE   + 
Sbjct  469  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSESEIEKMVADAEANAAA  527

Query  504  DEANKQRIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVI  553
            D   K+ IEAKN  ++  Y+   +L +          EK+K  + +   K+  D   E+ 
Sbjct  528  DLERKELIEAKNDADSTLYTTEKTLKEHEDKIDAETLEKVKAALADLRTKSETDNTEEIK  587

Query  554  QWLDANQSLE----KDAYESKQKE  573
              L+  Q +     +  Y+S+Q E
Sbjct  588  AALEEVQKMSMKIGEAVYKSQQGE  611

>PHYCA_541134
Length=633

 Score = 457 bits (1175),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 279/624 (45%), Positives = 368/624 (59%), Gaps = 64/624 (10%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  A
Sbjct  1    MFSAAAGSEVIGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +++  G   K    V+ KG+   +
Sbjct  61   KRQAVTNPENTFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--Y  117

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
             P +I SMVL KM+E                              DAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  178  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  236

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  266
             L+ +   EFK++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVDEFKKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  267  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
                N  ITRA FE + G    +TM P +K ++DA L KS ++EV+LVGG +R+PKVQ  
Sbjct  295  PKHLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQTS  354

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            + +FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  468

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSE  503
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS A+I++MV++AE   + 
Sbjct  469  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAA  527

Query  504  DEANKQRIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVI  553
            D+  K+ IEAKN  ++  Y+   +L +          EK+K  + +   K+  D   E+ 
Sbjct  528  DQQRKELIEAKNEADSTLYTTEKTLTEHEDKIDAETLEKVKAALADLRTKSEGDNTEEIK  587

Query  554  QWLDANQSLE----KDAYESKQKE  573
              L+  Q +     +  Y+S+Q E
Sbjct  588  AALEEVQKMSMKIGEAVYKSQQGE  611

>PHALS_07616
Length=677

 Score = 458 bits (1178),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 278/625 (44%), Positives = 369/625 (59%), Gaps = 56/625 (9%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  A
Sbjct  45   MFSAAAGSEVIGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPA  104

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +++  G   K    V+ KG  K +
Sbjct  105  KRQAVTNPENTFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKY  161

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
             P +I SMVL KM+E                              DAG IAGL+VLRIIN
Sbjct  162  SPSQIGSMVLTKMKETADGFLGKPITQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIIN  221

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  222  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  280

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  266
             L+ +   EFK++   +++ +  A++RLR A E+AKR L   AQ  I +  +        
Sbjct  281  ELLRYLVSEFKKETSINLSGDNLAMQRLREAAEKAKRELDGLAQTDISLPFITADASGPK  340

Query  267  -FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  325
              N  ITRA FE + G    +TM P +K ++DA LSKS ++EV+LVGG +R+PKVQ  + 
Sbjct  341  HLNMKITRATFEKLVGKLIERTMGPCKKCVKDAGLSKSDINEVILVGGMSRMPKVQASVE  400

Query  326  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  385
            +FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV 
Sbjct  401  EFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVF  454

Query  386  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG  445
            T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRG
Sbjct  455  TKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRG  514

Query  446  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  505
            VPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+A+I++MV++AE   + D+
Sbjct  515  VPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQ  573

Query  506  ANKQRIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVIQW  555
              K+ IEAKN  ++  Y+   +L +          EK+K  + +   KA  D   ++   
Sbjct  574  QRKELIEAKNDADSTIYTTEKTLKEHEDKIDAELLEKVKTALADLRTKAEGDNTEDIKAA  633

Query  556  LDANQSLEKDAYESKQKELEGVANP  580
            L+  Q +     E+  K  +G + P
Sbjct  634  LEEVQKMSMKIGEAVYKSQQGESTP  658

>CCI45982
Length=661

 Score = 457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 271/601 (45%), Positives = 357/601 (59%), Gaps = 60/601 (10%)

Query  7    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAM  65
            SG  +GIDLGTT SCV   +     +I N +G RTTPS VA  D  ERL+G  AK Q   
Sbjct  32   SGAVIGIDLGTTNSCVATMEGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQAVT  91

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            N  +T +  KRLIGRK++D       +   +++  G   K    V+ KG+   + P +I 
Sbjct  92   NPESTFYAVKRLIGRKYNDGETNKVKEVVSYKIVPGPNGK-DAWVETKGQK--YSPSQIG  148

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL KM+E                              DAG IAGL+VLRIINEPTAAA
Sbjct  149  SMVLAKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAA  208

Query  156  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            +AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H 
Sbjct  209  LAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHL  267

Query  216  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNS  269
              +FK++   D++++  A++RLR A E+AKR L   AQ  I +   F   D       N 
Sbjct  268  VSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASGPKHLNM  325

Query  270  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  329
             ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PKVQQ + DFF 
Sbjct  326  KITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQAVEDFF-  384

Query  330  GKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  389
            GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI
Sbjct  385  GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLI  439

Query  390  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  449
             RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI
Sbjct  440  PRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQI  499

Query  450  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQ  509
            +V+FDIDANGI+NV+A +K+TGKE  I I +  G LS+ADI+RMV EAE   + D+  K+
Sbjct  500  EVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG-LSEADIERMVQEAEMNATADQQRKE  558

Query  510  RIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVIQWLDAN  559
             IE KN  +   YS   +L +          E++K  + +   KA  D V E+   L+  
Sbjct  559  LIELKNDADGVIYSTEKTLKEYEDKIEATLVEQVKTDLADLRSKAEGDSVDEIKAALEKV  618

Query  560  Q  560
            Q
Sbjct  619  Q  619

>SDRG_11043
Length=649

 Score = 456 bits (1173),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 261/561 (47%), Positives = 344/561 (61%), Gaps = 50/561 (9%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAHN  69
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  ++ ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGA-GDKPQITVQFKGESKTFQPEEISSMV  128
            T++  KRLIGRKF+D   Q   K   +++  G  G    +  Q     + + P +I SMV
Sbjct  87   TLYAVKRLIGRKFNDKETQEVSKVVSYKIVPGTNGSDAWVEAQ----GQKYSPSQIGSMV  142

Query  129  LIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAY  158
            L KM+E                              DAG IAGL+VLRIINEPTAAA+AY
Sbjct  143  LTKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAY  202

Query  159  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
            G+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     E
Sbjct  203  GMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGE  261

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQA-----YIEIDSLFDGIDFNSTITR  273
            FKR+   D++ +  A++RLR A E+AKR L   AQ      +I  D+       N  ITR
Sbjct  262  FKRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLPFITADATGPK-HLNIKITR  320

Query  274  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  333
            A+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PKVQQ + DFF GK P
Sbjct  321  AQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPKVQQSVEDFF-GKRP  379

Query  334  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  393
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  380  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  434

Query  394  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  453
            T+PTKKSQ FST +DNQ  V I+V +GER M  DN  LG F+L  IPP PRG+PQI+V+F
Sbjct  435  TIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQNIPPAPRGIPQIEVSF  494

Query  454  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEA  513
            DIDANGI+NVSA +K+TGKE  I I +  G LS+ +I+RMV EAE     D   K+ IE 
Sbjct  495  DIDANGIVNVSARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIEV  553

Query  514  KNALENYAYSLRNSLNDEKMK  534
            KN  ++  Y+   +L++ + K
Sbjct  554  KNEADSLVYNAEKTLSEHESK  574

>PHYSO_500480
Length=633

 Score = 456 bits (1172),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 278/628 (44%), Positives = 372/628 (59%), Gaps = 62/628 (10%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  59
            M  A      +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  A
Sbjct  1    MFSAAAGSEVIGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPA  60

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTF  119
            K Q   N  NT +  KRLIGRKF D   Q   K   +++  G   K    V+ KG+   +
Sbjct  61   KRQAVTNPENTFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--Y  117

Query  120  QPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIIN  149
             P +I SMVL KM+E                              DAG IAGL+VLRIIN
Sbjct  118  SPSQIGSMVLTKMKETADGFLGKHVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIIN  177

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  178  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  236

Query  210  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  266
             L+ +   EF+++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  237  ELLRYLVDEFRKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATG  294

Query  267  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
                N  I+RA FE + G+   +TM P +K ++DA L KS ++EV+LVGG +R+PKVQ  
Sbjct  295  PKHLNMKISRATFEKLVGNLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQST  354

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            + +FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GG
Sbjct  355  VEEFF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGG  408

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
            V T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP P
Sbjct  409  VFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAP  468

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSE  503
            RGVPQI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+A+I++MV++AE   + 
Sbjct  469  RGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAA  527

Query  504  DEANKQRIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVI  553
            D+  K+ IEAKN  ++  Y+   +L +          EK+K  + +   K+  D   E+ 
Sbjct  528  DQQRKELIEAKNEADSTLYTTEKTLKEHEDKIDAETLEKVKAALADLRTKSEGDNTEEIK  587

Query  554  QWLDANQSLEKDAYES--KQKELEGVAN  579
              L+  Q +     E+  K ++ EG A+
Sbjct  588  AALEEVQKMSMKIGEAVYKAQQGEGAAS  615

>SDRG_05816
Length=479

 Score = 448 bits (1152),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 249/447 (56%), Positives = 317/447 (71%), Gaps = 15/447 (3%)

Query  134  EDAGAIAGLNVLRIINEPTAAAIAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEG  189
            +DAGAIAGL+V RIINEPTAAA+AYGLD   G    + N+LIFDLGGGTFDVS+LSIE G
Sbjct  38   KDAGAIAGLDVKRIINEPTAAALAYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENG  97

Query  190  IFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTL  248
            IFEVK+T GDTHLGGEDFD+ +VD    EFKRK++  D T + R++RRLRTACE AKR L
Sbjct  98   IFEVKSTGGDTHLGGEDFDSNMVDFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRML  157

Query  249  SSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEV  308
            S++  A IE+DSLF+G+DF+ST+TRA+FE +  + F++T E V KVL DA +    + E+
Sbjct  158  STTTSASIEVDSLFEGVDFSSTMTRAKFESLNEECFKRTEETVLKVLADANMQPGDITEL  217

Query  309  VLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlll  368
            VLVGGSTRIPKVQ +LS  F GKE +KSINPDEAVAYGA VQ AILSG   ++    LLL
Sbjct  218  VLVGGSTRIPKVQNMLSAVFGGKELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLL  276

Query  369  ldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDN  428
            +DVTPLSLG+E  G VM+ LI RNT +P KK++ ++T  D Q    + +FEGER+   DN
Sbjct  277  VDVTPLSLGIELVGKVMSVLIKRNTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDN  336

Query  429  NLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA  488
            N LG+F + GI    RG PQI+VTF+IDANGIL+VSA +K TG +N  TI+N++GRL+Q 
Sbjct  337  NKLGEFEISGIERAKRGEPQIEVTFEIDANGILHVSARDKKTGAKNATTISNNRGRLTQQ  396

Query  489  DIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDK  548
            DIDRMV EAEK+K +D    +RI+A+N LE Y Y         +  E   + +  A    
Sbjct  397  DIDRMVEEAEKFKKDDAQMLKRIDARNDLEGYLY---------RALEAASKKNDAAAQTA  447

Query  549  VTEVIQWLDANQSLEKDAYESKQKELE  575
            + E   W+D N+ L     E K++ LE
Sbjct  448  LCEARDWMDDNEELTVRELEDKRRVLE  474

>CCA21514
Length=659

 Score = 452 bits (1162),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 270/604 (45%), Positives = 356/604 (59%), Gaps = 60/604 (10%)

Query  4    ATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQ  62
            A  SG  +GIDLGTT SCV         +I N +G RTTPS VA  D  ERL+G  AK Q
Sbjct  28   AAGSGAVIGIDLGTTNSCVATMDGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQ  87

Query  63   VAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPE  122
               N  +T +  KRLIGRK++D       +   +++  G+  K    V+ KG+   + P 
Sbjct  88   AVTNPESTFYAVKRLIGRKYNDHETNKVKEVVSYKIVPGSNGK-DAWVETKGQK--YSPS  144

Query  123  EISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPT  152
            +I SMVL KM+E                              DAG IAGL VLRIINEPT
Sbjct  145  QIGSMVLGKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPT  204

Query  153  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            AAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+
Sbjct  205  AAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELL  263

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------  266
             H   +FK++   D++++  A++RLR A E+AKR L   AQ  I +   F   D      
Sbjct  264  RHLVSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASGPKH  321

Query  267  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  326
             N  ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PKVQQ + +
Sbjct  322  LNMKITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQAVEE  381

Query  327  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  386
            FF GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T
Sbjct  382  FF-GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFT  435

Query  387  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGV  446
             LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGV
Sbjct  436  KLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGV  495

Query  447  PQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEA  506
            PQI+V+FDIDANGI+NV+A +K+TGKE  I I +  G LS ADI+RMV EAE   + D+ 
Sbjct  496  PQIEVSFDIDANGIVNVAARDKATGKEQNIIIQSSGG-LSDADIERMVQEAEMNAAADQQ  554

Query  507  NKQRIEAKNALENYAYSLRNSLND----------EKMKEKIPEADKKAVDDKVTEVIQWL  556
             K+ IE KN  ++  YS   +L +          E++K  + +   KA  D   E+   L
Sbjct  555  RKEVIELKNDADSVIYSTEKTLKEFEDKIEATLAEQVKTDLADLKSKAEGDSADEIKAAL  614

Query  557  DANQ  560
            +  Q
Sbjct  615  EKVQ  618

>PYAR_22188
Length=634

 Score = 440 bits (1131),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 267/565 (47%), Positives = 337/565 (60%), Gaps = 75/565 (13%)

Query  32   IIANDQGNRTTPSYVAFTDSE-RLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPVVQAD  90
            +I N +G RTTPS VA  D+E RL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENAEGARTTPSVVAILDNEERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  91   IKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMRE----------------  134
             K   +++ +G   K    V+ KG  K + P +I SMVL KM+E                
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKPITQAVVT  124

Query  135  --------------DAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  180
                          DAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  181  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  240
            VS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVTEFKKETSIDLSGDNLAMQRLREA  243

Query  241  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  294
             E+AKR L   AQ  I +   F   D       N  ITRA FE + G+   +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVGNLVERTMGPCKKC  301

Query  295  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAIL  354
            ++DA L K  ++EV+LVGG +R+PKVQQ + +FF GK+P+K +NPDE VA GA +Q  +L
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFF-GKKPSKGVNPDEVVAMGAAIQGGVL  360

Query  355  SGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVL  414
             G+     L D+  L +       ET GGV T LI RNTT+PTKKSQ FST AD+Q  V 
Sbjct  361  RGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVG  415

Query  415  IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKEN  474
            I+V +GER M  DN  LG F+L GIPP PRGVPQI+VTFDIDANGI+NVSA +KSTGKE 
Sbjct  416  IKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSARDKSTGKEQ  475

Query  475  KITITNDKGRLSQADIDRMVSEAEKYKSED----------------------EANKQR--  510
             I I +  G LS ADI+RMV EAE     D                      EA+++R  
Sbjct  476  SIVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIXXXXERMVQEAEMNAEADQKRKA  534

Query  511  -IEAKNALENYAYSLRNSLNDEKMK  534
             IEAKN  ++ AYS   SL + + K
Sbjct  535  LIEAKNEADSVAYSTEKSLKEHEDK  559

>PHYSO_339666
Length=585

 Score = 438 bits (1127),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 260/608 (43%), Positives = 361/608 (59%), Gaps = 68/608 (11%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            VGIDLGTT S VGVW+N+RVE I N Q    TPSYVAFT++  L+G+AAK Q+  N  NT
Sbjct  5    VGIDLGTTGSRVGVWRNERVEFIPNRQQAYWTPSYVAFTETALLVGEAAKRQLTTNPENT  64

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
            VFD  + +GRKFS+  ++  +  WPF+V  G  D PQ+ VQ+KGE+K+F P EI +++L 
Sbjct  65   VFDLTQFVGRKFSE--LRESVIDWPFKVECGPEDTPQVVVQYKGETKSFMPVEIMAILLY  122

Query  131  KMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYGL  160
            +MR+                              DAGAIAGL+V+R++N  T A I YG 
Sbjct  123  EMRKIAEIYLDQEVTKAVFTVPGSFNYFQRQAMKDAGAIAGLDVIRLVNSATVACIEYGF  182

Query  161  DK---KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
            +    + GE NVL+ D G  + +                          FD+RLV+HF  
Sbjct  183  NTLVGRVGELNVLVVDYGASSLN--------------------------FDSRLVEHFAA  216

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
            EF+R+H KD+  +  A+ RLRTACE AKR LSSS +A+IE+D+L DGI+F S I     E
Sbjct  217  EFQRRHGKDLRSDSSAVMRLRTACEHAKRALSSSMEAFIELDALHDGINFYSMIRCVWME  276

Query  278  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  337
             +C D F K +  VEK+LR+A+L K QV E+VLVGGST +PKVQQ L DFFNGK    S+
Sbjct  277  RLCADLFDKMLRLVEKLLREARLRKDQVDEIVLVGGSTHVPKVQQKLKDFFNGK--MLSL  334

Query  338  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL-IARNTTVP  396
              DEA A+G  VQ   L G   S KL + +LLD   L   +E    +M  + +++N+T+P
Sbjct  335  RQDEAAAFGVAVQGDFL-GGLPSPKLDEYMLLDTASLEFSVEIDDCMMKEVPVSKNSTLP  393

Query  397  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  456
             +KS+TF T   N+  + I+ FEGE +    N LL +F +DGI   P  + +I+V  D+D
Sbjct  394  MRKSRTFLTANANKSTMRIKAFEGEATTVATNRLLCEFEMDGITMTPGRLSEIEVAIDVD  453

Query  457  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNA  516
            ANG L VSAVEKSTGKE KITI  +  RLS ++++RM S  E+   + E  + RI++K  
Sbjct  454  ANGSLTVSAVEKSTGKEKKITI--NCSRLSTSEVERMHSNIEETFLDPE-EELRIQSKAV  510

Query  517  LENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEG  576
            LE YA S+ +S      K K   A +  ++    E +QWLD N S +K+ +++K+++L  
Sbjct  511  LERYANSVCSSAAKRIAKLKRSLAKEYTIESSAMEALQWLDTNPSAKKEHFDAKRQKLGE  570

Query  577  VANPVLQK  584
            +A P  Q+
Sbjct  571  MATPSGQR  578

>PYIR_19697
Length=608

 Score = 437 bits (1124),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 254/540 (47%), Positives = 330/540 (61%), Gaps = 50/540 (9%)

Query  32   IIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPVVQAD  90
            +I N +G RTTPS VA  D+ ERL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  91   IKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMRE----------------  134
             K   +++ +G   K    V+ KG  K + P +I SMVL KM+E                
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKTITQAVVT  124

Query  135  --------------DAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  180
                          DAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  181  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  240
            VS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEFKKETSIDLSSDNLAMQRLREA  243

Query  241  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  294
             E+AKR L   AQ  I +   F   D       N  ITRA FE +      +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVSHLIERTMTPCKKC  301

Query  295  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAIL  354
            ++DA L K  ++EV+LVGG +R+PKVQ  + +FF GK+P+K +NPDE VA GA +Q  +L
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQTTVEEFF-GKKPSKGVNPDEVVAMGAAIQGGVL  360

Query  355  SGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVL  414
             G+     L D+  L +       ET GGV T LI RNTT+PTKKSQ FST AD+Q  V 
Sbjct  361  RGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVG  415

Query  415  IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKEN  474
            I+V +GER M  DN  LG F+L GIPP PRGVPQI+V+FDIDANGI+NV+A +K+TGKE 
Sbjct  416  IKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVAARDKATGKEQ  475

Query  475  KITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMK  534
             I I +  G LS ++I+RMV EAE     D+  K+ IE KN  ++ AY+   +L + + K
Sbjct  476  NIVIQSSGG-LSDSEIERMVQEAEMNAEADQKRKELIETKNEADSVAYTTEKTLKEHEEK  534

>PITG_15370
Length=474

 Score = 421 bits (1083),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 231/272 (85%), Positives = 247/272 (91%), Gaps = 3/272 (1%)

Query  136  AGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  195
            AGAIAGLNVLRIINEPTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKA
Sbjct  167  AGAIAGLNVLRIINEPTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKA  226

Query  196  TAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAY  255
            TAGDTHLGGEDFDNRLV+ F  EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAY
Sbjct  227  TAGDTHLGGEDFDNRLVEFFVTEFKRKHRKDMTSNQRALRRLRTACERAKRTLSTSAQAY  286

Query  256  IEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGST  315
            IEIDSLFDG+DFNSTITRARFED+C DYFRKTM+PV +VLRD+KLSK+QV+E+VLVG ST
Sbjct  287  IEIDSLFDGVDFNSTITRARFEDLCSDYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGSST  346

Query  316  RIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtpls  375
            R  KVQQLL DFFNGKE  KSINPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV PLS
Sbjct  347  R-SKVQQLLKDFFNGKELFKSINPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLS  405

Query  376  lglETAGGVMTTLIARN--TTVPTKKSQTFST  405
            LGLETAGGVMT LI RN  T   T K ++ ST
Sbjct  406  LGLETAGGVMTKLIPRNNSTLSLTGKYRSLST  437

>SPRG_02294
Length=634

 Score = 426 bits (1094),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 259/561 (46%), Positives = 343/561 (61%), Gaps = 65/561 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAHN  69
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  ++ ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            T++  KRLIGRKFSD   Q   K   + + +G   +       + + + + P +I SMVL
Sbjct  87   TLYAVKRLIGRKFSDKETQEVSKVVSYNIVAGTNGQ---DAWVEAQGQKYSPSQIGSMVL  143

Query  130  IKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
             KM+E                              DAG IAGL+VLRIINEPTAAA+AYG
Sbjct  144  TKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  203

Query  160  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  219
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     EF
Sbjct  204  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGEF  262

Query  220  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  273
            KR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  ITR
Sbjct  263  KRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKITR  320

Query  274  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  333
            A+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PKVQQ + DFF GK P
Sbjct  321  AQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPKVQQSVEDFF-GKRP  379

Query  334  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  393
             +                 +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  380  RR---------------GGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  419

Query  394  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  453
            T+PTKKSQ FST +DNQ  V I+V +GER M  DN  LG F+L  IPP PRG+PQI+V+F
Sbjct  420  TIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQNIPPAPRGIPQIEVSF  479

Query  454  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEA  513
            DIDANGI+NVSA +K+TGKE  I I +  G LS+ +I+RMV EAE     D   K+ IE 
Sbjct  480  DIDANGIVNVSARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIEV  538

Query  514  KNALENYAYSLRNSLNDEKMK  534
            KN  ++  Y+   +L++ + K
Sbjct  539  KNEADSLVYNAEKTLSEHESK  559

>PYAR_14487
Length=467

 Score = 405 bits (1040),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 216/246 (88%), Positives = 235/246 (96%), Gaps = 0/246 (0%)

Query  341  EAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKS  400
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  184  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243

Query  401  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  460
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303

Query  461  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENY  520
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYKSEDEANK RIEAKN LENY
Sbjct  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363

Query  521  AYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANP  580
            AY+LRN+LNDEK++ +IPE D+KA+DDKVTE+I WLDA+Q+ EK+ +E+KQKELEG+ANP
Sbjct  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423

Query  581  VLQKMY  586
            +LQKMY
Sbjct  424  ILQKMY  429

 Score = 267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 156/246 (63%), Gaps = 71/246 (29%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M Q+ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MAQSVT-GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NT                                     ITV FKGESKTFQ
Sbjct  60   NQVAMNAENT-------------------------------------ITVTFKGESKTFQ  82

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVL KMRE                              DAGAIAGLNVLRIINE
Sbjct  83   PEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV---KATAGDTHLGGEDF  207
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE     AT     L G D 
Sbjct  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQ  202

Query  208  DNRLVD  213
              +L D
Sbjct  203  SEKLQD  208

>HYAP_01993
Length=569

 Score = 400 bits (1027),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 218/527 (41%), Positives = 322/527 (61%), Gaps = 35/527 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVWQN +V IIANDQG RTTP+YV F   E ++GD A N++A +A NT+
Sbjct  5    GIDIGTTHGCVGVWQNGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKLASHADNTI  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+  +D   +  +K WPF VT GA    Q   Q  GE     P E   ++L  
Sbjct  65   FHLKRLLGKAHADVKDREFVKEWPFGVTEGADGVAQAETQRNGEKHAVDPVEFMMLLLQN  124

Query  132  MRE-----------------------------DAGAI-AGLNVLRIINEPTAAAIAYGLD  161
            +++                             DA A   G+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVINKPAHTDEKYTELLDAAAKKVGVNVLTYLSEPLAAAIAYGLD  184

Query  162  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G+  LGGEDF   + +H  + 
Sbjct  185  EAANNDKPEFVLVFDIGGATHDVTLLNADKGLFEVVASKGNDTLGGEDFTAAIFEHCAKS  244

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  245  FLRKTKLDVKPNQKASSRLRLACEAAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  304

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  D  +KT+  +E +L+D +L K  +  VVLVGGS+RIP VQ L+  FF  K  +  ++
Sbjct  305  LINDDVQKTITEIEAILKDNELEKEDIDHVVLVGGSSRIPLVQTLIKKFFENKTLHTQLS  364

Query  339  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            PDEAVA+GAT++A+ L+    S    + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAFGATIEASCLAELLGSEAPAKPLNMVNVVPLTLSVALANGSVSELIQRDTILPA  424

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
              ++ F+T +DNQ    +Q++EG+R M +DN L+ + ++ GI P+P+G  +IDVTF +  
Sbjct  425  SATEVFTTSSDNQEAAFLQIYEGQRLMAKDNTLVAQLSVAGITPLPKGDAEIDVTFTVST  484

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSED  504
             G+L V+A E+  G ++ + + +D  RL+ AD+  +V +A+    ED
Sbjct  485  KGVLTVTASERKAGSKS-LEVMHDSTRLTPADVAAVVKKADDAADED  530

>PHYSO_552116
Length=570

 Score = 397 bits (1021),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 213/517 (41%), Positives = 317/517 (61%), Gaps = 35/517 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+  +D   +  +K WPF +T+GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVADRDFVKEWPFDITAGADGVAQAETQRNGEKHPVSPVEFMALLLQN  124

Query  132  MRE-----------------------------DAGAI-AGLNVLRIINEPTAAAIAYGLD  161
            +++                             DA A  AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVISKPAHTDDSYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  184

Query  162  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   + +H  + 
Sbjct  185  EAANNAKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAAVFEHCAKS  244

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            F RK + D+  NQ+A  RLR ACE AK+TLS+  QA IE+D+L +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRIACEVAKKTLSTQTQANIEVDTLMEGEDFSLKLSRPRFEE  304

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  DY  +T+  +E +L + +L K  +  +VLVGGSTRIP VQ L+  FF+GK  +  ++
Sbjct  305  LITDYVHETITEIEAILEENELEKEDIDHIVLVGGSTRIPLVQNLVKKFFDGKNVHTQLS  364

Query  339  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            PDEAVAYGAT++ + L+           L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAYGATIEGSGLAELVGVPAPKNPLNMVNVVPLNLSVALANGSVSELIQRDTVLPA  424

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I+VTF +  
Sbjct  425  TATELFTTSEDNQEAVYLQIYEGQRLMAKDNTLVAQLSVAGITPLPKGDAEIEVTFTVST  484

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
             G+L V+A E+  GK++ + +T D  RL+ AD+  +V
Sbjct  485  KGVLTVTASERKAGKKS-LEVTQDSKRLTPADVAAIV  520

>PPTG_10122
Length=569

 Score = 394 bits (1011),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 215/517 (42%), Positives = 319/517 (62%), Gaps = 36/517 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+  +D   +  +K WPF VT GA +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVKDRDFVKEWPFDVTQGA-EGAQVETQRSGEKHPVTPVEFMAVLLQN  123

Query  132  MRE-----------------------------DAGAI-AGLNVLRIINEPTAAAIAYGLD  161
            ++E                             DA A  AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  183

Query  162  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H  + 
Sbjct  184  EAANNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKASSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP VQ L+  +F+GK     ++
Sbjct  304  LISDYVHETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFDGKNVRTQMS  363

Query  339  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            PDEAVAYGAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAYGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I+V F +  
Sbjct  424  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPLPKGDAEIEVIFTVST  483

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
             G+L V+A E+  GK++ + +T+D  RL+ AD+  +V
Sbjct  484  KGVLTVTASERKAGKKS-LEVTHDSKRLTPADVAAIV  519

>PYAP_16216
Length=564

 Score = 393 bits (1009),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 209/518 (40%), Positives = 318/518 (61%), Gaps = 37/518 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+G+T+ CVGVWQN +V IIANDQG RTTP++V F   E ++GD A N++  +A NTV
Sbjct  5    GIDIGSTHGCVGVWQNGKVNIIANDQGFRTTPAFVCFEGEEVIVGDTAVNKLHSHAANTV  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KR++G+   +   +  +  W F++T GA           GE+    P +  S +LIK
Sbjct  65   FHLKRVLGKNHEEIASRDFVSEWSFELTKGADGLAVAKTARNGEAHEVSPVDFVS-ILIK  123

Query  132  MRED-------------------------------AGAIAGLNVLRIINEPTAAAIAYGL  160
              +D                               A   AG+NV+  ++EP AAAIAYGL
Sbjct  124  NLKDLAEDFTGETVDSIVINIPAHAGESQKELIRAAATKAGVNVMSYLSEPLAAAIAYGL  183

Query  161  D---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
            D   K       L+FD+GG T DV+LLS+++G+FE+ AT+G+  LGGEDF   + +H  +
Sbjct  184  DENTKNSHAEYALVFDIGGATHDVTLLSVDKGLFEIVATSGNDALGGEDFTKAIFEHCAK  243

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
             F+RK + ++ +NQ+A  RLR ACE AKR+LS+ +Q  IE+DSL +G DF   ++R RFE
Sbjct  244  SFQRKTKLNVKDNQKASSRLRAACETAKRSLSTQSQVNIEVDSLMEGEDFALKLSRPRFE  303

Query  278  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  337
            ++  D+ + +++ VEK+L +A++ K+ +  V+L+GGS+RIP VQ  +  FF+GK+ +  I
Sbjct  304  ELIADFVKDSLKEVEKLLEEAEIEKADIDHVILIGGSSRIPLVQNSVKKFFDGKKTHMHI  363

Query  338  NPDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  396
            +PDE VA+GAT++AA +       E       ++VTPL+L +  A G ++ +I R+T +P
Sbjct  364  SPDEVVAHGATLEAAAIGDIAALGEPKSAQNDVNVTPLTLSVALANGSVSEVIHRDTVLP  423

Query  397  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  456
            T  ++ F+T  DNQ  + IQV+EGER M +DN LL +  + GI P+P+G  +I+VTF I 
Sbjct  424  TSATEVFTTSVDNQDSIFIQVYEGERVMAKDNTLLAQLKVTGISPLPKGEAEIEVTFAIS  483

Query  457  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
            + G+L V+A E S GK+  + + ND  RL+ AD+  ++
Sbjct  484  SKGVLTVTANEASAGKKT-LEVKNDAKRLTAADVAAVI  520

>PHYRA_71591
Length=570

 Score = 391 bits (1004),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 214/517 (41%), Positives = 313/517 (61%), Gaps = 35/517 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+  +D   +  +K WPF VT+GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVSDRDYVKEWPFNVTAGADGVAQAETQRNGEKHPVTPVEFMALLLQN  124

Query  132  MRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYGLD  161
            ++E                               A A AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGEKLEHVVINKPAHTDESYTELLDAAAAKAGVNVLTYLSEPLAAAIAYGLD  184

Query  162  KKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   L +H  + 
Sbjct  185  EASNNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFSAALFEHCAKS  244

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G D +  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRSLSTQTQANIEVDSLMEGEDLSLKLSRPRFEE  304

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  DY  +T+  ++ +L +  L K  +  VVLVGGSTRIP VQ L+  +F GK  +  ++
Sbjct  305  LISDYVHETITEIDAILEENDLEKDDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVHTQLS  364

Query  339  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            PDEAVA+GAT++A+ L+      E  + L L++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAFGATIEASGLAELVGVPEPKKPLNLVNVVPLNLSVALANGSVSELIQRDTVLPA  424

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P  +G  +I+V F +  
Sbjct  425  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPKAKGEVEIEVDFTVST  484

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
             G+L V+A E+  GK++ + +T D  RL+ AD+  +V
Sbjct  485  KGVLTVTASERKAGKKS-LEVTQDSKRLTPADVAAIV  520

>PITG_05721
Length=302

 Score = 379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 208/256 (81%), Positives = 225/256 (88%), Gaps = 12/256 (5%)

Query  134  EDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  193
            +DAGAIAGLNVLRIINEPTAAAIAYGLD+KGGE NVLIFDLGGGTFDVSLL+IE+GIFEV
Sbjct  37   KDAGAIAGLNVLRIINEPTAAAIAYGLDEKGGENNVLIFDLGGGTFDVSLLTIEDGIFEV  96

Query  194  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQ  253
            KATAGDTHLGG DFDNR+V+ F  E K  HR            LRTACER KRTLS+SAQ
Sbjct  97   KATAGDTHLGGGDFDNRMVEFFVTEVKPLHR------------LRTACERTKRTLSTSAQ  144

Query  254  AYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  313
            AYIEIDSLFDG+DFNSTITRARFED+C DYFRKTM+PV +VLRD+KLSK+Q +E+VLVGG
Sbjct  145  AYIEIDSLFDGVDFNSTITRARFEDLCSDYFRKTMDPVAQVLRDSKLSKNQGNEIVLVGG  204

Query  314  STRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp  373
            STRIPKVQQLL DFFNGKE  KS+NPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV P
Sbjct  205  STRIPKVQQLLKDFFNGKELFKSVNPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAP  264

Query  374  lslglETAGGVMTTLI  389
            LSLGLETAG VMT LI
Sbjct  265  LSLGLETAGSVMTKLI  280

>PYU1_G006940
Length=565

 Score = 387 bits (995),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 214/517 (41%), Positives = 322/517 (62%), Gaps = 35/517 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLHSHAENTI  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQV-----------TSGAGDKPQIT-VQF-------  112
            F  KR++G+   D V    I+ W F+V           TS  G+   +T V+F       
Sbjct  65   FHLKRVLGKNHEDVVDHDYIQEWSFKVSKADDGAVHAATSRNGEPHHVTPVEFVSLLIKN  124

Query  113  -KGESKTFQPEEISSMVLI----------KMREDAGAIAGLNVLRIINEPTAAAIAYGLD  161
             K  ++ F  E + S+VL           ++ ++A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEAVDSVVLSIPAHATEKQKELLQEAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  162  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
               K      VL+FD+GG T DV+L++ ++G+FE+ A+AG+  LGGEDF   LV+H  + 
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVASAGNDKLGGEDFTKALVEHCAKA  244

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            F+RK + ++ +N++A  RLR ACE AKRTLS+  Q  IEIDSL +G DF+  ++R RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQTQVNIEIDSLMEGEDFSLKLSRPRFEE  304

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  DY    ++ V+ +L  A + K  V  V+LVGGS+RIP +Q  +  +F+GK  +  ++
Sbjct  305  LINDYVTAALKEVDALLESADVEKEHVDHVILVGGSSRIPLLQNAVKKYFDGKTTHLHLS  364

Query  339  PDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            PDE VA+GATV+A++ +   +     + L  ++VTPL+L +  A G +T LI R T +P 
Sbjct  365  PDEVVAHGATVEASLRADLANFEAPKKALDNVNVTPLTLSVALANGSVTELIHRETVLPA  424

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
              ++TF+T  DNQ  + +Q++EGER M +DN LL    + GI P P+G  +I+VTF ++ 
Sbjct  425  TATETFTTSQDNQTAIFLQIYEGERVMAKDNTLLASLAVSGIAPAPKGEAEIEVTFAVNT  484

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
             G L ++AVE++ GK+  + ++ND  RLS AD+  ++
Sbjct  485  KGALTITAVEQTAGKKT-LEVSNDPKRLSAADVAVII  520

>PYIR_16738
Length=555

 Score = 386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/328 (60%), Positives = 261/328 (80%), Gaps = 1/328 (0%)

Query  259  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  318
            DSL DG DF+ T++RARFE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIP
Sbjct  194  DSLLDGEDFSETLSRARFEKLNEDLFKKTLGPVEKVLKDAGVKKSEVDEIVLVGGSTRIP  253

Query  319  KVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslgl  378
            KVQQL+ D+FNGKEP++ +NPDEAVAYGA VQ  ILSG    E L D++L+DV PLS G+
Sbjct  254  KVQQLIKDYFNGKEPSRGVNPDEAVAYGAAVQGGILSG-AEQEGLGDMVLIDVVPLSQGI  312

Query  379  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  438
            ET GGVMT LI +NT +PTKKSQ FST+ DNQP V I+V+EGER++ +DN+LLGKF+L G
Sbjct  313  ETVGGVMTKLINKNTAIPTKKSQVFSTHVDNQPAVSIKVYEGERALVKDNHLLGKFDLTG  372

Query  439  IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAE  498
            IPP PRGVPQI VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ +IDR++ EAE
Sbjct  373  IPPAPRGVPQIQVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRIIREAE  432

Query  499  KYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDA  558
            ++  ED+  K+RI+++NALE+Y Y+++NS+ D+K+  K+ + DK AV   V + + WL+ 
Sbjct  433  QFAEEDKRVKERIDSQNALESYLYNVKNSVEDDKVAAKMEDEDKDAVLKSVQDAMDWLED  492

Query  559  NQSLEKDAYESKQKELEGVANPVLQKMY  586
            NQ  +KD +++KQKE+E + NP+++K+Y
Sbjct  493  NQEADKDDFDAKQKEVEKIVNPIMKKVY  520

 Score = 160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 100/138 (72%), Gaps = 2/138 (1%)

Query  8    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  66
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  31   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  90

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
               T+FD KRLIGR ++D  VQAD K  P+++    G KP I V  KGE K F PEEIS+
Sbjct  91   PEQTLFDVKRLIGRSYNDKSVQADKKLLPYKIVDKDG-KPAIEVPIKGEKKLFSPEEISA  149

Query  127  MVLIKMREDAGAIAGLNV  144
            M+L KM++ A    G ++
Sbjct  150  MILTKMKQIAEGYLGKDI  167

>PITG_03546
Length=569

 Score = 385 bits (988),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 211/517 (41%), Positives = 316/517 (61%), Gaps = 36/517 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F   R++G+  +D   +  +K WPF VT G+ +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLNRILGKAHADIKDRDFVKEWPFDVTQGS-EGAQVETQRNGEKHPVTPVEFMAVLLQN  123

Query  132  MRE-----------------------------DAGAI-AGLNVLRIINEPTAAAIAYGLD  161
            ++E                             DA A  AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGLD  183

Query  162  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H  + 
Sbjct  184  EATSNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            F RK + D+  NQ+   RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKTSSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP VQ L+  +F GK     ++
Sbjct  304  LITDYVNETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVRTQMS  363

Query  339  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            PDEAVA+GAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAFGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P P+G  +I+VTF + +
Sbjct  424  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPQPKGDAEIEVTFTVSS  483

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
             G+L V+A E+  GK++ + +T D  RL+ AD+  +V
Sbjct  484  KGVLTVTAAERKAGKKS-LEVTQDSKRLTPADVAAIV  519

>PHYKE_64
Length=569

 Score = 384 bits (985),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 208/517 (40%), Positives = 310/517 (60%), Gaps = 35/517 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A +T+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADSTI  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            +  KRL+G+  +D   +  +K WPF V  GA           GE     P +  +++L  
Sbjct  65   YHLKRLLGKSHADVASRDFVKSWPFDVMEGAKGGAHAETVRNGEKHEVSPVDFMALLLQN  124

Query  132  MRE------------------------------DAGAIAGLNVLRIINEPTAAAIAYGLD  161
            ++E                               A   AG+ VL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGETLEHVVISKPAHADEKHQELLNAAAEKAGVKVLTYLSEPLAAAIAYGLD  184

Query  162  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
            +         VL+FD+GG T DV+LL+ ++G+FEV ++ G   LGGEDF N + +H  + 
Sbjct  185  EAANNPKPEYVLVFDIGGATHDVTLLNADKGLFEVLSSKGKDTLGGEDFTNAVFEHCAKS  244

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            F RK + D+  NQ+A  RLR ACE AKRTLS+  Q+ IE+DSL +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRTLSTQTQSNIEVDSLMEGEDFSLKLSRPRFEE  304

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  DY    M+ V+ +L + +L K  +  VVLVGGSTRIP VQ ++   F GK  +  + 
Sbjct  305  LIIDYVTDIMKEVDAILEENELEKDDIDHVVLVGGSTRIPLVQSMIKKSFEGKTTHLQMP  364

Query  339  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            PDE +AYGAT++A+ L+    + E  + + +++V PL+L +  A G ++ LI R T +P 
Sbjct  365  PDEVIAYGATIEASGLAELVDAPEPKKPVNMVNVVPLNLSVALANGSVSELIQRETILPA  424

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GIPPM +G  +I+VTF +  
Sbjct  425  THTELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVAGIPPMSKGDAEIEVTFTVST  484

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
             G+L+V+A E+  GK+  + +TND  RLS AD+  +V
Sbjct  485  KGVLSVTASERKAGKKT-LEVTNDPKRLSTADVAAIV  520

>PHALS_00390
Length=569

 Score = 375 bits (962),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 212/543 (39%), Positives = 320/543 (59%), Gaps = 37/543 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KRL+G+   +   +  +K W F V   A +   +  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKNHDEIKDRNFVKEWSFSVAQNA-EGVTVETQRNGEKHHVTPVEFMALLLQN  123

Query  132  MRE-----------------------------DAGAI-AGLNVLRIINEPTAAAIAYGLD  161
            ++E                             DA A  AG+NVL  ++EP AAAIAYG D
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDSRYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGFD  183

Query  162  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
            +         VL+FD+GG T DV+LL++++G+F+V A+ G   LGGE+F   + DH  + 
Sbjct  184  EAVNNEKPEYVLVFDIGGATHDVTLLNVDKGLFQVVASKGKDTLGGENFTAAVFDHCAKA  243

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            F RK + DI  NQ+A  RLR ACE AKR+LS+  Q+ IE+DSL +G DF   ++R RFE+
Sbjct  244  FLRKTKLDIKSNQKASSRLRIACEAAKRSLSTQTQSNIEVDSLMEGEDFALKLSRPRFEE  303

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  ++  +T+  ++ +L +  L K  +  ++LVGGSTRIP VQ ++  +F GK     ++
Sbjct  304  LISNFVNETITEIDVILEENDLEKDDIDHIILVGGSTRIPLVQNVVKKYFEGKNVRTQLS  363

Query  339  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            PDEAVA+GAT++A+ L      S+ ++ + ++++ PL+L L  A G +  LI R T +P 
Sbjct  364  PDEAVAFGATIEASCLVELVGVSKPIEPVNMVNMVPLNLSLALANGSVAELIHRETILPA  423

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ +  + GI P+P+G   I+VTF +  
Sbjct  424  TVTEIFTTSCDNQETVYLQIYEGQRIMAKDNTLVAQLKVSGITPLPKGDAAIEVTFTVST  483

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIE-AKNA  516
             G+L V+A E+  G ++ I +T D  RL+ AD+  +V  AE    ED+     +E A+ A
Sbjct  484  KGVLTVTASERMAGTKS-IQVTQDSKRLTPADVAAIVKNAEDAADEDDVLLGELEDAEKA  542

Query  517  LEN  519
             EN
Sbjct  543  AEN  545

>PYIR_24123
Length=567

 Score = 374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/517 (40%), Positives = 320/517 (62%), Gaps = 35/517 (7%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E ++GD A N+++ +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIVGDTAVNKLSSHAENTI  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQV-----------TSGAGDKPQIT-VQF-------  112
            F  KR++G+   + V +  I+ W F+V           TS  G+   +T V+F       
Sbjct  65   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSEDGAVHAATSRNGEAHHVTPVEFVSLLIKN  124

Query  113  -KGESKTFQPEEISSMVLI----------KMREDAGAIAGLNVLRIINEPTAAAIAYGLD  161
             K  ++ F  E + ++VL           ++ + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGESVDNVVLSIPAHVTEKQKELLQAAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  162  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
               K      VL+FD+GG T DV+L++ ++G+FE+ AT+G  +LGGEDF   L +H  + 
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVATSGKDNLGGEDFTKALFEHCAKA  244

Query  219  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
            F+RK + ++ +N++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  304

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP +Q  +   F+GK  +  ++
Sbjct  305  LISDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVKKHFDGKTTHLHLS  364

Query  339  PDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  397
            PDE VA+GAT++A++ +   +     + L  ++VTPL+L +  A G +  +I R+T +P 
Sbjct  365  PDEVVAHGATIEASLRADLANFESPKKALNHVNVTPLTLSVALANGSVAEVIHRDTVLPA  424

Query  398  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  457
              ++TF+T  DNQ  + +QV+EGER M +DN LL   ++ GI P P+G  +I+VTF ++ 
Sbjct  425  TATETFTTSQDNQTAIFLQVYEGERVMAKDNTLLASLSVAGIAPAPKGEAEIEVTFTVNT  484

Query  458  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
             G+L ++AVE++ GK+  + + ND  RL+  D+  ++
Sbjct  485  KGVLTITAVEQAAGKKT-LEVKNDPKRLTAKDVADII  520

>SDRG_10038
Length=565

 Score = 373 bits (958),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 207/512 (40%), Positives = 306/512 (60%), Gaps = 36/512 (7%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
             +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA N
Sbjct  3    CIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAAN  62

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TV+  KR++G+K SD      IK W F V + A       V  K   +     E +S+VL
Sbjct  63   TVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKRDVSATEFASLVL  122

Query  130  IKMR------------------------------EDAGAIAGLNVLRIINEPTAAAIAYG  159
             K++                               +A   AG++V+R I+EP AAAIAYG
Sbjct  123  GKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAYG  182

Query  160  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
             D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV+H  +
Sbjct  183  FDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALVEHCVK  242

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
             F+R+ + D+ +N RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D    ++R+RFE
Sbjct  243  TFERQKKVDLKDNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRFE  302

Query  278  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  337
            +M GD+ RK +  +E +L +A L K  +  V+L GGSTRIPKVQ  +  FF+GK+ + +I
Sbjct  303  EMIGDHVRKMVTDIETLLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKKASSTI  362

Query  338  NPDEAVAYGATVQAAILS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             PDE +AYGATV+AA LS      +     L +++  PL+L L  A G +  +I RNT +
Sbjct  363  VPDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVL  422

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            P    + F+T+ DNQ  V +Q++EG+R M RDN LL    + GIPPM +G P+I+V+F++
Sbjct  423  PATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNV  482

Query  456  DANGILNVSA-VEKSTGKENK-ITITNDKGRL  485
                +L V A +  + G ++K +T+ +D  R+
Sbjct  483  TRKSVLTVKAHLRNAEGAKSKALTVESDSKRV  514

>SPRG_11133
Length=676

 Score = 375 bits (962),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 216/439 (49%), Positives = 283/439 (64%), Gaps = 48/439 (11%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +GIDLGTT   VGVW++ +VE++ ND GN +TPS VAFTD+ RL+GD AK+Q   NA NT
Sbjct  10   IGIDLGTTTCSVGVWRHGQVEMVRNDNGNLSTPSCVAFTDAGRLVGDFAKSQAPRNAPNT  69

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
            VF+  R+IGR++ +   +        QV  G  + P I V  KGE+K   PEEI + +++
Sbjct  70   VFNIMRIIGRRYDEVRKKT-------QVVCGPKNNPMIRVVEKGETKELHPEEILAELVV  122

Query  131  KMRED------------------------------AGAIAGLNVLRIINEPTAAAIAYGL  160
            K+++D                              A AIAGL   RI + PT AA+A+  
Sbjct  123  KLKDDVVTYTNARIEHAVVTVPTGFNLLQRQAVRDACAIAGLAKYRISDAPTTAAVAH-T  181

Query  161  DKKGGER---NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
              KG  R   + ++ D+GGG   VSLL+IE+GIFEVKA AGD  LGGEDFD+ L DHF  
Sbjct  182  SIKGAPRCEVHDMVVDMGGGHLSVSLLAIEDGIFEVKAVAGDACLGGEDFDDVLFDHFAA  241

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
            EF R++RKD+T   RA+RRLRTACE+AKR LS S  A +E++ LF  IDF S+ITRARFE
Sbjct  242  EFARQYRKDMTTCDRAVRRLRTACEKAKRDLSISNTATLELEVLFGSIDFRSSITRARFE  301

Query  278  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS-  336
            D+C   FRK  +P+EKVLRDAK+ KSQV +VVL GGS R+PK+QQLLS FF  +  +K  
Sbjct  302  DLCSGLFRKVTQPIEKVLRDAKIDKSQVRDVVLAGGSMRMPKMQQLLSSFFGERYADKKL  361

Query  337  ----INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  392
                +N +EA A+GATV AA+   +++S     LL+L V P S+G+ET GGVMTTLI+RN
Sbjct  362  CHSILNNNEAAAHGATVMAAL--NDETSPDDMHLLVLHVVPYSVGIETGGGVMTTLISRN  419

Query  393  TTVPTKKSQTFSTYADNQP  411
            TT+P+KKS+ F       P
Sbjct  420  TTIPSKKSEKFKISQPQSP  438

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 67/145 (46%), Gaps = 24/145 (17%)

Query  415  IQVFEGERSMTRDNNLLGKFNLDGI-PPMPRGVPQIDVTFDIDANGILN-VSAVEKSTGK  472
            I++F GERSM RDN  L    + G   P  R     DV FDID +G+L  +       G 
Sbjct  523  IKIFTGERSMVRDNTPLHTIAIHGFYDPTARS----DVAFDIDGDGLLTAIVTYTPHIGT  578

Query  473  ENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEK  532
               I +  DKG LSQ D+ R+ +  E   + D+  ++R+ A   L+ Y            
Sbjct  579  NETIVVKLDKGYLSQHDVKRLTTNFE--AAADDRTRRRV-AHEELQTYL-----------  624

Query  533  MKEKIPEADKKAVDDKVTEVIQWLD  557
            +  K P    +A D    EV++WLD
Sbjct  625  IGGKYPYW--RAAD--AAEVLEWLD  645

>PHYCA_532207
Length=1118

 Score = 384 bits (986),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 210/518 (41%), Positives = 315/518 (61%), Gaps = 35/518 (7%)

Query  11    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
             +GID+GTT+ CVGVW N +V +IANDQG RTTP+YV F   E ++GD A N++  +A NT
Sbjct  552   IGIDIGTTHGCVGVWHNGKVNVIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNT  611

Query  71    VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
             +F  KRL+G+   +   +  +K WPF VT GA    Q   +  GE     P E  +++L 
Sbjct  612   IFHLKRLLGKAHDEIKDRDFVKEWPFDVTEGAEGVAQAETKRNGEKHPVTPVEFMTLLLQ  671

Query  131   KMRE-----------------------------DAGAI-AGLNVLRIINEPTAAAIAYGL  160
              +++                             DA A  AG+NVL  ++EP AAAIAYGL
Sbjct  672   NLKDLAEDFTGEKLEHVVISKPAHTDEKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGL  731

Query  161   DKKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
             D+         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   + +H  +
Sbjct  732   DEAANNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAAVFEHCAK  791

Query  218   EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
              F RK + D+  NQ+A  RLR ACE AKRTLS+  QA IE+D+L +G DF   ++R RFE
Sbjct  792   SFLRKTKLDVKTNQKASSRLRIACETAKRTLSTQTQANIEVDTLMEGEDFALKLSRPRFE  851

Query  278   DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  337
             ++  DY  +T+  ++ +L + +L K  +  +VLVGGSTRIP VQ L+  +F GK  +  +
Sbjct  852   ELINDYVHETITEIDAILEENELEKEDIDHIVLVGGSTRIPLVQTLVKKYFEGKTVHTQL  911

Query  338   NPDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVP  396
             +PDEAVAYGAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +P
Sbjct  912   SPDEAVAYGATIEASGLAELVDVPEPKKPLNMVNVVPLNLSVALANGSVSELIQRDTILP  971

Query  397   TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  456
                ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I+VTF + 
Sbjct  972   ATATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPLPKGDAEIEVTFTVS  1031

Query  457   ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
               G+L V+A E+  G ++ + +  D  RL+ AD+  +V
Sbjct  1032  TKGVLTVTASERKAGNKS-LEVAQDAKRLTPADVAAIV  1068

>PYVX_17692
Length=551

 Score = 363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 201/516 (39%), Positives = 312/516 (60%), Gaps = 25/516 (5%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GIDLG+T+ CVGVW N +V IIANDQG RTTP++V F   E ++GD A +++  +A +TV
Sbjct  5    GIDLGSTHGCVGVWHNGKVNIIANDQGFRTTPAFVCFEGDEVIVGDTAVHKLPAHADSTV  64

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            F  KR++G+  +D   +  ++ WPF V +G G     T Q  G +    P +  +++L  
Sbjct  65   FHLKRVLGKSQADVASRPFVQDWPFDVAAGEGGAAVATTQKNGAAHQVAPVDFLALLLRN  124

Query  132  MREDAGAIAGLNVLRII-NEPTAA------------------AIAYGLDKKGGERNVLIF  172
            +R+ A    G  V  ++ + P  A                   +AY  +     + VL+F
Sbjct  125  LRDLAQDFTGETVEHVVLSVPPHADEAHRALIRDAAAAAEVNVLAYIPEPTPEPQYVLVF  184

Query  173  DLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQR  232
            D+GG T DV+LL+ ++G+F+V AT GD  LGGEDF + + +H  + F+RK + D+  NQ+
Sbjct  185  DIGGATHDVTLLTADKGLFDVTATQGDDALGGEDFTSAVFEHCAKAFQRKTKLDVRGNQK  244

Query  233  ALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVE  292
            A  RLR ACE AKR+LS+  Q  IE+DSL +G DF+  ++R RFE++  DY +K ++ VE
Sbjct  245  ASSRLRLACETAKRSLSTQTQVTIEVDSLLEGEDFSLKLSRPRFEELINDYVKKALDEVE  304

Query  293  KVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAA  352
             +L   +L K  +  VVL+GGSTRIP VQ  +  FF+GK  +  ++PDE VA+GAT++AA
Sbjct  305  ALLEAQELDKEDIDHVVLIGGSTRIPLVQSSVKSFFDGKRTHLHLSPDEVVAHGATIEAA  364

Query  353  ---ILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADN  409
                L G    +  +    ++ TPL+L +  A G ++ L+ R+T +P   ++TF+T AD+
Sbjct  365  GRGDLVG--VPDPKKPANQVNATPLTLSVALANGSVSELVHRDTVLPASATETFTTSADD  422

Query  410  QPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  469
            Q  V +Q++EGER M +DN LL +  + GI  +P+G  +IDVTF +   G+L V+A E+S
Sbjct  423  QTAVFLQIYEGERLMAKDNTLLAQLAVTGITALPKGEAEIDVTFTVSTKGVLTVTAEERS  482

Query  470  TGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  505
             GK+  + + +D  RL+ AD+  +V + +    ED+
Sbjct  483  AGKKT-LEVKHDDKRLTAADVAAIVQKGKDAAEEDD  517

>PPTG_02121
Length=222

 Score = 350 bits (897),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 179/212 (84%), Gaps = 31/212 (15%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MTQAT SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQAT-SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNA NTVFDAKRLIGRKFSDP+VQADIKHWPF++TSG GDKPQITVQFKGESKTFQ
Sbjct  60   NQVAMNAANTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  182
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVS
Sbjct  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  211

>PYAR_24704
Length=525

 Score = 354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 195/495 (39%), Positives = 292/495 (59%), Gaps = 42/495 (8%)

Query  27   NDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPV  86
            N +V IIANDQG RTTP+YV F   E ++GD A N+V  +A NT+F  KR++G+   D  
Sbjct  1    NGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKVHSHAANTIFHLKRVLGKNHEDVA  60

Query  87   VQADIKHWPFQVTSGA-----------GDKPQIT-VQF--------KGESKTFQPEEISS  126
                +  W F V  GA           G   ++T V+F        K  ++ F  E + S
Sbjct  61   ASDFVSEWSFDVAKGADGAVVAKTSRNGADHEVTPVEFLSILLKNLKNLAEDFTGETVDS  120

Query  127  MVLI----------KMREDAGAIAGLNVLRIINEPTAAAIAYGLD---KKGGERNVLIFD  173
            +V+           ++   A A AG+NVL  ++EP AAAIAYGLD   K       ++ D
Sbjct  121  VVISLSAHGGENQKELISAAAAKAGVNVLSYLSEPLAAAIAYGLDENTKNSHAEYAVVVD  180

Query  174  LGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRA  233
            +GG T DV+L+SI++G+FE+  T G+  LGGEDF   + +H  + F+RK + ++ +N +A
Sbjct  181  IGGATHDVTLVSIDKGLFEIVGTHGNDSLGGEDFTKAVFEHCVKAFQRKTKLNVKDNAKA  240

Query  234  LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEK  293
              RLR ACE AKRTLS+ +Q  IE+D+L +G DF   ++R RFE++  DY + +++ VEK
Sbjct  241  SSRLRVACEAAKRTLSTQSQVNIEVDTLMEGEDFALKLSRPRFEELIVDYVKTSLKEVEK  300

Query  294  VLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAI  353
            VL DA + KS V  V+L+GGS+RIP VQ  +  FF+GK+ +  ++PDE VA+GAT++AA 
Sbjct  301  VLEDADVDKSDVDHVILIGGSSRIPLVQTSVKKFFDGKKTHMHMSPDEVVAHGATLEAAA  360

Query  354  LS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQP  411
            +S   N    + +   +             G V  T++      PT  ++ F+T ADNQ 
Sbjct  361  ISELANFDPAESEQNNVAVTPLTLSVALANGSVSETVL------PTSATEVFTTSADNQD  414

Query  412  GVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTG  471
             + IQV+EGER+M +DN LL +  +DGI P+P+G  +I+VTF + + G+L V+A E + G
Sbjct  415  AIFIQVYEGERAMAKDNTLLAQLRVDGISPLPKGEAEIEVTFAVSSKGVLTVTANEAAAG  474

Query  472  KENKITITNDKGRLS  486
            K+  + + ND  RL+
Sbjct  475  KKT-LEVKNDGARLT  488

>H310_12765
Length=560

 Score = 355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 202/520 (39%), Positives = 301/520 (58%), Gaps = 39/520 (8%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCMVSFASDDVVVGDSAVAKLHNNAAN  62

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TV+  KR++G+K  D      +K W F + +     P    +    S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKDVHAHEYVKDWSFDLAADKHGAP--IAKILDGSRDIHAVEFCTIVL  120

Query  130  IKMR------------------------------EDAGAIAGLNVLRIINEPTAAAIAYG  159
             K++                              ++A + A LNVLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGSSVKNSVLTVPEGYSDEQKALLQEAASAADLNVLRYISEPIAAAIAYG  180

Query  160  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
            LD  KK   +  ++ D+GG + D++LLS+++G+F V ATA D  LGGE F N +V+H  +
Sbjct  181  LDEDKKNESKLAVVVDIGGASTDLTLLSVDKGLFNVIATASDHALGGEVFTNSVVEHCIK  240

Query  218  EFKRKHRKDIT-ENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  276
             F+R+ +  I  +N RAL R++ A E+AK++LS+  Q  IE+DSL DG D    ++R+RF
Sbjct  241  TFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQTQVTIEVDSLADGQDLIVKLSRSRF  300

Query  277  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  336
            EDM  D+ RK  + +  +L  A   K  +  V+L+GGSTRIPKVQ  + DFF+GK+   +
Sbjct  301  EDMVIDHIRKVTKDIAALLEGAGYEKDSIDHVLLIGGSTRIPKVQTAVEDFFDGKKALVT  360

Query  337  INPDEAVAYGATVQAAILSGNds-seklqdlllldvtplslglETAGGVMTTLIARNTTV  395
            I PDEAVA+GATV++  LS     +     L  ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESGTLSETADWTLPEDPLNNVEAVPLNLSLGLADGTVYDMIHRGTIL  420

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            P    + F+T  DNQ  V +QV+EG+R + +DN LL    L GIPP P+G  +++V+F +
Sbjct  421  PANHQEVFTTQVDNQHAVYLQVYEGQRVLKKDNTLLANLTLTGIPPAPKGESEVEVSFTV  480

Query  456  DANGILNVSA-VEKSTGKENKITITNDKGRLSQADIDRMV  494
               G L V A V  + G    + + +D  R+   D++ +V
Sbjct  481  TRKGQLTVKAHVRNAEGGSKALVVASDSKRV--VDVNAIV  518

>SPRG_15695
Length=581

 Score = 353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 203/512 (40%), Positives = 297/512 (58%), Gaps = 46/512 (9%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
             +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA N
Sbjct  29   CIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAAN  88

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TV+  KR++G+K SD      IK W F V + A       V  K   +     E +S+VL
Sbjct  89   TVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKREISATEFASLVL  148

Query  130  IKMR------------------------------EDAGAIAGLNVLRIINEPTAAAIAYG  159
             K++                               +A   AG++V+R I+EP AAAIAYG
Sbjct  149  GKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAYG  208

Query  160  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
             D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV+H  +
Sbjct  209  FDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALVEHCVK  268

Query  218  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  277
             F+R+ + D+  N RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D           
Sbjct  269  TFERQKKVDLKNNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLI---------  319

Query  278  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  337
             M GD+ RK +  +E +L +A L K  +  V+L GGSTRIPKVQ  +  FF+GK+ + +I
Sbjct  320  -MIGDHVRKMITDIEALLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKKASSTI  378

Query  338  NPDEAVAYGATVQAAILS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  395
             PDE +AYGATV+AA LS      +     L +++  PL+L L  A G +  +I RNT +
Sbjct  379  VPDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVL  438

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            P    + F+T+ DNQ  V +Q++EG+R M RDN LL    + GIPPM +G P+I+V+F++
Sbjct  439  PATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNV  498

Query  456  DANGILNVSA-VEKSTGKENK-ITITNDKGRL  485
                +L V A +  + G ++K +T+ +D  R+
Sbjct  499  TRKSVLTVKAHLRNAEGAKSKALTVESDSKRV  530

>H257_07650
Length=563

 Score = 349 bits (895),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 197/490 (40%), Positives = 288/490 (59%), Gaps = 36/490 (7%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCIVSFASDDVVVGDSAVAKLHNNAAN  62

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
            TV+  KR++G+K  +      +K W F + +     P    +    S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKEVHEHDYVKDWSFDLAADTHGAP--IAKILDGSRDISSVEFCTIVL  120

Query  130  IKMREDAGAIAG------------------------------LNVLRIINEPTAAAIAYG  159
             K++  A    G                              L+VLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGVVVKNAVLTVPEGYSDEQKALLEEAATAADLSVLRYISEPIAAAIAYG  180

Query  160  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  217
            LD  KK   + V++ D+GG + D++LLSI++G+F V ATA D  LGGE F N +V+H  +
Sbjct  181  LDEDKKNESKLVVVVDIGGASTDLTLLSIDKGLFNVIATASDHALGGEVFTNSIVEHCVK  240

Query  218  EFKRKHRKDIT-ENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  276
             F+R+ +  I  +N RAL R++ A E+AK++LS+ +Q  IE+DSL DG D    ++R+RF
Sbjct  241  AFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRF  300

Query  277  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  336
            EDM  D+ RK  + +  +L  A  +K  +  V+LVGGS+RIPK Q  + DFF+GK+   S
Sbjct  301  EDMVSDHVRKVTKDIAALLDGAGYAKDTIDHVLLVGGSSRIPKAQSAVEDFFDGKKALVS  360

Query  337  INPDEAVAYGATVQAAILSGNds-seklqdlllldvtplslglETAGGVMTTLIARNTTV  395
            I PDEAVA+GATV++A LS     +        ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESATLSETADWTLPTDPHNNVEAVPLTLSLGLADGTVYEMIHRGTVL  420

Query  396  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  455
            P    + F+T ADNQ  V +QV+EG+R + +DN LL    L GIPP P+G  +++V+F++
Sbjct  421  PANVQEVFTTNADNQDAVYLQVYEGQRVLKKDNTLLANLTLSGIPPAPKGESEVEVSFNV  480

Query  456  DANGILNVSA  465
               G L V A
Sbjct  481  TRKGQLTVKA  490

>PITG_15111
Length=186

 Score = 335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  7    PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR  66

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            LV+ F  EFKRKHRKD+T NQRALRRLRTACERAKRTL +SAQAYIEIDSL+DG+DFNST
Sbjct  67   LVEFFVTEFKRKHRKDMTSNQRALRRLRTACERAKRTLFTSAQAYIEIDSLYDGVDFNST  126

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ITRARFED+C DYFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIPKVQQLL DFFNG
Sbjct  127  ITRARFEDLCSDYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPKVQQLLKDFFNG  186

>PYIW_17145
Length=443

 Score = 335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 191/396 (48%), Positives = 256/396 (65%), Gaps = 18/396 (5%)

Query  160  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  219
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  1    MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEF  59

Query  220  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  273
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  60   KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  117

Query  274  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  333
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PKVQ  + DFF GK+P
Sbjct  118  ATFEKLVNHLIERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTTVEDFF-GKKP  176

Query  334  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  393
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  177  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLITRNT  231

Query  394  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  453
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI+V+F
Sbjct  232  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSF  291

Query  454  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEA  513
            DIDANGI+NV+A +K+TGKE  I I +  G LS ++I+RMV EAE     D   K+ IEA
Sbjct  292  DIDANGIVNVAARDKATGKEQNIVIQSSGG-LSDSEIERMVQEAEMNAEADLKRKELIEA  350

Query  514  KNALENYAYSLRNSL--NDEKMKEKIPEADKKAVDD  547
            KN  ++ AY+   +L  ++EK+ ++  EA K  +++
Sbjct  351  KNEADSVAYTTEKTLKEHEEKLDKETVEAVKAGLEN  386

>PHYSO_549561
Length=361

 Score = 325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 184/366 (50%), Positives = 250/366 (68%), Gaps = 11/366 (3%)

Query  211  LVDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  269
            +V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+S
Sbjct  1    MVEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSS  60

Query  270  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  329
            T+TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F 
Sbjct  61   TVTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFG  120

Query  330  GKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  389
            GKE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI
Sbjct  121  GKELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLI  179

Query  390  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  449
             RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ+
Sbjct  180  KRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQV  239

Query  450  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQ  509
            +VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D    +
Sbjct  240  EVTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLR  299

Query  510  RIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYES  569
            RIEA+N LE + Y         +  E   E     V+  + +   WL+ ++       E 
Sbjct  300  RIEARNDLEQFIY---------RAIEMAREKGDTNVESAIRDARDWLEDHEEATLRELED  350

Query  570  KQKELE  575
            K++ LE
Sbjct  351  KKRMLE  356

>CCI47582
Length=582

 Score = 332 bits (852),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 193/553 (35%), Positives = 302/553 (55%), Gaps = 50/553 (9%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHADN  62

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
             VF  +RL+G+K+ +      +  W F+V     D+ Q     K   + ++   +  + L
Sbjct  63   IVFHLRRLLGKKYEEIAENPHVNEWFFKVEKDGKDEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  130  I--------------------------------KMREDAGAIAGLNVLRIINEPTAAAIA  157
            +                                ++   A   A L+++  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVLTTSIHCTDRQQQLLTQAAKEAQLDIMSYLPDPIAAAIA  182

Query  158  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  207
            YG D       KK  +     +L+ D+GG T  ++LLS+++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPNNYKKANQCQADLILVVDIGGATTAITLLSVDKGLFEIVADGGHEGRGGEDL  242

Query  208  DNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  267
               +VDH  Q F RK + DI +N++A+ RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAQSFLRKTKVDIHKNRKAMIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  268  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  327
            +  ++R RFE++   + R   E ++KVL +A   K  V  ++LVGGS RIP +Q+ +  +
Sbjct  303  SMKLSRPRFEELIQKHVRFIFEEIDKVLVNADTEKENVDHIILVGGSCRIPLIQEKIQSY  362

Query  328  FNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGV---  384
            F     +  ++PDE VA GAT++AA L          D L   V   ++ L  + G+   
Sbjct  363  FKDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLDQHVNVNAVPLSLSVGLVHG  422

Query  385  -MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
             + TLI R+  +P K ++TF+T+ DNQ  VLI+++EGER++   N LL +  + GI P+P
Sbjct  423  NVHTLIHRDAILPAKMTETFTTWEDNQTEVLIEIYEGERAIAEKNTLLARMCVSGIAPLP  482

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKIT-ITNDKGRLS-QADIDRMVSEAEKYK  501
            +G  +I +   + + G+L V A     G+E KI  I  D+ RL+ +  +D++V  A    
Sbjct  483  KGEAEIILQVQVSSKGVLTVKA--SMNGEEKKILEIHTDEARLADKKQLDQIVEAANDAI  540

Query  502  SEDEANKQRIEAK  514
             ED+     IE K
Sbjct  541  DEDDTFLTEIENK  553

>PPTG_16727
Length=217

 Score = 318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 167/208 (80%), Gaps = 31/208 (15%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            MT+  T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MTEKVT-GQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
            NQVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPF+V  GA +KPQ+ VQFKGESKTFQ
Sbjct  60   NQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQ  119

Query  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150
            PEEISSMVLIKMRE                              DAGAIAGLNVLRIINE
Sbjct  120  PEEISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGT  178
            PTAAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  180  PTAAAIAYGLDKKGGEHNVLIFDLGGGT  207

>PYIW_19165
Length=1124

 Score = 343 bits (880),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 195/516 (38%), Positives = 297/516 (58%), Gaps = 56/516 (11%)

Query  12    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
             GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  585   GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLTSHAENTI  644

Query  72    FDAKRLIGRKFSDPVVQADIKHWPFQV-----------TSGAGDKPQIT-VQF-------  112
             F  KR++G+   + V +  I+ W F+V           TS  GD   +T V+F       
Sbjct  645   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSDDGAVHAATSRNGDAHHVTPVEFVSLLIKN  704

Query  113   -KGESKTFQPEEISSMVLI----------KMREDAGAIAGLNVLRIINEPTAAAIAYGLD  161
              K  ++ F  E +  +VL           ++ + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  705   LKDLAEDFTGETVDDVVLSIPAHATEKQKELLQAAADKAGVNVLTFISEPIAAAIAYGLD  764

Query  162   ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
                K     +VL+FD+GG T DV+L++ ++G+FE+ AT+G   LGGEDF   L +H  + 
Sbjct  765   DSAKGSHPESVLVFDIGGATHDVTLINADQGLFEIVATSGKDDLGGEDFTKALFEHCAKT  824

Query  219   FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
             F+RK   D+ +N++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  825   FQRKTTLDVKKNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  884

Query  279   MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
             +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP +Q  +   F+GK  +  ++
Sbjct  885   LIYDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVMKHFDGKTTHLHLS  944

Query  339   PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  398
             PDE VA+GAT++A++ +                       E+    +  +   N T P  
Sbjct  945   PDEVVAHGATIEASLRA------------------DIANFESPKKPLNHV---NVT-PLT  982

Query  399   KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  458
              S   +  +DNQ  + +QV+EGER M +DN LL   ++ GI   P+   +I+VTF +   
Sbjct  983   LSVALANGSDNQTAIFLQVYEGERVMAKDNTLLASLSVTGIAAAPKSEAEIEVTFTVSTK  1042

Query  459   GILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  494
             G+L+++AVE++ G +  + + +D  RL+ AD+  ++
Sbjct  1043  GVLSITAVEQAAGTKT-LEVKSDPKRLTAADVAAII  1077

>CCA20229
Length=583

 Score = 328 bits (840),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 197/553 (36%), Positives = 300/553 (54%), Gaps = 50/553 (9%)

Query  10   SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHAEN  62

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFK--GESKTFQPEEISSM  127
             VF   RL+G+   +    A +  W F+V   + ++ Q     K  GE       E  ++
Sbjct  63   IVFHLGRLLGKSHEEVAENAHVNEWFFKVEKDSKNEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  128  VLIKMREDAGAIAGL------------------------------NVLRIINEPTAAAIA  157
            +L  ++  A    GL                              NV+  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVISTSIHCTTEQKQVLAQAAKDAELNVMSYLPDPIAAAIA  182

Query  158  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  207
            YG D       KK  +     +L+ D+GG T  V+LL++++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPKNYKKANQSTAQLILVVDIGGATTAVTLLNVDKGLFEIVADGGSEFRGGEDL  242

Query  208  DNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  267
               +VDH  + F RK +  I  N++A  RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAKSFLRKTKVAIQNNRKATIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  268  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  327
            +  ++R RFE++  D+ R   E ++ VL  A + K  V  V+LVGGS RIP +Q+ +  +
Sbjct  303  SMKLSRPRFEELIQDHVRFIFEEIDAVLEKADVDKENVDHVILVGGSCRIPLIQEKIQTY  362

Query  328  FNGKEPNKSINPDEAVAYGATVQAA----ILSGNdsseklqdlllldvtplslglETAGG  383
            F     +  ++PDE VA GAT++AA    +L      + L+    ++  PLSL +  A G
Sbjct  363  FGDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLEQHANVNAVPLSLSVGLAHG  422

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
             + TLI R+  +P K  +TF+T+ DNQ   LI+++EGER++   N LL +  + GI P+P
Sbjct  423  NVHTLIHRDVVLPAKMMETFTTWEDNQTEALIEIYEGERAIAEKNTLLAQMCISGITPLP  482

Query  444  RGVPQIDVTFDIDANGILNVSAVEKSTGKENK-ITITNDKGRLSQA-DIDRMVSEAEKYK  501
            +G  +I +   + + G+L V A+    G+E K + I  D+ RL+ A  +D +V  A    
Sbjct  483  KGEAEIIIELQVSSQGLLTVRAI--LNGEEKKMLEIHTDQARLADAKKLDHIVEAANAAM  540

Query  502  SEDEANKQRIEAK  514
             ED+     IE K
Sbjct  541  DEDDTFLTEIENK  553

>PHYKE_2977
Length=220

 Score = 313 bits (802),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 162/170 (95%), Gaps = 0/170 (0%)

Query  417  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  476
            VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI
Sbjct  1    VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  60

Query  477  TITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEK  536
            TITNDKGRLSQADIDRMV+EAEKYKSEDEANK RIEAKNALENYAY+LRN+LNDEK+K++
Sbjct  61   TITNDKGRLSQADIDRMVAEAEKYKSEDEANKIRIEAKNALENYAYNLRNTLNDEKLKDQ  120

Query  537  IPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
            I E DKKA+DDKVTE I WLDANQS EK+ +E KQKELEGVANP+LQKMY
Sbjct  121  ITEDDKKAIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMY  170

>SDRG_05778
Length=618

 Score = 297 bits (761),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 174/240 (73%), Gaps = 36/240 (15%)

Query  8    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  247

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NA NTVFDAKR+IGR FSDP+V+ D  H+PF++  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  126  SMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAA  155
            SMVL +M+E                              DAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  156  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

 Score = 154 bits (390),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 122/196 (62%), Gaps = 9/196 (5%)

Query  380  TAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGI  439
            T G VM+ LI RNT +P KK++ ++T  D Q  V + ++EGER+    NN LG+F + GI
Sbjct  428  TVGRVMSVLIKRNTAIPIKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGI  487

Query  440  PPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEK  499
                RG PQ+ VTF+IDANGILNVSA++K T  + + TI N+ GRL+Q DIDRMV++AEK
Sbjct  488  ERAKRGEPQVQVTFEIDANGILNVSALDKKTNAKAETTINNNNGRLTQEDIDRMVADAEK  547

Query  500  YKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDAN  559
            +K +D    ++IEA+N+LE++ Y         +  E   E    A ++ + E  +WL+ +
Sbjct  548  FKKDDAEVLKKIEARNSLESFIY---------RALELTREKGDAAAENTIREAREWLEDH  598

Query  560  QSLEKDAYESKQKELE  575
            +       E K++ LE
Sbjct  599  EDATLRELEEKKRVLE  614

>PHALS_12790
Length=214

 Score = 277 bits (708),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)

Query  424  MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  483
            MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  484  RLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKK  543
            RLSQADIDRMVSEAEKYKSEDEANK RIEAKN LENYAY+LRN+LNDEK+K ++ + DKK
Sbjct  61   RLSQADIDRMVSEAEKYKSEDEANKVRIEAKNGLENYAYNLRNTLNDEKLKGQLSDDDKK  120

Query  544  AVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANPVLQKMY  586
            A+DDKVTE I WLDANQS EK+ +E KQKELEGVANP+LQKMY
Sbjct  121  AIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMY  163

>PITG_16528
Length=561

 Score = 286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 199/505 (39%), Positives = 281/505 (56%), Gaps = 59/505 (12%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDSER--LIGDAAKN-Q  62
             +GIDLGTT SCVG+W  DR  V+I  N  D+G RTTPS V F    +   +G+ A   +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKIFKNHLDRG-RTTPSVVRFDPKSQSVAVGNVAVGLE  80

Query  63   VAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKT-FQP  121
             +    NT+   KRL+G+KF    V     +  ++V   A     + V  +G+ K   QP
Sbjct  81   TSEPVENTIRSVKRLMGQKFDSKAVDVARIYASYEVAPTAQGNVAVQV-VRGQKKVQVQP  139

Query  122  EEISSMVLIKMREDAGA--------------------------------IAGLNVLRIIN  149
            EE+S+ VL +++  A A                                +AG   +R++N
Sbjct  140  EEVSACVLRELKASADAYFDGHTKLDNVVITVPAYFSDTQRKATIASASMAGFKAVRLLN  199

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYGL    G + V +FD GGGT DVSLLSIE+G FEV    GDT+LGGED +N
Sbjct  200  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIEDGKFEVLGIGGDTNLGGEDINN  258

Query  210  RLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  266
             L+DH      R+H  ++T  Q     + RL+   E+AK  LS    A I +  + D   
Sbjct  259  TLLDHVLDVLYRRH--NVTRAQVGQADMVRLKREVEKAKIELSEQEDAEISVHDIADVST  316

Query  267  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  326
            F  T+TR +FE +C   ++K +  V  VLRDA++  S + EV+LVGGSTRIP ++  +S+
Sbjct  317  FTYTLTRRKFEQLCDAIWKKCLRIVSSVLRDAEVEPSDIDEVILVGGSTRIPVLRTKISE  376

Query  327  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  386
             FNGKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  377  AFNGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSME  435

Query  387  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  444
             ++ RN  +PT  ++ F TY D Q G+ ++V+EGE+ + ++N+ +  FN      +PR  
Sbjct  436  VILLRNARIPTTVTKYFQTYEDEQRGLTVEVYEGEKEVAKENDHICYFNF----ALPRDK  491

Query  445  ----GVPQIDVTFDIDANGILNVSA  465
                G     VTF ++A+GIL V A
Sbjct  492  VGKAGEFAHPVTFTMNASGILQVQA  516

>PYAR_24687
Length=618

 Score = 287 bits (735),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 187/544 (34%), Positives = 284/544 (52%), Gaps = 44/544 (8%)

Query  6    TSGYSVGIDLGTTYSCVGVWQND--RVEIIANDQGNRTTPSYVAF--TDSERLIGDAAKN  61
            ++ + + ID GT+ +   V +N   +VEII ND+G+  TP+YV +     E ++G  AK 
Sbjct  35   SAHHMIAIDFGTSNTRAAVVRNTTGQVEIIPNDKGHSATPTYVTWDSVTGEVIVGRDAKQ  94

Query  62   QVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQP  121
            Q  +   NT FD K+L+GR F    VQ+ I   P+ +     +KP I V+ KGE++ F  
Sbjct  95   QALLQPKNTAFDFKQLLGRSFDSKEVQSAIAQLPYTIID-RDNKPFIQVEMKGETREFSV  153

Query  122  EEISSMVLIKMR----------------------EDA--------GAIAGLNVLRIINEP  151
            EE+++MVL +M+                      EDA         A+AGL   R++NEP
Sbjct  154  EEVTAMVLTRMKQFAEAYLGEEIENAVVTVPASFEDAQREAMKAACAMAGLTTRRVLNEP  213

Query  152  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            TAA + +G+  K   ER VL+    GG  D +LL I+EGI EV  T   +H  G++   R
Sbjct  214  TAATMGFGIKPKTQHERKVLVVHFDGGALDATLLEIDEGIVEVLVT--KSHRIGDEVTQR  271

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
            ++DH   ++K     DI+ + R L+RLR   ER +  LS   +A + I+S         +
Sbjct  272  VMDHCISQWKYDKHVDISTDPRMLQRLRLEAERVQHALSEQTEAVVTIESSSGSAVLTQS  331

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
             +RA  E M  D     +E VE  L +  ++K +V  +V  GG++RIP ++QL+ + F  
Sbjct  332  FSRATLETMTRDLAEPLVEIVEIALMNGGVAKQEVDGIVFAGGASRIPMLRQLMVERFGW  391

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
             E    ++ +E V +GA   A I+ G       +  +L  +       ETAGGVM  +++
Sbjct  392  IELQCDVDEEEVVVHGAAAIADIIHGQAVDATAELNILPWIVNSLGV-ETAGGVMLPVLS  450

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  450
            R+   PT+ +QT ST   NQ  + I+VFEGER +T+DN+ +G+  L G+ P P+GVP+I+
Sbjct  451  RHRLTPTRATQTVSTLHANQLDITIRVFEGERLLTKDNHFIGQLRLSGLAPAPQGVPRIE  510

Query  451  VTFDIDANG-ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEA-EKYKSEDEANK  508
            V F+ DA G  L  +A  + T   + +TI   K        D  V +A E  K ED   K
Sbjct  511  VEFETDAMGETLFATARVEGTNLADSLTIQVAKHAFEH---DEAVRKAGEDAKDEDTKVK  567

Query  509  QRIE  512
             RIE
Sbjct  568  ARIE  571

>SDRG_17122
Length=361

 Score = 278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 224/370 (61%), Gaps = 50/370 (14%)

Query  76   RLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMRE-  134
            R+IGR++ +    A       QV  G+ + P I V  KG++K   PEE+ + +++K+++ 
Sbjct  2    RIIGRRYDEVRKTA-------QVVRGSMNNPIIRVIEKGDAKELHPEEVLAELVVKLKDD  54

Query  135  -----------------------------DAGAIAGLNVLRIINEPTAAAIAY----GLD  161
                                         DA AIAGL   RI +  T AA+ +    G+ 
Sbjct  55   VAAYTNARIEHAIVTVPTGFNLLQRQAVRDACAIAGLTNYRIKDVSTTAAVGHTSIKGMP  114

Query  162  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  221
            ++ G    ++ DLGGG   V LL IE GIFEV+A AG T LGGEDFD+ L DHF  EF R
Sbjct  115  RREGHD--MVVDLGGGHLSVPLLMIENGIFEVEAVAGITCLGGEDFDDHLYDHFVAEFSR  172

Query  222  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  281
            KHRKD+T   RA+RRLRTACE+ KR LS S  A +E++ LF  IDF S+ITRARFE +C 
Sbjct  173  KHRKDMTTCNRAVRRLRTACEKVKRDLSVSNTATLELEMLFGDIDFCSSITRARFEALCS  232

Query  282  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS-----  336
            + F K  + +EKVLRDAK++KSQV +VVL GGS R+PK+QQLLS FF G   +K      
Sbjct  233  ELFSKVTKLIEKVLRDAKINKSQVRDVVLAGGSMRMPKMQQLLSTFFGGANVDKKLCHSI  292

Query  337  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  396
            +N +EA A+GATV AA + G   +      L+LD    S+G+ET GGV+T+LI+RNTT+P
Sbjct  293  LNNNEAAAHGATVMAAAVYGE--TWPDSRFLVLDAVSDSVGIETDGGVLTSLISRNTTIP  350

Query  397  TKKSQTFSTY  406
             KKS+ F  +
Sbjct  351  AKKSKKFEIF  360

>PHYRA_51904
Length=129

 Score = 268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 128/128 (100%), Gaps = 0/128 (0%)

Query  6    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61

Query  66   NAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEIS  125
            NAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQPEEIS
Sbjct  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121

Query  126  SMVLIKMR  133
            SMVLIKMR
Sbjct  122  SMVLIKMR  129

>PHALS_00667
Length=142

 Score = 268 bits (684),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)

Query  424  MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  483
            MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  484  RLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKK  543
            RLSQA+IDRMV+EA+KYKSEDEANK R+EAKNALENYAYSLRNSLN+EKMKE IP+ADKK
Sbjct  61   RLSQAEIDRMVAEADKYKSEDEANKVRVEAKNALENYAYSLRNSLNEEKMKESIPKADKK  120

Query  544  AVDDKVTEVIQWLDANQSLEKD  565
             VDDKVTEVIQWLDA+QS EK+
Sbjct  121  VVDDKVTEVIQWLDAHQSSEKE  142

>PHYSO_493381
Length=562

 Score = 277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 193/505 (38%), Positives = 279/505 (55%), Gaps = 58/505 (11%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDSERLIGDAA-KNQ  62
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  T     +G+AA + +
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVRFEPTTQRADVGNAAVQLE  80

Query  63   VAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKT-FQP  121
                  NTV   KRL+G+KF          +  ++V S A     + V   G+ K   QP
Sbjct  81   TQEPVGNTVRSVKRLMGQKFESKAADVARIYATYKVVSTAQGNAAVQVARGGQKKVHVQP  140

Query  122  EEISSMVLIKMREDAGA--------------------------------IAGLNVLRIIN  149
            EE+S+ VL +++  A A                                +AG   +R++N
Sbjct  141  EEVSACVLAELKASAEAYFDGSVKLDNVVITVPAYFSDSQRKATITSASMAGFKAVRLLN  200

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYGL   G  + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +N
Sbjct  201  EPTAAAMAYGLFLSG-TKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDINN  259

Query  210  RLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  266
             LVDH  +   + H  D+   Q     + RL+   E+AK  LS+   A IE+  +     
Sbjct  260  ILVDHLLEVLYKHH--DVARAQVGEGDMVRLKREVEKAKIELSAEDYAEIELQGIAGVKT  317

Query  267  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  326
            F  T+ R +FE +C   ++K +  V  VL++A++    + EV+LVGGSTRIP ++  +S+
Sbjct  318  FTYTLMRRKFEQLCDPIWKKCLRIVTSVLKEAEVEAVDIDEVILVGGSTRIPILRTKISE  377

Query  327  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  386
             F GKE   S+N DE V  GA +QAAILSG       +D+L++D  PL +GLETA G M 
Sbjct  378  AFGGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDALPLPIGLETADGSME  436

Query  387  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  444
             ++ RN  +PT  ++ F T+ D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR  
Sbjct  437  VILPRNARIPTTVTKYFQTFEDDQLGLTVEVYEGEKEIAKENDHICYFNF----ALPRDK  492

Query  445  ----GVPQIDVTFDIDANGILNVSA  465
                G     VTF ++A+GIL V A
Sbjct  493  IGKAGEFAHPVTFTMNASGILQVQA  517

>PYU1_G002895
Length=561

 Score = 275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 193/505 (38%), Positives = 282/505 (56%), Gaps = 56/505 (11%)

Query  8    GYSVGIDLGTTYSCVGVWQNDR--VEII--ANDQGNRTTPSYVAF---TDSERLIGDAAK  60
            G  +GIDLGTT SC+G+W  +R  V+I+  A D+  RTTPS V F   ++    +G AA 
Sbjct  21   GLCIGIDLGTTNSCIGMWHVERNHVKILKSAKDR-KRTTPSVVRFDPASEHAYEVGHAAI  79

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120
             Q      NTV   KRL+G+K++   V+       + V S       + V    +    Q
Sbjct  80   AQETQPVGNTVRSIKRLMGQKYASKAVEVAKSFGTYTVASTKQGNAAVQVVRNEKPALLQ  139

Query  121  PEEISSMVLIKMREDAGA-------------------------------IAGLNVLRIIN  149
            PEE+S+ +L  ++  A A                               +AG  V+R++N
Sbjct  140  PEEVSACILSDLKASAEAYFDGKRIDNVVITVPAYFSDSQRKATITSASMAGFKVIRLMN  199

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N
Sbjct  200  EPTAAAMAYGL-FVAGTKIVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNN  258

Query  210  RLVDHFTQEFKRKH---RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  266
             ++DH ++   + H   R  +T N   + +L+T  ERAK  LS+   A I +  +     
Sbjct  259  VIIDHLSELLHKHHDVARSRLTMND--MIQLKTQAERAKIELSNEDTAKIRLRDVAGIPA  316

Query  267  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  326
            F  T+TR +FE +C   ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +SD
Sbjct  317  FEYTLTRHKFEQLCESIWKKCLRIVSSVLKEAEVEVADVDEVVMVGGSTRIPILRSKISD  376

Query  327  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  386
            FFNGKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  377  FFNGKELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETADGRME  435

Query  387  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  444
             +I +N  +P   ++ F T+ DNQ G+ I+V+EGE  + ++N+ +  FN      +PR  
Sbjct  436  VIIPKNARIPVSLTKYFQTFEDNQRGLTIEVYEGENEVAKENDHICYFNFT----LPRDK  491

Query  445  ----GVPQIDVTFDIDANGILNVSA  465
                G     VTF ++A+G+L V A
Sbjct  492  VGKAGEFAHPVTFTMNASGVLQVQA  516

>PHYRA_79054
Length=563

 Score = 275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 190/506 (38%), Positives = 279/506 (55%), Gaps = 60/506 (12%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  S +   D     VA+
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRSDRG-RTTPSVVRFDPSSQ-AADVGNAAVAL  79

Query  66   NAH----NTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKT-FQ  120
                   NT+   KRL+G+KF          +  ++V   A     + V   G+     Q
Sbjct  80   ETCEPLGNTIRSVKRLMGQKFDSKAADVARIYAGYRVLPTAQGNVAVQVLRGGKRDIQVQ  139

Query  121  PEEISSMVLIKMREDAGA--------------------------------IAGLNVLRII  148
            PEE+S+ VLI+++  A A                                +AG   +R++
Sbjct  140  PEEVSACVLIELKASAEAYFEDGRRLENVVITVPAYFSDSQRKATITSASMAGFKAVRLL  199

Query  149  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  208
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  200  NEPTAAAMAYGL-FLSGRKVVTVFDFGGGTLDVSLLSIDDGKFEVLGIGGDTNLGGEDIN  258

Query  209  NRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  265
            N L DH  +   + H  D+T  Q     + RL+   E+AK  LS+   A + +  +    
Sbjct  259  NTLCDHLLEVLYKHH--DVTRAQVGDVDMVRLKREVEKAKIELSTEEYADVTVHGIAGVK  316

Query  266  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  325
             F  ++ R++FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP ++  +S
Sbjct  317  TFTYSLLRSKFEQLCDPIWKKCLRIVSSVLKEAEMEAADIDEVILVGGSTRIPILRTKIS  376

Query  326  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  385
            + FNGKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M
Sbjct  377  EAFNGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSM  435

Query  386  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-  444
              ++ RN  +PT  ++ F T+ D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR 
Sbjct  436  EVILPRNARIPTTVTKNFQTFEDDQRGLTVEVYEGEKDIAKENDHICYFNF----ALPRD  491

Query  445  -----GVPQIDVTFDIDANGILNVSA  465
                 G     VTF ++A+GIL V A
Sbjct  492  KIGKAGEFAHPVTFTMNASGILQVQA  517

>PHYCA_6458
Length=560

 Score = 275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 193/508 (38%), Positives = 280/508 (55%), Gaps = 65/508 (13%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDSERLI--GDAAKN-Q  62
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + +  G+ A   +
Sbjct  21   CLGIDLGTTNSCVGMWHVDRHHVKILKNRLDRG-RTTPSVVRFNPQSQSVDVGNVAIGLE  79

Query  63   VAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQ---FKGESKT-  118
             +    NT+   KRL+G+KF+         +  ++V       PQ  V     +G+ K  
Sbjct  80   TSEPVGNTIRSVKRLMGQKFASKATDVARIYASYEVAP----TPQGNVAAQVVRGQKKVQ  135

Query  119  FQPEEISSMVLIKMREDA--------------------------------GAIAGLNVLR  146
             QPEE+S+ +L +++  A                                 ++AG   +R
Sbjct  136  VQPEEVSACILTELKASAEGYFDGQVKLDNVVITVPAYFSDSQRKATITAASMAGFKAVR  195

Query  147  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGED  206
            ++NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED
Sbjct  196  LLNEPTAAAMAYGL-FLSGTKMVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGED  254

Query  207  FDNRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFD  263
             +N LVDH  +   + H+  +T  Q     + RL+ A E+AK  LS      I +  +  
Sbjct  255  INNVLVDHLLEVLYKHHK--VTRAQVGEADMVRLKRAVEKAKIELSEEEDVEITVHDIAG  312

Query  264  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
               F  T+TR +FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP ++  
Sbjct  313  VEKFAFTLTRRKFEQLCDPIWKKCLRIVSSVLKEAQVEAADIDEVILVGGSTRIPILRTK  372

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            +SD FNGKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G
Sbjct  373  ISDAFNGKELCLSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETADG  431

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
             M  ++ RN  +PT  ++ F TY D Q G+ ++V+EGE+   ++N+ +  FN      +P
Sbjct  432  TMEVILPRNARIPTTVTKYFQTYEDGQRGLTVEVYEGEKENAKENDHICYFNF----ALP  487

Query  444  R------GVPQIDVTFDIDANGILNVSA  465
            R      G     VTF ++A+GIL V A
Sbjct  488  RDKIGKAGEFAHPVTFTMNASGILQVQA  515

>PPTG_05819
Length=561

 Score = 275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 192/506 (38%), Positives = 280/506 (55%), Gaps = 61/506 (12%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDSERLIGDAAKNQVAM  65
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + + D     V +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKILKNSLDRG-RTTPSVVRFDPKSQSV-DVGNVAVGL  79

Query  66   NAH----NTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKT-FQ  120
                   NT+   KRL+G++F +  V     +  ++V   A     + V  +G  K   Q
Sbjct  80   ETSEPVGNTIRSVKRLMGQRFENKAVDVARIYASYEVAPTAQGNVAVQV-VRGHKKVQVQ  138

Query  121  PEEISSMVLIKMREDAGA--------------------------------IAGLNVLRII  148
            PEE+S+ VL +++  A A                                +AG   +R++
Sbjct  139  PEEVSACVLRELKASAEAYFDGQTKLDNVVITVPAYFSDAQRRATITSASMAGFKAVRLL  198

Query  149  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  208
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  199  NEPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDIN  257

Query  209  NRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  265
            N L+DH      ++H  ++T  Q     + R++   E+AK  LS    A I +  +    
Sbjct  258  NTLLDHLLDVLYKRH--NVTRAQVEQGDMVRVKREVEKAKIELSEQESADITVYEIAGVS  315

Query  266  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  325
             F  T+TR +FE +C   ++K +  V  VL+ A++  + + EV+LVGGSTRIP ++  +S
Sbjct  316  TFKYTLTRRKFEQLCDPIWKKCLRIVASVLKHAEVDAADIDEVILVGGSTRIPVLRTKIS  375

Query  326  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  385
            + FNGKE  KS+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M
Sbjct  376  EAFNGKELCKSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGTM  434

Query  386  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-  444
              ++ RN  +PT  ++ F TY D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR 
Sbjct  435  EVILPRNARIPTTVTKYFQTYEDDQRGLTVEVYEGEKEIAKENDHICYFNF----ALPRD  490

Query  445  -----GVPQIDVTFDIDANGILNVSA  465
                 G     VTF ++A+GIL V A
Sbjct  491  KIGKAGEFAHPVTFTMNASGILQVQA  516

>PYAR_14579
Length=567

 Score = 272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 189/507 (37%), Positives = 284/507 (56%), Gaps = 58/507 (11%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDS--ERLIGDAAKNQV  63
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  S  E L+G+AA  + 
Sbjct  22   CIGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVHFLPSSHEVLVGNAAIARE  80

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESK-TFQPE  122
                 NTV   KRL+G++F    VQ   K     + + A     + VQ  G+     QPE
Sbjct  81   YEPPGNTVRAIKRLMGQRFDSRAVQLASKFATHSIVATAQGNAAVQVQRGGDGVIAVQPE  140

Query  123  EISSMVLIKMREDAGA----------------------------------IAGLNVLRII  148
            EI++ VL +++  A A                                  +AG   +R++
Sbjct  141  EIAAEVLRELKASAEAYWEQTHSKRIDNVVITVPAYFNDSQRKATILSAQMAGFKAVRLL  200

Query  149  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  208
            NEPTAAA+AYGL    GE++V++ D GGGT DVSLL+I +G F+V    GDT+LGGED +
Sbjct  201  NEPTAAAMAYGL-FVSGEKHVVVVDFGGGTLDVSLLAIHDGKFQVLGIGGDTNLGGEDIN  259

Query  209  NRLVDHFTQEFKRKHRKDITENQRA-LRRLRTACERAKRTLSSSAQAYIEIDSL---FDG  264
            + ++ H  +  +R+     +   R+ L +++   ERAK  LS+     +E+ +L      
Sbjct  260  DLVMAHVLENLQRQRSVPRSALSRSDLIQIKREVERAKVALSTDESVELELPNLGPLAKQ  319

Query  265  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  324
              F   +TR +FE +CG  + + ++ VE VLR+A +   ++ EV++VGGSTRIP V+  +
Sbjct  320  KPFTLVLTRTKFESLCGSIWTRCLDIVEDVLREAGVETHEIDEVIMVGGSTRIPIVRSKV  379

Query  325  SDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGV  384
            S FF+ KE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLE A G 
Sbjct  380  SAFFHDKELCVSVNADEVVCEGAAIQAAILSG-IDKRVFRDVLMMDVIPLPIGLEKADGR  438

Query  385  MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR  444
            M  L+A+N+ +P   ++ F T+ D Q G+ +QV+EGE+ M ++N+ +  F+     P+PR
Sbjct  439  MEVLLAKNSRIPVSVTKYFETFEDGQRGLTVQVYEGEKEMAKENDHISDFSF----PLPR  494

Query  445  ------GVPQIDVTFDIDANGILNVSA  465
                  G  +  VT  ++A+G+L V A
Sbjct  495  DKIGKAGEFRHPVTLTMNASGVLQVQA  521

>H257_16775
Length=291

 Score = 257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 182/266 (68%), Gaps = 54/266 (20%)

Query  323  LLSDFFNGK--EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglET  380
            +LSDF   +  +P     PDEAVA+GATVQAAILSGNDSS++LQD               
Sbjct  43   ILSDFCKKQVGQP-----PDEAVAFGATVQAAILSGNDSSDRLQD---------------  82

Query  381  AGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIP  440
                +  L     ++  K+  TFST  DNQPG LIQVFEGERSMTRDNNLLGKF+ DGIP
Sbjct  83   ----LLFLHVTPLSLGLKQPATFST--DNQPGALIQVFEGERSMTRDNNLLGKFSFDGIP  136

Query  441  PMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKY  500
            PM RGVPQ+DVTFDIDANGILNVS +EKSTGKE  ITITN KGRLS+ DI          
Sbjct  137  PMHRGVPQVDVTFDIDANGILNVSTIEKSTGKE--ITITNAKGRLSKDDI----------  184

Query  501  KSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQ  560
                      IE  N LENYAY+LRN+LN EK++ K+ EADKK ++DKVTE I+WLDA  
Sbjct  185  ----------IERMNGLENYAYNLRNTLNVEKLQGKLDEADKKVMEDKVTETIKWLDAT-  233

Query  561  SLEKDAYESKQKELEGVANPVLQKMY  586
               K+ YE+KQKELEGVANP++QK+Y
Sbjct  234  ---KEEYEAKQKELEGVANPIMQKLY  256

>PHALS_02692
Length=557

 Score = 265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 188/505 (37%), Positives = 276/505 (55%), Gaps = 59/505 (12%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAF--TDSERLIGDAAKN-QV  63
             +GIDLGTT SCVG+W  DR  V+I  N     RTTPS V F  T     +G AA + + 
Sbjct  18   CLGIDLGTTNSCVGMWYVDRNHVKIFKNRLNRGRTTPSVVHFDPTSQSVDVGQAAIDLET  77

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQF-KGESKT-FQP  121
            +    NT+   KRL+G+K+          +  ++V   A  +  + VQ  +G  K   QP
Sbjct  78   SEPVGNTIRSIKRLMGQKYESKATDVARIYASYEVAPTA--QKNVAVQLVRGHKKVQVQP  135

Query  122  EEISSMVLIKMREDAGA--------------------------------IAGLNVLRIIN  149
            EE+S+ +L +++  A A                                +AG   +R++N
Sbjct  136  EEVSAYILTELKTSAEAYFDGQTRLNNVVITVPAYFSDAQRKATITSALMAGFKAVRLLN  195

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAA+AYGL    G + V +FD GGGT DVSLL I++G FEV    GDT+LGGED +N
Sbjct  196  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLRIQDGKFEVLGIGGDTNLGGEDINN  254

Query  210  RLVDHFTQEFKRKH---RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  266
             ++DH  +   ++H   R  +T     L RL+   E+ K  LS    A + +  L     
Sbjct  255  LVLDHVLEVLNKRHNVIRSQVTGAD--LVRLKQEVEKLKIQLSVEESADVIVRDLAGVPR  312

Query  267  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  326
               T+TR +FE +C   ++K +  +  VL++A++  + + EV+LVGGSTRIP ++  +S 
Sbjct  313  VTVTLTRRKFEQLCDPIWKKCLRIMSSVLKEAQVDAADMDEVILVGGSTRIPCLRSKISK  372

Query  327  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  386
             F+GKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  373  AFHGKELCMSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETADGTME  431

Query  387  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  444
             ++ RN  +PT  ++ F+TY DNQ G+ I+V+EGE+ + ++N+ +  FN      +PR  
Sbjct  432  VILPRNARIPTTVTKYFTTYEDNQRGITIEVYEGEKDIAKENDHICYFNF----ALPRNK  487

Query  445  ----GVPQIDVTFDIDANGILNVSA  465
                G     VTF ++A+GIL V A
Sbjct  488  IGKAGEYSHPVTFTMNASGILQVQA  512

>PYIW_17320
Length=563

 Score = 262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 181/498 (36%), Positives = 276/498 (55%), Gaps = 46/498 (9%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAF---TDSERLIGDAAKNQV  63
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS V F   ++    +G AA  Q 
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPSVVRFDPQSEHAYEVGHAAIAQE  82

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEE  123
                 NT+   KRL+G+K++   V+       + +T+       + V    ++   QPEE
Sbjct  83   TQPVGNTIRSVKRLMGQKYTSKAVEVAKSFGTYTITATKQGGAAVQVVRANKTAVVQPEE  142

Query  124  ISSMVLIKMREDAGA-------------------------------IAGLNVLRIINEPT  152
            +++ +L  ++  A A                               +AG   +R++NEPT
Sbjct  143  VAACILADLKASAEAYFDDKRIDNVVITVPAYFNDSQRKATLTSASMAGFKAVRLLNEPT  202

Query  153  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            AAA+AYGL    G + V++FD GGGT DVSL+SI +G FEV    GDT+LGGED +N + 
Sbjct  203  AAAMAYGL-FVAGTKMVVVFDFGGGTLDVSLMSISDGRFEVLGIGGDTNLGGEDLNNAIT  261

Query  213  DHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  271
            DH  +   + H     T   + + +L+T  E+AK  LSS     IE+  +     F  T+
Sbjct  262  DHLIELLHKHHDVSRATLTMQDMIQLKTQAEQAKIALSSDDSTEIELRDVAGIAKFKYTL  321

Query  272  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  331
            TR +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +SDFF+GK
Sbjct  322  TRHKFEQLGEAIWKKCLRIVHSVLKEAEVEVADVDEVVMVGGSTRIPLLRTKVSDFFDGK  381

Query  332  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  391
            E   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLET  G M T+I +
Sbjct  382  ELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGRMETIIPK  440

Query  392  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR----GVP  447
            N+ +P   ++ F T+ DNQ G+ ++V+EGE  + ++N+ +  FN   + P  +    G  
Sbjct  441  NSRIPVSLTKYFQTFEDNQRGLTVEVYEGEHEVAKENDHICYFNF--VLPHDKVGKAGEF  498

Query  448  QIDVTFDIDANGILNVSA  465
               VTF ++A+G+L V A
Sbjct  499  AHPVTFTMNASGVLQVQA  516

>H310_03911
Length=570

 Score = 261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 187/516 (36%), Positives = 279/516 (54%), Gaps = 56/516 (11%)

Query  10   SVGIDLGTTYSCVGVWQNDR-----VEIIANDQGNRTTPSYVAF-TDSERLIG-DAAKNQ  62
             +GIDLGTT SCVG W+        V  +  D  ++T PS V+F       +G DA +++
Sbjct  21   CIGIDLGTTNSCVGYWKEGANFAKIVNHVGKDGKHKTVPSVVSFPPQGNPFVGFDAVEHE  80

Query  63   VAMNAHN-TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQP  121
              +     T+  AKRL+G+  ++  V  + K+  + +     D   + +    +     P
Sbjct  81   QKLEPDTVTIRSAKRLMGKTLAE--VGDEQKYLSYSLCD---DGDHVAIDLPSKKTVVAP  135

Query  122  EEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEP  151
             E+S+++L  +++                               A A+AG   +R++NEP
Sbjct  136  SEVSAILLKYIKDTTEEKLGHQVVNCVLTVPAHFNESQRQATLKAAAMAGFQGIRLLNEP  195

Query  152  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            TAAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    G+THLGGED ++ L
Sbjct  196  TAAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGKFAVDGVGGNTHLGGEDINHVL  254

Query  212  VDHFTQEFKRKH-RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  270
             D+  +  + ++    +T ++ A+ +L+ A E AK TLSS  +  I +D +         
Sbjct  255  YDYMLESIQNQNGGTPLTLDRTAIIQLQQAAEHAKVTLSSQKEVSIYLDDIGGVKSHKLK  314

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +TR++FE +C     + ++    VL    L+ + + EVVLVGGSTRIP ++  LS  FNG
Sbjct  315  LTRSKFESLCDPLLTRCIDITLNVLASIDLTPNDIDEVVLVGGSTRIPALRNKLSALFNG  374

Query  331  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  390
            KE   S+N DE VA GA +QAAILSG  +   LQD+L+LDV PLS+G+E A G M  LI 
Sbjct  375  KEMCTSMNADEVVASGAAIQAAILSG-VNKRVLQDVLMLDVIPLSIGIEKADGTMEVLIP  433

Query  391  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------  444
            +N+ +P   ++ F T  D+Q G+ ++VFEGE+ + RDN  L  FN      +PR      
Sbjct  434  KNSRIPIAVTKHFETLDDDQRGITVEVFEGEKPVARDNVFLTYFNF----TLPRHKAGKA  489

Query  445  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  480
            G  Q  VT  +DANGIL V A  +    +N++ I+N
Sbjct  490  GEFQHAVTLSMDANGILQVKAGAQHDIDDNEVAISN  525

>SDRG_01068
Length=621

 Score = 262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 192/617 (31%), Positives = 294/617 (48%), Gaps = 54/617 (9%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQ-GNRTTPSYVAFTDSERLIGDAAKNQVAMNAHN  69
            + ID+GT+   VGVW+NDRVE++A D  G    P+YVAFTD+ RL+G  AK   A +A N
Sbjct  5    IAIDIGTSNLRVGVWRNDRVELLALDSDGATALPAYVAFTDAGRLVGRRAKAYAATDAAN  64

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL  129
             VF   R +GR   D  V+AD    PFQV + + DKPQ+ V   G+  TF  EE+ + +L
Sbjct  65   VVFRMTRFLGRSMRDRGVRADCDKVPFQVVASSDDKPQVRVTLNGQPSTFDLEEVLATLL  124

Query  130  IKMRE----------------------------DAGAIAGLNVLRIINEPTAAAIAYG--  159
               +                             DA AIAGLNV +++N PTAA + Y   
Sbjct  125  EHTKAMVDEQLTVGYVTLTVPAAFTTTQRHAVLDAAAIAGLNVRKLLNAPTAALVTYMNM  184

Query  160  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  219
              +   ER VL    G G+  V++   E  +    AT+G+ HLGG D D RLV H    F
Sbjct  185  HPRMREERTVLTVTAGAGSLGVAITVDESALSTAVATSGNAHLGGLDIDERLVRHCIAAF  244

Query  220  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  279
            +R    D+  + R L+RLRTACE AK  LS++    +E+  L    D    ++R +   +
Sbjct  245  ERTIGCDVRLSPRGLQRLRTACEEAKIALSTATTTTVEVPRLSGENDLVVVVSRDQLNQL  304

Query  280  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINP  339
              +   +    V K L+ AKL K+ + ++VL GG  R+P ++  L D F+G+      NP
Sbjct  305  AREMMAQLTALVVKALQTAKLDKNNIDDIVLAGGLVRMPLLKTTLVDLFHGQRVRLVGNP  364

Query  340  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  399
            DEA+  GAT+  A    N +       +L      +             +AR  T     
Sbjct  365  DEAIVTGATLYTA----NATLRATGRDVLACQCLPTPFWVATEARHPQYLARGATDYFST  420

Query  400  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ---IDVTFDI-  455
            ++   T   NQP + + V+EG       ++L GK+    + P+P G+P+   + V F I 
Sbjct  421  TEDMFTTQANQPDITLLVYEGLLGQRDTSHLQGKWR---VGPLPNGIPRGATVQVGFQIC  477

Query  456  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
             A G L +SA    T  +  I  TN+    ++  + R++ EA   +  D   +Q I A  
Sbjct  478  HATGTLQISA----TVDDKPIPATNELAPTTRGRMCRLIQEAATRRQVD--GRQHIHAAR  531

Query  516  ALE-----NYAYSLRNSLN-DEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYES  569
            A        Y   LR + + D   + ++ E  +  +DD +   ++WL  + +     YE 
Sbjct  532  AAAKAAATEYTMRLREAWHGDAISRNRVSEVTRDELDDALALALKWLILHPNANTVEYEV  591

Query  570  KQKELEGVANPVLQKMY  586
             + +LE V + V++ +Y
Sbjct  592  VRFKLEAVGSRVVEALY  608

>SPRG_01255
Length=566

 Score = 258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 180/500 (36%), Positives = 267/500 (53%), Gaps = 54/500 (11%)

Query  10   SVGIDLGTTYSCVGVW--QNDRVEII---ANDQGNRTTPSYVAF--TDSERLIGDAAKNQ  62
             +GIDLGTT SCVG W    + V+I+   A D   +T PS V+F  T +  +   A   +
Sbjct  24   CIGIDLGTTNSCVGYWKLHANHVKIVNHSAGDTKAKTLPSVVSFPPTGAPAVGFAAVAAE  83

Query  63   VAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPE  122
             +     TV  AKRL+G+  +D     D K+  + +  G  +   +++       +  P 
Sbjct  84   ASDADVVTVRSAKRLLGQSLAD--ASPDQKYLSYTLCDG--ESGHVSIALPARKTSVTPS  139

Query  123  EISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPT  152
            E+++++L K++                               +A A+AG + +R++NEPT
Sbjct  140  EVAALLLSKLKAAAEAKLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPT  199

Query  153  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            AAA+AYGL   G +R V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N L 
Sbjct  200  AAAMAYGLFVAGTKR-VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNILF  258

Query  213  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  271
            DH  Q   +KH    +      + +L+ A E AK  LS+  +  + + ++        T+
Sbjct  259  DHVLQAIAKKHGPVSLPLATHDMVQLQRAVEAAKVALSTDDETVLRLTNVGHVALHEMTL  318

Query  272  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  331
            TR + + +C   ++K +    +VL+   +  S V EVVLVGGSTRIP ++  L  FFN K
Sbjct  319  TRRKLDALCDPLYKKCLRITREVLKSIDVDPSDVDEVVLVGGSTRIPAIRARLRAFFNDK  378

Query  332  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  391
            E   S+N DE VA GA +QAAILSG    +  QD+L+LDV P+S+G+E A G M  LI +
Sbjct  379  ELCTSVNADEVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIQK  437

Query  392  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------G  445
            N+ +P   ++ F T  D+Q G  I+VFEGE  + R+N  L  F+      +PR      G
Sbjct  438  NSRIPVSVTKYFDTAIDDQAGFTIEVFEGESPVARENTYLTYFDF----VLPRKVRGKAG  493

Query  446  VPQIDVTFDIDANGILNVSA  465
              Q  VT  ++ANG+L V A
Sbjct  494  AIQHPVTLSMNANGLLQVKA  513

>CCI45261
Length=558

 Score = 258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 177/507 (35%), Positives = 285/507 (56%), Gaps = 65/507 (13%)

Query  10   SVGIDLGTTYSCVGVWQND--RVEIIANDQGNR---TTPSYVAFTDSERLIGDAAKNQVA  64
            ++GID GTT SCVG+W  D  RV+I+ +D   +     PS V +  ++  +    +  V 
Sbjct  24   AIGIDFGTTNSCVGIWLKDQSRVKILKHDFDTKRYYLLPSVVRYDPTDVSLVSVGQEAVR  83

Query  65   MNA----HNTVFDAKRLIGRKFSD---PVVQADIKHWPFQVTSGAGDKPQITVQFKGESK  117
            + A     NT+   KRL+G+++++     +Q+   H    V++  G+     +  K +  
Sbjct  84   LEATPPCKNTIRCVKRLMGQRYTNDRISYLQSSSTHQI--VSTKRGNVGICIITEKNDES  141

Query  118  TFQPEEISSMVLIKMREDAGA-------------------------------IAGLNVLR  146
              +PE++++ +L+K++  A A                               +AG   +R
Sbjct  142  IVEPEQVAACILLKLKAKAEAYFDHKIIENVVLTVPAHFNDGQRKATIRAASMAGFRKIR  201

Query  147  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGED  206
            ++NEPTAAA+AYGL    G + VL+FD GGGT DVSL+ I+EG F+V A  GDT+LGGED
Sbjct  202  LMNEPTAAAMAYGL-FIAGHKQVLVFDFGGGTLDVSLMRIDEGKFKVVAIGGDTNLGGED  260

Query  207  FDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  266
             +  +  H    F+++    +T +Q+    ++ + E AK  LS S +A +E+      + 
Sbjct  261  INQIIYHHILCSFEKRGILKLTIDQQT--AMKQSIEEAKIQLSDSMEATVELKVATRLLQ  318

Query  267  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  326
            +N  + R  FE +C   +++ +  +EKVL+DA L    V EVV+VGGSTRIPK++  +S+
Sbjct  319  YN--LRRDVFESICDSVWKRCISTIEKVLKDASLEPCDVDEVVMVGGSTRIPKLRSSISE  376

Query  327  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  386
            FF+ KE   S+N D  V  GA +QAA+LSG    + LQD+L+LDV PLS+GLET  G M 
Sbjct  377  FFDKKELCDSVNADRVVCEGAAIQAAVLSG-MDRKTLQDVLMLDVIPLSMGLETVDGRME  435

Query  387  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGV  446
             ++++N+ +P + ++ F T+ D+Q G+ + V+EGE S+ R+N  + +F+     P+P   
Sbjct  436  IILSKNSQIPAEVTKYFQTFEDDQRGISVDVYEGENSIARENEHICRFDF----PIPS--  489

Query  447  PQID--------VTFDIDANGILNVSA  465
             +ID        VTF ++ NG+L VSA
Sbjct  490  LKIDKAGRIFHPVTFKMNENGVLQVSA  516

>PYIR_13638
Length=543

 Score = 257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 174/499 (35%), Positives = 272/499 (55%), Gaps = 68/499 (14%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAFTDSERLIGDAAKNQVAMN  66
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS          +G          
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPSV-----ETAPVG----------  67

Query  67   AHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
              NT+   KRL+G+K++    +       +++ +       + V    +  T +PEE+S+
Sbjct  68   --NTIRSIKRLMGQKYTSKAAEVAKSFGTYKIAATKQGSAAVQVVRAQKLVTVEPEEVSA  125

Query  127  MVLIKMREDA-------------------------------GAIAGLNVLRIINEPTAAA  155
             +L  ++  A                                ++AG   +R++NEPTAAA
Sbjct  126  CILSDLKASAEVYFDNKRIDNVVITVPAYFNDSQRKATITSASMAGFKAIRLMNEPTAAA  185

Query  156  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            +AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N + DH 
Sbjct  186  MAYGL-FVAGTKMVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNNVITDHL  244

Query  216  TQEFKRKHRKDITENQRALR---RLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  272
             +   + H  D+   + ++    +L+T  E+AK  LSS   A IE+  +     F  T+T
Sbjct  245  IELLHKHH--DVPRAKLSMADMIQLKTQAEQAKIALSSDDSAEIELHDVAGVPKFKYTLT  302

Query  273  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  332
            R +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +S+FF+GKE
Sbjct  303  RHKFEQLGESIWKKCLRIVSSVLKEAEVEIADVDEVVMVGGSTRIPILRTKISEFFDGKE  362

Query  333  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  392
               S+N DE V  GA +QAAILSG       +D+L++DV PL +GLET  G M  +I +N
Sbjct  363  LCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGTMEVIIPKN  421

Query  393  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GV  446
            + +P   ++ F T+ DNQ G+ ++V+EGE+ + ++N+ +  FN      +PR      G 
Sbjct  422  SRIPVSLTKYFQTFEDNQRGLTVEVYEGEQKVAKENDHICYFNF----VLPRDKIGRAGE  477

Query  447  PQIDVTFDIDANGILNVSA  465
                VTF ++A+G+L V A
Sbjct  478  FAHPVTFTMNASGVLQVQA  496

>PYAP_19903
Length=527

 Score = 244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 175/504 (35%), Positives = 275/504 (55%), Gaps = 55/504 (11%)

Query  24   VWQNDR--VEIIAN-DQGNRTTPSYVAFT--DSERLIGDAAKNQVAMNAHNTVFDAKRLI  78
            +W  +R  V+I+ N D   RTTPS V F     E ++G+AA  +      NTV   KRL+
Sbjct  1    MWHVERNHVKILKNRDDRGRTTPSVVHFKPDSQEVVVGNAAIAREYDPPGNTVRTIKRLM  60

Query  79   GRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKT-FQPEEISSMVLIKMREDAG  137
            G++F    V+   +     +         ++V+  G+     QPEE+SS VL++++  A 
Sbjct  61   GQRFDSDAVRVAKRFATHSIVETKQGNAAVSVKRSGQDAVDVQPEEVSSHVLMELKASAE  120

Query  138  A-------------------------------IAGLNVLRIINEPTAAAIAYGLDKKGGE  166
            A                               +AG   +R++NEPTAAA+AYGL    G+
Sbjct  121  AYWDDERVDNVVITVPAYFNDSQRKATILSAQMAGFKAIRLLNEPTAAAMAYGL-FLSGQ  179

Query  167  RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKH---  223
            ++V++FD GGGT DVSLLSI +G FEV    GDT+LGGED ++ +V H      ++H   
Sbjct  180  KHVVVFDFGGGTLDVSLLSINDGRFEVLGIGGDTNLGGEDINDLVVGHVVDMLHQQHGLT  239

Query  224  RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID-FNSTITRARFEDMCGD  282
            R D++ +   L +++   E+AK  LSS     IE+  +      +   +TR  FE +C  
Sbjct  240  RNDLSRSD--LIQIKRETEKAKVELSSEESIAIELKGIGKKKQAYKIKLTRPAFEKICAS  297

Query  283  YFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEA  342
             + + +  V  VL +A +  S + EV++VGGSTRIP V+  +S+FF+ KE   S+N DE 
Sbjct  298  IWSRCLVIVTDVLEEAGVHTSDIDEVIMVGGSTRIPIVRAKVSEFFDNKELCLSVNADEV  357

Query  343  VAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQT  402
            V  GA +QAAILSG       +D+L++DV PL +GLE A G M  L+ +N+ +P   ++ 
Sbjct  358  VCEGAAIQAAILSG-LDKRIFRDVLMMDVLPLPIGLEKADGEMEILLPKNSRIPVTMTKY  416

Query  403  FSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDID  456
            F T+ D+Q G+ +QV+EGE ++ ++N+ +  FN     P+PR      G  +  VTF ++
Sbjct  417  FETFEDDQRGLTVQVYEGENAVAQENDHICDFNF----PIPRDKIGKAGEFKHPVTFTMN  472

Query  457  ANGILNVSAVEKSTGKENKITITN  480
            A+G+L V+A      +E  +++T+
Sbjct  473  ASGVLQVTAGIHHDSEETPMSLTS  496

>PYVX_13615
Length=585

 Score = 245 bits (625),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 184/535 (34%), Positives = 283/535 (53%), Gaps = 81/535 (15%)

Query  3    QATTSGYSVGIDLGTTYSC---VGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDSER  53
            Q       VGIDLGTT SC   VG+W+ +R  V+I+ N  D+G RTTPS V F     + 
Sbjct  14   QFAAGARCVGIDLGTTNSCATRVGIWKTERNHVKILKNRRDRG-RTTPSVVRFGPESDQV  72

Query  54   LIG-DAAKNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQF  112
            L+G +A  +++     NTV   KRL+G+ F    V+   K   F++         I++  
Sbjct  73   LVGNEAIAHELEDPVGNTVRAVKRLMGQPFESKAVEVATKFAAFKLEPTKQGNTAISIDR  132

Query  113  KG-ESKTFQPEEISSMVLIKMREDAGAI-------------------------------A  140
             G ++ T  PE++S+ VL +++  A A                                A
Sbjct  133  SGSKTDTVLPEDVSAAVLSELKASAEAYYQDESIDHVVITVPAYFNDSQRRATLEAATSA  192

Query  141  GLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDT  200
            G + +R++NEPTAAA+AYGL    G + V++FD GGGT DVSL+ I++G FEV    GDT
Sbjct  193  GFSAVRLLNEPTAAAMAYGL-FLAGTKLVVVFDFGGGTLDVSLMQIQDGKFEVLGIGGDT  251

Query  201  HLGGEDFDNRLVDHFTQEFKRK---HRKDITENQRALRRLRTACERAKRTLSSSAQAYIE  257
            +LGGED ++ L+DH  + F +    HR+ +      + +L+   E+AK  LS+   A +E
Sbjct  252  NLGGEDINHLLLDHVLEMFDKHFGVHREQLRPED--MVKLKREVEKAKIELSTEESAVVE  309

Query  258  I-DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  316
            +  +         T+ R +FE +C   +++ +  V  VL++A+   +++ EV+LVGGSTR
Sbjct  310  LRGAAGSSKTMTVTLHRRKFELLCESIWKRCLRIVSNVLKEAEADVTEIDEVILVGGSTR  369

Query  317  IPKVQQLLSDFFNGK--------------------EPNKSINPDEAVAYGATVQAAILSG  356
            IP V+  LS+FFN K                    E   S+N DE V  GA +QAAILSG
Sbjct  370  IPVVRSRLSEFFNDKWMVCLTVRIRSTNGVSGVEQELCMSVNADEVVCEGAAIQAAILSG  429

Query  357  NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQ  416
                +  +D+L++DV PL +GLETA G M  L+ +N+ +P   ++ F T+ D Q G+ ++
Sbjct  430  -MDHKVFRDVLMMDVIPLPIGLETADGAMEVLLPKNSRIPVSLTKYFETFEDGQRGLTVE  488

Query  417  VFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDIDANGILNVSA  465
            V+EGE ++ + N+ +  FN      +PR      G  +  VTF +  +G+L V A
Sbjct  489  VYEGEHAVAKQNDHICYFNF----ALPRDKIGKAGEFRHPVTFTMTPSGVLQVQA  539

>HYAP_01857
Length=492

 Score = 242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 175/467 (37%), Positives = 250/467 (54%), Gaps = 53/467 (11%)

Query  43   PSYVAF-TDSERL-IGDAA-KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVT  99
            PS V F   S+ + +GDAA + +      NT+   KRL+G+KF    V     +  + V 
Sbjct  2    PSVVHFDPQSQHVDVGDAAVEFETEPPVGNTIRSIKRLLGQKFVSKAVDVARIYASYSVV  61

Query  100  SGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREDAGA---------------------  138
              A     + V   G+    QPEE+ + VL +++  A A                     
Sbjct  62   PTAQGNVVLQVVRGGKRVQVQPEEVVASVLAELKASAEAYFDGQLSIDNVVITVPAYFSD  121

Query  139  -----------IAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIE  187
                       +AG   +R++NEPTAAA+AYGL    G++ V +FD GGGT DVSLL IE
Sbjct  122  SQRKATLTSASMAGFKAVRLLNEPTAAAMAYGL-FLSGKKLVTVFDFGGGTLDVSLLRIE  180

Query  188  EGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERA  244
            +G FEV    GDT+LGG+D DN LVDH  +   R H  ++T  Q     + RL+   E A
Sbjct  181  DGKFEVLGIGGDTNLGGDDIDNVLVDHLIEMLDRHH--NLTRAQVGDENMVRLKREVENA  238

Query  245  KRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQ  304
            K  LS    A + +D + +      T+TR + E++CG   +K +  V  VL +AK+  S 
Sbjct  239  KIKLSEEEHAVVTVD-MANVPRITYTLTRRKLEELCGPIRKKCLRIVSSVLEEAKVESSN  297

Query  305  VHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklq  364
            V EV+LVGGSTRIP ++Q +S+ F GKE   S+N DE V  GA +QAAIL G       +
Sbjct  298  VDEVILVGGSTRIPILRQQISEAFGGKELCMSVNADEVVCEGAAIQAAILCG-VDQRVFR  356

Query  365  dlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSM  424
            D+L++DV PL +GLETA G M  ++ +N  +PT  ++ F TY DNQ G+ ++V+EGE  +
Sbjct  357  DVLMMDVLPLPIGLETADGSMEVILPKNARIPTTMTKYFQTYEDNQRGLTVEVYEGENKI  416

Query  425  TRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDIDANGILNVSA  465
             ++ + +  FN      +PR      G     VTF ++ANGIL V A
Sbjct  417  AKECDHICYFNF----VLPRDKIGKAGEFAHPVTFTMNANGILQVRA  459

>H257_01680
Length=571

 Score = 244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 180/518 (35%), Positives = 270/518 (52%), Gaps = 59/518 (11%)

Query  10   SVGIDLGTTYSCVGVWQN--DRVEII---ANDQGNRTTPSYVAF-TDSERLIG-DAAKNQ  62
             +GIDLGTT SCVG W+   +  +II   A D  ++T PS V+F +     +G DA +++
Sbjct  21   CIGIDLGTTNSCVGYWKEGANHAKIINHTATDGKHKTVPSVVSFPSQGNPFVGFDAVEHE  80

Query  63   VAMNAHN-TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQP  121
                    T+  AKRL+G+  ++  +  + K+  + +    G    + +    +     P
Sbjct  81   QKYEPDTVTIRSAKRLMGKTLAE--MADEQKYLSYTLCDADG---HVAIDLPSKESIATP  135

Query  122  EEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEP  151
             E+S+++L  +++                               A  +AG   +R++NEP
Sbjct  136  SEVSAILLKYIKDTAEDKLGHQVFNCVLTVPAYFNESQRQSTLKAATMAGFQGIRLLNEP  195

Query  152  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            TAAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    GDTHLGGED ++ L
Sbjct  196  TAAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGTFAVDGVGGDTHLGGEDINHLL  254

Query  212  VDHF----TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  267
            VD      +QE        +   + A+ +L+ A E AK TLS+     I +  +      
Sbjct  255  VDFMLDSISQEQNGGKPLPLPLTRTAIIQLQQAAEHAKVTLSTQKDVSIYLKDVGGIKAH  314

Query  268  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  327
               ++RA+ E +C     + ++    VL    L+   + EVVLVGGSTRIP ++  LSD 
Sbjct  315  KMKLSRAKLESLCAPLLTRCVDITRDVLASIGLTPQDIDEVVLVGGSTRIPALRTKLSDL  374

Query  328  FNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  387
            F+GK    S+N DE VA GA +QAAILSG       QD+L++DV PLS+G+E A G M  
Sbjct  375  FDGKVLCTSVNADEVVASGAAIQAAILSG-VDKRVFQDVLMMDVIPLSIGIEMADGRMEV  433

Query  388  LIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR---  444
            LI +N+ +P   +++F TY D+Q G+ ++VFEG+  + RDN  L  FN      +PR   
Sbjct  434  LIPKNSRIPISVTKSFDTYEDHQKGITVEVFEGDHPVARDNVYLTYFNF----TLPRHKL  489

Query  445  ---GVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  479
               G  Q  VT  ++ NG+L V A  +    EN+  ++
Sbjct  490  GKAGEFQHAVTLSMNENGVLQVKAGAQHEIDENEAAVS  527

>CCA22305
Length=561

 Score = 243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 176/510 (35%), Positives = 284/510 (56%), Gaps = 68/510 (13%)

Query  10   SVGIDLGTTYSCVGVWQND--RVEIIAN---DQGNRTTPSYVAFTD---SERLIG-DAAK  60
            ++GID GTT SCVGVW  D  RV+I  +    + +   PS V +     S  L+G +A +
Sbjct  24   AIGIDFGTTNSCVGVWLKDQNRVKIFKHGIETKWSHLLPSVVRYDPVDISLVLVGKEAIE  83

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGES----  116
             +      NT+   KRL+G+K+ +  +        +++ S    +    +Q  G+     
Sbjct  84   LESKPPCKNTIRCVKRLMGQKYVNDRIAYLQSSSIYEIVST--QRGNAAIQIDGDHGDDK  141

Query  117  -KTFQPEEISSMVLIKMREDAGA-------------------------------IAGLNV  144
              + +PEE+++ +LIK++  A A                               +AG   
Sbjct  142  RTSVEPEEVAAHILIKLKARAEAYFDHKAIENVVLTVPAHFNDGQRKATIRAASMAGFKK  201

Query  145  LRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGG  204
            +R++NEPTAAA+AYGL    G++ VL+FD GGGT DVSL+ I EG F V A  GDT+LGG
Sbjct  202  IRLLNEPTAAAMAYGL-FIAGKKQVLVFDFGGGTLDVSLMQIHEGRFRVVAIGGDTNLGG  260

Query  205  EDFDNRLVDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  263
            ED +  ++DH  Q F+ K     +T +Q+A   ++ + E+AK  LS++ +A I+ +    
Sbjct  261  EDINQMIIDHILQSFEEKEGILQLTIDQKA--AMKQSIEQAKIQLSNAMEAVIKFEHKTT  318

Query  264  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
               +   ++R  FE +C   + + +  ++ VL+DA +    V EVV+VGGSTRIPK++  
Sbjct  319  WRQY--ALSRDVFESICDSVWTRCISTIQGVLQDASVDPCDVDEVVMVGGSTRIPKLRSK  376

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  383
            +S+ F+ K   +S+N D+ V  GA +QAA+LSG    + LQD+L+LDV PLS+GLETA G
Sbjct  377  ISEVFDNKALCESVNADQVVCEGAAIQAAVLSG-MDRKVLQDVLMLDVIPLSMGLETADG  435

Query  384  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  443
             M  ++ +N+ +P + ++ F T+ D+Q G+ + V+EGE  + R+N  + +F+     P+P
Sbjct  436  RMEVILPKNSQIPAQVTKYFQTFEDDQRGISVDVYEGEHPIARENEHICRFDF----PIP  491

Query  444  RGVPQID--------VTFDIDANGILNVSA  465
                +ID        VTF ++ NG+L+V+A
Sbjct  492  TS--KIDTAGRIFHPVTFRMNENGVLHVTA  519

>HYAP_06818
Length=316

 Score = 235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 171/250 (68%), Gaps = 9/250 (4%)

Query  288  MEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            M P +K ++DA L KS+++EV+LVGG +R+PKVQ  +  FF GK+P+K +NPDE VA GA
Sbjct  1    MGPCKKCVKDAGLEKSEINEVILVGGMSRMPKVQTTVEAFF-GKKPSKGVNPDEVVAMGA  59

Query  348  TVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYA  407
             +Q  +L G+     L D+  L +       ET GGV T LI RNTT+PTKKSQ FST A
Sbjct  60   AIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAA  114

Query  408  DNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVE  467
            D+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI+NV A +
Sbjct  115  DSQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARD  174

Query  468  KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNS  527
            K+TGKE  I I +  G LS A+I++MV++AE     D+  K+ IEAKN  ++  Y+   +
Sbjct  175  KATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAVADQQRKELIEAKNEADSVLYTTEKT  233

Query  528  LNDEKMKEKI  537
            L  E+ KEKI
Sbjct  234  L--EEHKEKI  241

>SPRG_00182
Length=615

 Score = 243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 186/614 (30%), Positives = 291/614 (47%), Gaps = 58/614 (9%)

Query  13   IDLGTTYSCVGVWQNDRVEIIAND-QGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            +D+GT+   VGV +N+RVE++A D  G    P+YVAFTDS RL G  AK   A    N +
Sbjct  7    LDIGTSSLRVGVKRNNRVELLALDGDGATAMPAYVAFTDSGRLFGRRAKAYAASAPENVI  66

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVL--  129
            F   R +G    D  V+AD    PF+V + + DKPQ+ V   G+  TF  EE+ +M+L  
Sbjct  67   FRMLRFLGGSMRDLNVRADCDKVPFRVVASSDDKPQVRVTVNGQPSTFDLEEVMAMLLEH  126

Query  130  --------IKMRE------------------DAGAIAGLNVLRIINEPTAAAIAYGL---  160
                    + +R                   DA AIAGL V +++N PTAA +AY     
Sbjct  127  TKAMVDEQLAVRHVTLTVPASFTTTQRRAVLDAAAIAGLTVRKLLNAPTAALVAYMATHP  186

Query  161  DKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFK  220
             +   +R V+    G G+  V++      +    AT G+ HLGG + D RLV H    F+
Sbjct  187  SRMHQDRTVVTVTAGAGSLGVAITIDSNDVSTAVATTGNAHLGGIEIDERLVRHCIAAFE  246

Query  221  RKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMC  280
            R   +D+  + R L+RLRTACE AK  LS++    IE+  L    D    ++R +   + 
Sbjct  247  RTIGRDVHLSPRGLQRLRTACEDAKIALSTATTTTIEVPRLSGENDLVVCVSRDQLNALA  306

Query  281  GDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPD  340
             D   +    V + LR AK+ K+ V  +VL GG  R+P +Q  L D F+G+      NP 
Sbjct  307  RDVMTQLTALVVEALRMAKMEKANVDAIVLAGGLGRMPLLQTTLVDLFHGQRVRLIGNPS  366

Query  341  EAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKS  400
            EA+  GAT+      G+  + +         T                + R +T     +
Sbjct  367  EAIVTGATLYTP--DGDVLALQSLPTPFWVATEARHPE---------YLLRGSTEYFSTT  415

Query  401  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ---IDVTFDI-D  456
            + F T  + Q  + + V+EG       ++L GK+    + P+P+ +P+   + V+F I D
Sbjct  416  EDFYTTQNKQSDITLLVYEGLVGQRETSHLQGKWR---VGPLPKSIPRGASVQVSFQILD  472

Query  457  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSED---EANKQRIEA  513
            A G L+VSA     GKE  I   N+    ++  + R++ EA   +  D     N  R  A
Sbjct  473  ATGTLDVSATVD--GKE--IPTANELAPTTRGRMRRLIEEAATRRRVDGGQVVNAARAAA  528

Query  514  KNALENYAYSLRNSLN-DEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQK  572
            K A   Y   LR + + D   + ++ EA +  +DD +   ++WL  N +     Y + + 
Sbjct  529  KAATTEYTMRLREAWHGDAVSRNRVSEATRDELDDALAVALKWLILNPNATIVEYNAVRF  588

Query  573  ELEGVANPVLQKMY  586
            +LE V + V++ ++
Sbjct  589  QLEAVGSRVIEGLW  602

>SPRG_10476
Length=270

 Score = 231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 186/276 (67%), Gaps = 10/276 (4%)

Query  300  LSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNds  359
            +  +++ E+VLVGGSTRIPKVQ +LS  F GKE +KSINPDEAVAYGA VQ AILSG   
Sbjct  1    MKPNEITELVLVGGSTRIPKVQNMLSAVFGGKELSKSINPDEAVAYGAAVQGAILSG-IR  59

Query  360  seklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  419
            ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P KK++ ++T +D Q  V + ++E
Sbjct  60   NDATNSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIPVKKTRVYTTESDYQTQVNVVIYE  119

Query  420  GERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  479
            GER+    NN LG+F + GI    RG PQ++VTF+IDANGILNVSA +K T  + + TI+
Sbjct  120  GERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDANGILNVSARDKKTNAKAETTIS  179

Query  480  NDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPE  539
            N+ GRLSQADIDRMV EAEK+K ED    ++IEA+N+LE + Y         +  E   E
Sbjct  180  NNHGRLSQADIDRMVEEAEKFKKEDAEALKKIEARNSLEGFIY---------RALELTRE  230

Query  540  ADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELE  575
                A ++ + E  +WL+ ++       E K++ LE
Sbjct  231  KGDAAAENTIREAREWLEDHEDATLRELEEKKRVLE  266

>SDRG_16621
Length=531

 Score = 239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 171/493 (35%), Positives = 261/493 (53%), Gaps = 74/493 (15%)

Query  26   QNDRVEIIANDQGN---RTTPSYVAFTDSERLIGDAAKNQVAMNAHN------TVFDAKR  76
              + V+I+ +  G+   +T PS V+F  +    G  A   VA+ A        TV  AKR
Sbjct  1    HANHVKIVNHSTGDAKAKTLPSVVSFPST----GAPAVGFVAVAAEASDADVVTVRSAKR  56

Query  77   LIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMRE--  134
            L+G+  +D +   D K+  +++  G  +   +++       +  P E+++++L ++++  
Sbjct  57   LLGQSLADAL--PDQKYLSYKLCEG--ESGHVSIALPARKTSVTPSEVAALLLSELKKAA  112

Query  135  ----------------------------DAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  166
                                        +A A+AG + +R++NEPTAAA+AYGL   G +
Sbjct  113  EAKLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPTAAAMAYGLFVAGTK  172

Query  167  RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKH---  223
            R V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N + DH  Q   +KH   
Sbjct  173  R-VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNIVFDHVLQSIAKKHGPL  231

Query  224  -----RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  278
                   D+ + QRA+       E AK  LS+  +  + + ++        T+TR + + 
Sbjct  232  ALPLATPDMVQLQRAV-------EAAKIALSTDDETVLRLTNVGHVALHEMTLTRRKLDA  284

Query  279  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  338
            +C   F+K +    +VL+   +  S V+EVVLVGGSTRIP ++  L  FFN KE   S+N
Sbjct  285  LCDPLFKKCLRITREVLKAIDVDPSDVNEVVLVGGSTRIPAIRARLRAFFNDKELCTSVN  344

Query  339  PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  398
             DE VA GA +QAAILSG    +  QD+L+LDV P+S+G+E A G M  LI +N+ +P  
Sbjct  345  ADEVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIPKNSRIPVS  403

Query  399  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVT  452
             ++ F T  D+Q G  I+VFEGE  + R+N  L  F+      +PR      G  Q  VT
Sbjct  404  VTKYFDTAVDDQAGFTIEVFEGESPVARENTYLTYFDF----VLPRKTRGKAGSIQHPVT  459

Query  453  FDIDANGILNVSA  465
              ++ANG+L V A
Sbjct  460  LSMNANGLLQVKA  472

>SPRG_00183
Length=609

 Score = 235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 174/610 (29%), Positives = 290/610 (48%), Gaps = 50/610 (8%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAH  68
            + + ID+G +   VGVW+N R  ++A D  N   P+ VAFTD+  L G+ AK     +  
Sbjct  6    HCIAIDIGASTIRVGVWRNGRATVLALDGAN-GLPAVVAFTDTTTLFGNQAKAIAQNDPT  64

Query  69   NTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
            N VF+   L+GR+ +DP VQA +   PF++ + +   P I VQ +  + T+ P+EI  M+
Sbjct  65   NVVFNVLHLLGRRMNDPTVQAMVTSAPFRIIASSDKTPLIHVQHRRSACTYYPQEIVGML  124

Query  129  LIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAY  158
            L   ++                              DA  +AGL V R+++  TA  IA+
Sbjct  125  LEHAKKLAEDHLGACLDHAVVTVPATYTTSQRQAVLDAATMAGLTVDRLLSATTAVGIAH  184

Query  159  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
                   +R +L+ D G  +   S+++ E   F   A+A DT LGG   D RL  H    
Sbjct  185  TQATGASKRKLLVVDAGASSVTASVVTAEHDTFTAHASASDTQLGGFAMDARLAAHCMST  244

Query  219  FKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLF-DGIDFNSTITRARF  276
            +    R  D+     A +RL +ACE A+  LS+S +  + I     DG+    T++R + 
Sbjct  245  WTPSTRGHDLI---LAKQRLLSACEAARCALSTSDETDVCIPHRSQDGMRL--TLSREKL  299

Query  277  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  336
              +      K +  V KVL+ A+  K  V ++VLVGG   +P +Q  LS+ F GK+    
Sbjct  300  NALVHHLMDKVVAHVLKVLQQAQCCKEDVDDIVLVGGVALMPCLQTTLSNLFGGKQVAWF  359

Query  337  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  396
              P EAV  GA +   I S   SS+       +     +     A G   T + R+  + 
Sbjct  360  PTPSEAVVAGAALY--IASTTASSDATVRPFAIHDALSTPIWAAAAGHHWTTVFRSPALS  417

Query  397  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  456
            +  + TF +   + P VL+ V+EG+      ++L G+++++ +P        IDV F +D
Sbjct  418  SMATHTFVSTG-SSPFVLL-VYEGDVGFPASSHLQGQWHIESLP----HTRFIDVAFVVD  471

Query  457  -ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
               G+L V+A +KS+ K   + +TN     S+ ++  + ++A               AK 
Sbjct  472  ECTGVLRVTASDKSSQK--ALPVTNTDCATSRRELQHLCAQATARYHTTRQTVLLARAKA  529

Query  516  ALENYAYSLRNSLN-DEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574
            A  ++ YSLR++ + DE  + ++ +A +  +DD +   I+WL  +     D Y+  + +L
Sbjct  530  AANDFTYSLRSTWHSDEASRRRVGDAARDELDDALAAAIKWLLLHPQATIDQYDDVRVQL  589

Query  575  EGVANPVLQK  584
            E V+  VL +
Sbjct  590  EAVSRRVLAR  599

>PHYSO_249932
Length=232

 Score = 218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 144/199 (72%), Gaps = 13/199 (7%)

Query  134  EDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  193
            ++AGA+AGLNV+R I   TAA+I YG +K G  R +L+FD+GG   D+SL++I++ I+EV
Sbjct  15   KNAGALAGLNVVRSIAGSTAASIGYGFEKTG-LRAILVFDMGGSALDLSLVTIDDDIYEV  73

Query  194  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQ  253
             AT G  HLGG              FKR H KD+  N RA+ RLR+ACE+AKR +S+S +
Sbjct  74   LATLGVPHLGGV------------PFKRTHGKDLRTNSRAMVRLRSACEQAKRAVSTSTE  121

Query  254  AYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  313
            A IE++SL++GID NSTI+R RF D+C D F K +  V KVLRDAK SK++V E+VLVGG
Sbjct  122  AQIELESLYEGIDLNSTISRPRFNDLCADLFDKALGAVSKVLRDAKKSKTRVDEIVLVGG  181

Query  314  STRIPKVQQLLSDFFNGKE  332
            S RIP++QQLL DFFNGK+
Sbjct  182  SPRIPRMQQLLEDFFNGKK  200

>PYAP_18643
Length=804

 Score = 231 bits (589),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 180/678 (27%), Positives = 302/678 (45%), Gaps = 114/678 (17%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNVDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    ++          + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAYKCVELPNGDVGVVLNYNDEPVTFTCEQVVAMILN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAG+N LR++NE TA A+AYG
Sbjct  124  KMQAIAAAANEGVRPAYAVMSCPGFYTDVQRRALLNATKIAGMNCLRLLNEHTAIALAYG  183

Query  160  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K       +   ++V+  D+G  ++ VS+++  +G  +VKA   D  LGG DFD  L 
Sbjct  184  IYKSARNLFHESEPQHVMFIDMGHASYTVSIVAFVQGKLQVKAATFDRFLGGRDFDYALA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
                ++F+ KH+ +   + +A  +L  ACE+AK+ LS       Y+ I+ L D  D++  
Sbjct  244  VDVAKQFEEKHKINALNDAKARIKLLAACEKAKKNLSPHGVNATYVNIECLADEKDYSGQ  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN-  329
            +T   FE++      +  +P+++ L+DA + KSQ+  V +VGG+TR+  V++ LSD    
Sbjct  304  VTLEHFEELIAPLLNRLEDPIQRALKDAGIDKSQLASVEIVGGATRVSSVKRRLSDILGL  363

Query  330  GKEP-----NKSINPDEAVAYGATVQAAILS------------------------GNdss  360
             KE      + ++N DE+VA G  +Q AILS                        GN   
Sbjct  364  DKEAQNYGLSTTLNADESVARGCALQCAILSPVFKVKEFHIADKVHLPVRVTWEDGN---  420

Query  361  eklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG  420
                 +   D     + +E AG     +  R    P  K  TF    D    +     E 
Sbjct  421  -ASAPMDTADDNDEDVNMEAAGDSTIVIFDRKDDYPKTKRITFRR--DAAFSIDAAYDET  477

Query  421  ERSMTRDNNLL--GKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------  467
             +     + +L  GK+ + G+P   +G  VP+I V    D NGI +V++ +         
Sbjct  478  AQPYLPPDYVLNLGKYTISGLPAGEKGAEVPKIRVNVSQDINGIFSVASSQLMQEIKEEE  537

Query  468  ----------------------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  505
                                  K   ++ ++ +  +   LS  +I     +      +D 
Sbjct  538  KPAEEAKEGEAKEAEEKPAEPKKKRFRKVELKVEANVPGLSPTEITSATEQELAMAHQDR  597

Query  506  ANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--  563
              ++    +N LE++ Y +R  + D ++ E I   +K A++DK+ EV  WL +++  +  
Sbjct  598  VIEETFNKRNELESFVYDMRAQVTD-RLAEYISSDEKNALEDKLNEVEDWLYSDEGFDST  656

Query  564  KDAYESKQKELEGVANPV  581
            K  Y+SK  E+  + +PV
Sbjct  657  KSVYQSKLDEMRKITSPV  674

>PYVX_13288
Length=810

 Score = 230 bits (587),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 181/679 (27%), Positives = 303/679 (45%), Gaps = 114/679 (17%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAISVARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    +     A     I +Q+  E  TF  E+I +MVL 
Sbjct  64   ATDIKRLIGRKFKHPEVQREIAQLAYPCVELANGDVGIVLQYNDEPVTFSCEQIVAMVLN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYAVLSCPGFYTDVQRRAVLNASKIAGVNCLRLLNEHTAVALAYG  183

Query  160  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            + K    RN         V+  D+G  ++ VS+++  +G  +VKA A D  LGG DFD  
Sbjct  184  IYKSA--RNLFHESEPQYVMFIDIGHASYTVSIIAFVQGKLQVKAAAYDRFLGGRDFDMA  241

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  268
            +      +F  K++ D   N ++  +L +ACE++K+ LS       ++ I+ L D  D++
Sbjct  242  IAKDAAAQFSAKYKTDPLANPKSRIKLLSACEKSKKNLSPYGVTATHLNIECLADDRDYS  301

Query  269  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  328
            + IT  +FE+M      +   P+E  L+DA + KSQ+  V ++GG TR+  V++ LS+  
Sbjct  302  AQITLEQFEEMIAPLLARLDAPIESALKDAGIDKSQLANVEIIGGGTRVASVKRHLSEVL  361

Query  329  N-GKEP-----NKSINPDEAVAYGATVQAAILSGNdsse------------------klq  364
               KE      + ++N DE+VA G  +Q AILS     +                     
Sbjct  362  GLDKEAQNYGLSTTLNADESVARGCALQCAILSPMFKVKEFSITDAVHLPIRVSWDGAAS  421

Query  365  dlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSM  424
                       + +E +      +  R    P  K  TF     +Q   +  V++   + 
Sbjct  422  APTDAAENDEDVNMEASSDSSIVIFHRKDEYPKTKRITFRR---DQSFAIDAVYDESATP  478

Query  425  TRDNNLL---GKFNLDGIPPMPRG--VPQIDVTFDIDANGILNV----------------  463
                + L   GKF + G+P + +   +P+I V    D NG+ +V                
Sbjct  479  YLPPDYLMSIGKFTVSGLPSLAKDAELPKIRVNVTQDINGLFSVASSQLMQEVKEEEKPA  538

Query  464  -------------SAVEKSTGKENK------ITITNDKGRLSQADIDRMVSEAEKYKSED  504
                         +A +KS   + K      + +T + G L+ +D+     +  K   +D
Sbjct  539  EEEAKEGAEGDAKAAEDKSEQPKKKRFRKIELQVTAEVGGLTTSDVAAATEQELKMAQQD  598

Query  505  EANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE-  563
               ++    +N LE++ Y +RN ++D ++   I  ++K  +++K+ E   WL  ++  + 
Sbjct  599  RVIEETFNKRNELESFVYEMRNHVSD-RLANFITSSEKATLEEKLLEAEDWLYTDEGFDS  657

Query  564  -KDAYESKQKELEGVANPV  581
             K  Y++K  +L  ++NPV
Sbjct  658  TKSVYQTKLDDLRKLSNPV  676

>PHYSO_525236
Length=246

 Score = 210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 141/227 (62%), Gaps = 34/227 (15%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M   TT G S+GID+GT YS V +W  DR EI+ N  GNR T SYVAFTDS+ L+GDAA 
Sbjct  1    MANKTTGGPSIGIDIGTAYSRVAIWHKDRAEILPNRFGNRLTSSYVAFTDSKVLVGDAAA  60

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGD----KPQITVQFKGES  116
            +Q   NA NTVF   RL+GRKFSDP VQ  IKHWPF+V  G  D     P + VQF+G++
Sbjct  61   DQRLQNAENTVFGITRLLGRKFSDPEVQERIKHWPFKVIRGPHDTPPPPPHVMVQFRGQT  120

Query  117  KTFQPEEISSMVLIKMR------------------------------EDAGAIAGLNVLR  146
            K F P +I S++L +MR                              +DAGAIA + V+R
Sbjct  121  KIFHPVQILSLLLSEMRGIVETYTGKEATTAVVTVPAHFNYSQRQAVKDAGAIAEIQVMR  180

Query  147  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  193
            +I+  TAA+I+YG++KKG ER VL+ DLG  T DVS++ IE+G FEV
Sbjct  181  MISRSTAASISYGINKKGSERRVLVVDLGASTLDVSVVEIEDGNFEV  227

>PHALS_04095
Length=803

 Score = 222 bits (566),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 176/674 (26%), Positives = 298/674 (44%), Gaps = 107/674 (16%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    +     A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDLKRLIGRKFKHPEVQKEIAQLAYTCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIASAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  160  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
                 +F  K++ D   N ++  +L +ACE+AK+ LS        + I+ L D  D+N+ 
Sbjct  244  KDVAAKFAEKYKTDPLGNPKSRIKLLSACEKAKKNLSPYGVTATNLNIECLADDRDYNAQ  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +T   FE++      +  +PVE+ L DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  LTLEEFEELIAPLLLRLNDPVERALADAGIDKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  331  KEPNK------SINPDEAVAYGATVQAAILSGNdsseklqdlll-----------ldvtp  373
             +  +      ++N DE+VA G  +  AILS     ++                      
Sbjct  364  DKEQQNFGLSTTLNADESVARGCALNCAILSPMFKVKEFSVTDCVHLPVRVSWDGSAAAG  423

Query  374  lslglETAGGV-MTT------LIARNTTVPTKKSQTFSTYADNQPGVLIQVFE--GERSM  424
                 E  G V M T      + +R    P  K  TF     ++P  +  +++   +  +
Sbjct  424  TPSAAEEDGDVNMETEDSSLVIFSRKDEYPKTKRITFRR---DKPFSIDAMYDESAKSYL  480

Query  425  TRDNNL-LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE--------------  467
              D ++ +GK+ + G+P    G  +P+I V    D NG+ +VS+ +              
Sbjct  481  PPDYDMDIGKYTISGMPSQEAGTEIPKIRVNVQQDMNGLFSVSSSQLMQEILEEEKPAVA  540

Query  468  ------------------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQ  509
                              K   ++ ++++      LS  D+     +  K   +D   ++
Sbjct  541  DGAEVEGEKKDDKPVEPKKKRFRKVELSVHAAVSGLSAGDVAAATEQELKMAQQDRVIEE  600

Query  510  RIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAY  567
                +N LE++ Y +RN + D K+   I   +K  ++ K+TE   WL  ++  +  K  Y
Sbjct  601  TFNKRNELESFVYEMRNQITD-KLAGFITSGEKSNLESKLTETEDWLYTDEGFDSTKSVY  659

Query  568  ESKQKELEGVANPV  581
            + K  ++  +++PV
Sbjct  660  QQKLDDMRKLSSPV  673

>CCA15913
Length=857

 Score = 221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 178/693 (26%), Positives = 307/693 (44%), Gaps = 135/693 (19%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  43   IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  102

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQA+I    F+    A     I +++     TF  E+I +M+L 
Sbjct  103  ATDIKRLIGRKFKHPEVQAEIAQLSFKCDEMANGDVGIVLKYNDADVTFSCEQIIAMILN  162

Query  131  KMR-------------------------------EDAGAIAGLNVLRIINEPTAAAIAYG  159
            KM+                                ++  IAGLN LR+INE TA A+AYG
Sbjct  163  KMQIIATSANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  222

Query  160  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            + K    RN         V+  D+G  ++ V+++S   G  +V++ A D  LGG DFD  
Sbjct  223  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVSFVLGKLQVRSVAFDRFLGGRDFDYA  280

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  268
            L     + F+ KH+ D  +  ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  281  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  340

Query  269  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  328
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+  V++ L+D  
Sbjct  341  SQITLEHFEELIAPLLDRLEAPITQALNDAGIEKSQLSNVEVVGGGTRVASVKRRLADIL  400

Query  329  NGKEP------NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAG  382
            +  +       + ++N DE+VA G  +Q AILS      K   +      P+ +  ET+ 
Sbjct  401  SLDKSAQNYGLSTTLNADESVARGCALQCAILSP-LFKVKEFSIADRVYYPVRVSWETSA  459

Query  383  GVMTTLIARNTTVPTK---------------KSQTFSTYADNQPGVLIQVFEGERSMTRD  427
             V         +VP +                S    T+AD  P      F  E S + D
Sbjct  460  DV---------SVPMETGDDNEDGDLGNDGANSIVIFTHADEYPKTKRITFRREDSFSVD  510

Query  428  NNL---------------LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---  467
                              +GKF + G+P + +G  +P+I V    D NG++ +S+ +   
Sbjct  511  AKYDESAKALLPPDYDLGIGKFTISGLPEIEKGGEIPKIRVNIQHDLNGLVGISSSQLMQ  570

Query  468  -------------------------------------KSTGKENKITITNDKGRLSQADI  490
                                                 K   ++ ++ I  +   L+ +++
Sbjct  571  ELKEEKPADEAKETQENEENKEKKEGGKADEKAPEPKKKRFRKVELKIEAETKGLNVSEV  630

Query  491  DRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVT  550
            ++      +   +D   ++    +N LE++ Y +RN ++D ++++ I E +K  ++  + 
Sbjct  631  NKATEIELEMAHQDRVIEETCNKRNELESFVYEMRNQISD-RLRDFITEEEKSKLESSLA  689

Query  551  EVIQWLDANQSLE--KDAYESKQKELEGVANPV  581
            EV +WL  ++  +  K  Y++K   L  ++ P+
Sbjct  690  EVEEWLYTDEGFDSVKSVYQTKLDGLRKLSAPI  722

>PYAR_15468
Length=769

 Score = 219 bits (558),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 174/656 (27%), Positives = 297/656 (45%), Gaps = 104/656 (16%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G T   +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNTDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    F           + +++  E+ TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAFPCVELPNGDVGVVLRYNDEAVTFTCEQVVAMILN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVRPAYAVLSCPGFYTDVQRRALLNAAKIAGVNCLRLLNEHTAVALAYG  183

Query  160  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K       +   ++V+  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  L 
Sbjct  184  IYKSARNLFAESEPQHVMFIDMGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYALA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
            +    +F+ K++ +  ++ +A  +L + CE+AK+ LS       ++ ++SL +  D++  
Sbjct  244  EDVAAQFEAKYKVNPLKDAKARIKLLSGCEKAKKNLSPHGVTATFLNVESLAEDRDYSGQ  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +T  RFE++      +   P+++ L DA + K+Q+  V +VGG+TR+     +LS  F  
Sbjct  304  VTLERFEELIAPLLNRLEGPIQRALADAGIDKAQLASVEIVGGATRVSSC-AILSPVFKV  362

Query  331  KE---PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  387
            KE    +K+  P        +      +G+                  + +E AG   T 
Sbjct  363  KEFHIADKTHFPVRVSWENGSANTTDAAGD-------------NDEEDVNMEAAGSDSTL  409

Query  388  LIA-RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERS---MTRDNNL-LGKFNLDGIPPM  442
            +I  R    P  K  TF   A       I     E +   +  D +L LGK+ + GIP  
Sbjct  410  VIFDRKDEYPKTKRITFRRDA----AFAIDAAYDETATPFLPADYSLALGKYTISGIPKT  465

Query  443  PRGVPQIDVTFDIDANGILNVSAVE----------------------KSTGKENK-----  475
               +P+I V    D NGI +V++ +                      K    E+K     
Sbjct  466  GDEIPKIRVNVQQDLNGIFSVASSQLMQEIKEEEKSAEEAKEGADEAKDKAAEDKPAEPK  525

Query  476  --------ITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNS  527
                    + +  D   LS  +I     +      +D   ++    +N LE++ Y +RN 
Sbjct  526  KKRFRKVELKVDADVPGLSPQEISSATEQELAMAHQDRVIEETFNKRNELESFVYDMRNH  585

Query  528  LNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAYESKQKELEGVANPV  581
            +  E++ E I E++K +++DK+TE   WL +++  +  K  Y+ K  EL  +++PV
Sbjct  586  IT-ERLAEYISESEKASLEDKLTEAEDWLYSDEGFDSTKSVYQGKLDELRKLSSPV  640

>CCI46709
Length=819

 Score = 217 bits (552),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 175/693 (25%), Positives = 305/693 (44%), Gaps = 135/693 (19%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQA+I    F+    A     I +++     TF  E+I +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQAEIAQLSFRCEEMANGDVGIVLKYNDADVTFSCEQIIAMILN  123

Query  131  KMR-------------------------------EDAGAIAGLNVLRIINEPTAAAIAYG  159
            KM+                                ++  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQIIATTANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  183

Query  160  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            + K    RN         V+  D+G  ++ V++++   G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVAFVLGKLQVKSVAFDRFLGGRDFDYA  241

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  268
            L     + F+ KH+ D  +  ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  242  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  301

Query  269  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  328
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+  V++ L+D  
Sbjct  302  SQITLDHFEELIAPLLDRLEAPINQALNDAGIIKSQLSNVEIVGGGTRVASVKRRLADIL  361

Query  329  NGKEP------NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAG  382
            +          + ++N DE+VA G  +Q AILS      K   +      P+ +  ET+ 
Sbjct  362  SLDNSAQNYGLSTTLNADESVARGCALQCAILSP-LFKVKEFSIADRVYFPVRVSWETSA  420

Query  383  GVMTTLIARNTTVPTK---------------KSQTFSTYADNQPGVLIQVFEGERSMTRD  427
             +         +VP +                S    T+AD  P      F  + S + D
Sbjct  421  DI---------SVPMETGDDNEDGDLGNDGANSIVIFTHADEYPKTKRITFRRDNSFSID  471

Query  428  NNL---------------LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---  467
                              +GKF + G P + +G  +P+I V    D NG++ +++ +   
Sbjct  472  AKYDESAKALLPPDYDLAIGKFTVSGFPELEKGGEIPKIRVNIQHDLNGLVGIASSQLMQ  531

Query  468  -------------------------------------KSTGKENKITITNDKGRLSQADI  490
                                                 K   ++ ++ I ++   L+ A++
Sbjct  532  ELKEEKPVEEPKEAQESDEKKEKKEGEQAEEKASEPKKKRFRKVELKIESEIKGLNVAEV  591

Query  491  DRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVT  550
            ++      +   +D   ++    +N LE++ Y +RN ++D ++++ I E +K  ++  + 
Sbjct  592  NKATETELEMAHQDRIIEETCNKRNELESFVYEMRNQISD-RLRDFITEEEKAKLESSLA  650

Query  551  EVIQWLDANQSLE--KDAYESKQKELEGVANPV  581
            E  +WL  ++  +  K  Y++K   L  ++ P+
Sbjct  651  EAEEWLYTDEGFDSVKSVYQTKLDGLRKLSAPI  683

>SDRG_01067
Length=611

 Score = 213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 171/615 (28%), Positives = 290/615 (47%), Gaps = 62/615 (10%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAH  68
            + V ID+GT+   VGVW+N RV ++A D G  + P+ VAFTD+  L G  AK     +  
Sbjct  6    HCVAIDIGTSRVRVGVWRNGRVHVLALD-GAESLPAVVAFTDTLTLFGHQAKAYAQDHPT  64

Query  69   NTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
            N V +A +L+GR+ +DP+VQA +   PF++ + +   P I VQ +  + T+ P+EI +M+
Sbjct  65   NVVSNALQLLGRRMNDPIVQAAVAGAPFRIRASSDKTPLICVQHQRSACTYYPQEIIAML  124

Query  129  LIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAY  158
            L  +R                               DA  +AG  V R+++  TAAAIA 
Sbjct  125  LEHVRTSAECHLGSCLDHAVVTVPATYTTSQRQAIVDAATMAGWTVDRLLSATTAAAIAQ  184

Query  159  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  218
                   +R +L+ D G      S+++ E   F   A+A D H+ G   D RL  +    
Sbjct  185  VHATGADKRRLLVVDAGASAVTASVVTAEYDTFTAHASASDMHVSGSAMDARLAAYCMSS  244

Query  219  FKRKHRKDITENQRAL-----RRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  273
            +    R  I  N  A      +RL +ACE A+  LS++ +  + I  L+   D   +++R
Sbjct  245  W----RPSIIGNDFAFSASTKQRLLSACEAARCALSTTNETQLCIPRLYRDEDVALSLSR  300

Query  274  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  333
             + + +      K +  V KVL+ AK  K  V ++VLVGG   +P +Q  LS+ F GK  
Sbjct  301  EKLDALVDHLMDKVVVLVRKVLQQAKCVKDDVEDIVLVGGVASMPYLQSTLSNVFCGKTV  360

Query  334  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  393
                 P  AV  GA +  A  + +  S      +   +         AG    T+     
Sbjct  361  ACLATP--AVVAGAALYVASTTASSDSVVRPIAIHDALLTPIWAA-AAGHHWRTVF----  413

Query  394  TVPTKKSQTFSTYADNQPG-VLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  452
             VP        T+  N  G  ++ ++EG+   +  ++L G+++++ +    R    IDV 
Sbjct  414  NVPVLSGTATHTFQSNGSGPFVLLMYEGDVGFSDSSHLQGRWHIETL----RSTRFIDVA  469

Query  453  FDID-ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRI  511
            F ID   G+L V+A +KST  +  +++ N     S+  +  + ++A    +     +Q++
Sbjct  470  FVIDEGTGVLRVAAFDKST--QEGLSVVNSDSATSRRKLQHLCAQA---MARHHIARQKV  524

Query  512  ---EAKNALENYAYSLRNSLN-DEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAY  567
                AK A  ++ YSLR++ + DE  + ++ +  +  +DD +   I+WL  N +   + Y
Sbjct  525  LLARAKAAANDFTYSLRSTWHSDEASRHRVGDPSRDELDDALAAAIKWLLLNPNATIEEY  584

Query  568  ESKQKELEGVANPVL  582
            +  + +LE V+  VL
Sbjct  585  DDVRVQLETVSRRVL  599

>SPRG_06720
Length=425

 Score = 208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/391 (35%), Positives = 193/391 (49%), Gaps = 53/391 (14%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNA  67
            +SVGIDLGTTYS V V Q D V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  31   HSVGIDLGTTYSVVAVNQKDNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  90

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGES-KTFQPEEISS  126
             +T+F+AKR IGR F   V   +  H+ F +      +    +   G + +   P ++ +
Sbjct  91   RHTIFNAKRFIGRAFDATVETEEAPHYEFGLGRDEAHRVCFPLSVTGHATRCVSPVDVGA  150

Query  127  MVLIKMREDA----------GAI---------------------AGLNVLRIINEPTAAA  155
             ++ +++  A           A+                     AGL V  ++ EPTAAA
Sbjct  151  HIVSQLKTSAMRYLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  210

Query  156  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  211  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  270

Query  216  TQEFKRKHRKDITENQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  258
               F+             L R             +R   E+ KR L    S++A   IE 
Sbjct  271  VARFEELLATPALPPLSTLARTSDESAFPCTVSGMRGVAEKLKRDLSALPSAAASCVIEA  330

Query  259  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  316
             +        +T+  TR  +E +      +T+ P+  +L    ++ + + EVVLVGGS+R
Sbjct  331  STAQHAAGSLATVEMTRQEWEALVAPMLSRTLTPIHDMLDGNGMAPTDIDEVVLVGGSSR  390

Query  317  IPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            IP +Q  L+  F G+EPN  I+PD AVA GA
Sbjct  391  IPWIQHALAALF-GREPNAHIDPDVAVAVGA  420

>PYIR_21692
Length=468

 Score = 207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 133/397 (34%), Positives = 193/397 (49%), Gaps = 60/397 (15%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAHN  69
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  67   VGIDLGTTYSVVAISQKNNVSVIPDAFGHVIIPSIVAFLPGGDVLVGRQARAHRTKDPEH  126

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFK----GESKTFQPEEIS  125
            T+F+AKR IGR + D     D + + + V   +  +P+  V F+    G  K   P  + 
Sbjct  127  TIFNAKRFIGRIYDDVKQSKDDESYEYTVARASLSEPESGVCFQLSLPGHPKCVTPVSVG  186

Query  126  SMVLIKMREDAGAIAG-------------------------------LNVLRIINEPTAA  154
            S ++  +R  A +  G                               L V RI+ EPTAA
Sbjct  187  SAIVRHLRAMAHSFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRILEEPTAA  246

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            AIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D+++ + 
Sbjct  247  AIAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDIDSQVAEL  306

Query  215  FTQEFKRK-------HRKDITENQRALRR-----------LRTACERAKRTLSSSAQAYI  256
             T+    +          D+ E    L             +R A E  KRTLSS      
Sbjct  307  LTEAIAARIGTTLTSMASDMEETDSELHEDPGQLPCTPAGIRRAAELLKRTLSSEGSGSA  366

Query  257  EIDSLFDGIDFNST------ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  310
                   G    S       +TRA+FED+CG+  ++T+ PV++++    ++  ++  VVL
Sbjct  367  SCIVQRSGTLLQSAEKVTIDMTRAQFEDICGEILKRTLTPVQEIISANHMTPEEIDAVVL  426

Query  311  VGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            VGGS+RIP V++ L++ F+G+ P   I+PD AVAYGA
Sbjct  427  VGGSSRIPWVREHLAELFDGRAPLSDIDPDIAVAYGA  463

>SDRG_16559
Length=461

 Score = 207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 136/391 (35%), Positives = 197/391 (50%), Gaps = 54/391 (14%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNA  67
            +SVGIDLGTTYS V V Q   V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  68   HSVGIDLGTTYSVVAVNQKGNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  127

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGES-KTFQPEEISS  126
             +T+F+AKR IGR F D  V+ +  H+ F +     ++    +   G + +   P ++ +
Sbjct  128  RHTIFNAKRFIGRAF-DAAVETEASHYEFGLDRDEANRVCFPLSVTGHATRCASPIDVGA  186

Query  127  MVLIKMREDA----------GAI---------------------AGLNVLRIINEPTAAA  155
             ++ +++  A           A+                     AGL V  ++ EPTAAA
Sbjct  187  HIVSQLKASAMRHLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  246

Query  156  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  247  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  306

Query  216  TQEFKRKHRKDITENQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  258
               F+            +L R             +R   E+ KR L    S++A   +E 
Sbjct  307  VARFEALLATPALPALSSLARTSDASAFPCTVSGMRGVAEKLKRDLSATPSAAASCVVEA  366

Query  259  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  316
             +        +T+  TR  +E +      +T+ P+ ++L    ++ S V EVVLVGGS+R
Sbjct  367  ATPQHAAGDLATLEMTRVEWEALVAPLLSRTLSPIHEMLSGNGMAPSDVDEVVLVGGSSR  426

Query  317  IPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            IP +Q+ L   F G+EPN  I+PD AVA GA
Sbjct  427  IPWIQEALGALF-GREPNAHIDPDVAVAVGA  456

>H257_16484
Length=795

 Score = 213 bits (541),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 171/674 (25%), Positives = 297/674 (44%), Gaps = 112/674 (17%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKFS P VQ +I+++ F+       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIQNYGFKCVELPSGQVGIVLNYNDNPVTYSCEQVVAMMLN  123

Query  131  KMRE-------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
            K++                                +A  IAGLN LR++NE TA A+ YG
Sbjct  124  KLQNIAAVANDGVNPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGYG  183

Query  160  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L 
Sbjct  184  IYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFALA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
                ++F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S 
Sbjct  244  KDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSVLNIECLVDEIDYASK  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--F  328
            ++   FE +     ++   P++  L DA L+  ++  V +VGG  R+  V++ L++    
Sbjct  304  VSLDEFETLIAPLLQRLEGPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLAEILGL  363

Query  329  NGKEPN----KSINPDEAVAYGATVQAAILSG------------Ndsseklqdlllldvt  372
            + ++PN     ++N DEAVA G  +Q AILS             N+   ++         
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAILSPLFKVKDFSISDINNYPIRVSWEGAASAD  423

Query  373  plslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNL--  430
              +   ET G V T   A +  + T+K        D+ P      F    ++  + N   
Sbjct  424  DDTNEDETDGAVQTPANANSILILTRK--------DDFPTTKRITFRRSEALVVEANYDE  475

Query  431  -------------LGKFNLDGIPPMPRG-VPQIDVTFDIDANGILNVSAVEKSTG-----  471
                         LGKF + G+     G  P++ V    D +G+  V++ +         
Sbjct  476  TATPFLPPSPYTNLGKFTISGMSAGENGEAPRVRVNVRQDIHGLFEVASGQMMVEIKEEE  535

Query  472  ----------------------KENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQ  509
                                  ++  + + +    L+ AD++R   E      +D   ++
Sbjct  536  TKEAEAKEGEEKKEEGPKKKRFRKVDLKVESQVNGLTAADVNRASEEELTMAQQDRVIEE  595

Query  510  RIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAY  567
                +N LE + Y  RN L+D K  E +  +D+ A D K+ ++  WL +++  +  K  +
Sbjct  596  TANKRNELETFVYDNRNHLSD-KYSEFVSTSDRDAFDAKLNDMEDWLYSDEGFDSTKSVF  654

Query  568  ESKQKELEGVANPV  581
            ++K  EL  +  PV
Sbjct  655  QTKLDELRALLKPV  668

>H310_06229
Length=800

 Score = 211 bits (538),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 171/673 (25%), Positives = 293/673 (44%), Gaps = 107/673 (16%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKFS P VQ +IK++ F+       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIKNYGFKCVELPSGQVGIVLNYNDNPVTYTCEQVVAMMLN  123

Query  131  KMRE-------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
            K++                                +A  IAGLN LR++NE TA A+ YG
Sbjct  124  KLQNIAAVANENVRPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGYG  183

Query  160  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L 
Sbjct  184  IYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFALA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
                ++F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S 
Sbjct  244  KDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSALNIECLVDEIDYASK  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF--  328
            ++   FE +      +   P++  L DA L+  ++  V +VGG  R+  V++ L+D    
Sbjct  304  VSLEEFETLIAPLLERLEAPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLADILGL  363

Query  329  NGKEPN----KSINPDEAVAYGATVQAAIL---------------------SGNdssekl  363
            + ++PN     ++N DEAVA G  +Q AIL                     S   ++   
Sbjct  364  DKEKPNMGLSTTLNADEAVARGCALQCAILSPLFKVKDFSISDINNYPIRVSWEGATSSE  423

Query  364  qdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTF----STYADNQPGVLIQVFE  419
             D    +    +    TA      ++ R    PT K  +F        D         F 
Sbjct  424  DDTHEDETDGPAAAQPTANADSILILTRKDDFPTTKRISFRRSDPLVVDAHYDETATPFL  483

Query  420  GERSMTRDNNLLGKFNLDGIPPMPRG-VPQIDVTFDIDANGILNVSA-------------  465
                 T     LGKF + G+     G  P+I V    D +G+  V++             
Sbjct  484  PPSPYTN----LGKFTISGMCADENGEAPRIRVNVRQDIHGLFEVASGQMMVEIKEDETK  539

Query  466  ---------------VEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQR  510
                            +K   ++ ++ + +    LS +++ R   +      +D   ++ 
Sbjct  540  EVEAKEGEEKKAEEGPKKKRFRKVELKVESQVNGLSSSEVTRASEDELAMAQQDRVIEET  599

Query  511  IEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAYE  568
               +N LE + Y +RN L  EK  E +  AD+++ + K+ ++  WL +++  +  K  Y+
Sbjct  600  ANKRNELETFVYDMRNHLG-EKYSEFVSTADRESFEAKLNDMEDWLYSDEGFDSTKSVYQ  658

Query  569  SKQKELEGVANPV  581
            +K  EL  V+ P+
Sbjct  659  AKLDELRVVSKPI  671

>PYIW_19956
Length=459

 Score = 204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 138/396 (35%), Positives = 193/396 (49%), Gaps = 59/396 (15%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAH  68
            + VGIDLGTTYS V + Q + V +I +  G+   PS VAF   E L+G  A+     +  
Sbjct  61   HVVGIDLGTTYSVVAIAQKNNVSVIPDAFGHVIIPSIVAFLPGEVLVGRQARAHRTRDPK  120

Query  69   NTVFDAKRLIGRKFSDPVVQADIKHWPFQV--TSGAGDKPQITVQFKGESKTFQPEEISS  126
            +T+F+AKR IGR + D V   D   + + V  T   G   Q++V   G  K   P  I S
Sbjct  121  HTIFNAKRFIGRTYKDVVQSKDDASYEYTVARTPEGGVCFQLSV--AGHPKCVTPVAIGS  178

Query  127  MVLIKMREDA-----------GAIA--------------------GLNVLRIINEPTAAA  155
             ++  +R  A             IA                    GL V R+++EPTAAA
Sbjct  179  AIVSHLRAMAHRFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRVLDEPTAAA  238

Query  156  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            IAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D+++    
Sbjct  239  IAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDIDSQVAAFL  298

Query  216  T------------------QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIE  257
            T                  +E   +H +D  +       +R A E  KRTLSS + +   
Sbjct  299  TEAIAARIGTTLTSMASDMEESDSEHNEDPEQLPCTPAGIRRAAELLKRTLSSHSASSAS  358

Query  258  IDSLFDGIDFNST------ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  311
                  G    S       +TRA+FE+MC +   +T+ PV++++    ++  ++  VVLV
Sbjct  359  CVVQHSGTLLQSGEKVTIDVTRAQFEEMCAEILGRTLVPVQEIISANHMTPEEIDAVVLV  418

Query  312  GGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            GGS+RIP V+  L+  FNG+ P   I+PD AVAYGA
Sbjct  419  GGSSRIPWVRSNLATMFNGRAPLSDIDPDVAVAYGA  454

>H257_04453
Length=423

 Score = 202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 136/389 (35%), Positives = 197/389 (51%), Gaps = 52/389 (13%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V V ++  V ++ +  GN   PS VAF      L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDANGNLLLPSIVAFKPHGGVLVGRDARHHRRVDP  91

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQIT--VQFKGESKTFQPEEIS  125
             +T+ +AKR IGRKF D  ++AD   + F +         +   +   G      P +I 
Sbjct  92   KHTISNAKRFIGRKF-DATIEADASLYDFPLLGNTTGDHHVCFGLSVPGHPSCVSPVDIG  150

Query  126  SMVLIKMREDA----------GAI---------------------AGLNVLRIINEPTAA  154
              V+  ++E A          GA+                     AGL V  ++ EPTAA
Sbjct  151  YFVVKTLKETAMAYLGHDQIYGAVIAIPAGFDANQRKATVAAFERAGLKVRNVLVEPTAA  210

Query  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214
            A+AYGL  K    NVL+FD GGGT DVSLL +++G F+V  TAGD HLGGED D++L  H
Sbjct  211  ALAYGLHTKPNVHNVLVFDFGGGTLDVSLLYLQKGSFQVMDTAGDNHLGGEDLDDQLSGH  270

Query  215  FTQEFKR----KHRKDITENQR------ALRRLRTACERAKRTLS------SSAQAYIEI  258
               +F++        D+  +            +R   E+ KR LS      +S      +
Sbjct  271  LKHQFEQLVGGHSLPDLQTSDEPNVFPCTAAGIRGVAEQLKRQLSFDVEGEASCVVQEAV  330

Query  259  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  318
             S+  G      +TR+ +E +C    ++TM PV++VL    ++   + EVVLVGGS+RIP
Sbjct  331  GSVAVGDVLRLRMTRSEWEALCLPTLQRTMAPVKEVLEGNMMTTDDIDEVVLVGGSSRIP  390

Query  319  KVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
             +Q  L+  F G+EPN  I+PD AVA GA
Sbjct  391  WIQAQLAQMF-GREPNSHIDPDVAVAVGA  418

>PHYRA_53570
Length=395

 Score = 200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 140/395 (35%), Positives = 192/395 (49%), Gaps = 59/395 (15%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNAHN  69
            VGIDLGTTYS V + Q + V  IA+D+G    PS VAF    E L+G  A+     +  +
Sbjct  1    VGIDLGTTYSVVAISQKNNVTAIADDEGYILVPSTVAFLPHGEMLVGREARAHRTTDPQH  60

Query  70   TVFDAKRLIGRKFSDPVVQAD-----IKHWPFQVTSGAGD---KPQITVQFKGESKTFQP  121
            T+F+AKR IGRK+ D VV+++     I  + F V    G+       ++    +     P
Sbjct  61   TIFNAKRFIGRKY-DEVVRSEADSNGITPYEFVVKPAQGNVHGGVCFSLDLPEQPDCVTP  119

Query  122  EEISSMVLIKMREDAGAI-------------------------------AGLNVLRIINE  150
             +I S V+  +R  A                                  AGL V R++ E
Sbjct  120  VQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVEFDAQQRDATVAAFREAGLEVSRVLEE  179

Query  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            PTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D  
Sbjct  180  PTAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDAL  239

Query  211  LVDHFTQEFKRKHRKDIT------------ENQRA----LRRLRTACERAKRTLS--SSA  252
            L D   ++F+ +    IT            E+  A    L  +R A E  KR L+  S+A
Sbjct  240  LADWLAKQFEAQLGTPITSRGTEANVKNFDEDGMAPPCTLAGVRHAAELLKRQLTDFSTA  299

Query  253  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  312
             A          +      TR +FE +CG    +TM PV ++L    +   ++  VVLVG
Sbjct  300  SAACVWRKGTKVVRAEVKTTRTQFEALCGSLLERTMVPVREILEANNMETEEIDAVVLVG  359

Query  313  GSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            GS+R+P V+Q L++ F G+ P  +I+PD AVAYGA
Sbjct  360  GSSRVPWVRQHLTEMFQGRAPLSNIDPDLAVAYGA  394

>PHALS_09281
Length=465

 Score = 201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/397 (34%), Positives = 198/397 (50%), Gaps = 62/397 (16%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V ++Q + V  IA+++G+   PS VA+  D   LIG  A+    ++ 
Sbjct  68   HVVGIDLGTTYSVVAIFQKNNVTAIADNEGHVLVPSTVAYLPDGGVLIGREARTHRTIDP  127

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHWPFQ-----VTSGAGDKPQITVQFKGESKTFQPE  122
             +T+F+AKR IG+ + D V++++    P++     +     D     +      +   P 
Sbjct  128  QHTIFNAKRFIGQSYDD-VIKSENGTMPYEFNIKPLQRNEYDGICFALNLPNHPECVTPV  186

Query  123  EISSMVLIKMR-------------------------------EDAGAIAGLNVLRIINEP  151
            EI + ++  +                                + A   AGL V R++ EP
Sbjct  187  EIGTAIVRHLHFMAHRYVGHNQVTKAVVAVPVDFNEKQRNATKAAFRAAGLEVSRVLEEP  246

Query  152  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            TAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D RL
Sbjct  247  TAAAIAYGLHQDQNINFMLVFDFGGGTLDVSLLFARNGAITVVDTLGDNHLGGEDLDARL  306

Query  212  VDHFTQEFKRKHRKDI------TENQRALRR----------LRTACERAKRTLS-----S  250
                   F+ + +K I      TE +R L+           +R A E  KR L+     +
Sbjct  307  SAWLLMRFESQLKKKISTHNTKTEGKRVLKDRPEPPCTMAGVRQAAELLKRQLTNLSVVT  366

Query  251  SAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  310
            +A  + E D   + I     +TR +FE++C     +TM PV  +L    +   ++  VVL
Sbjct  367  AACVWNEGD---ESIQIEVDVTRLQFEELCKPLLERTMIPVRDILAANNIGTEEIDAVVL  423

Query  311  VGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            VGGS+RIP V+Q L++ F+G+ P  +I+PD AVAYGA
Sbjct  424  VGGSSRIPWVRQRLTEMFHGRAPLSNIDPDLAVAYGA  460

>PHYCA_111740
Length=810

 Score = 204 bits (520),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/391 (31%), Positives = 198/391 (51%), Gaps = 46/391 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +IK   ++    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIKQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAGLN LR+INE T+ A+AYG
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTSIALAYG  183

Query  160  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K       +   ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
                 +F  K++ +  EN ++  +L +ACE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +T   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  VTLEEFEELIAPLLQRLDGPIERALADAGIEKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  331  KEPNK------SINPDEAVAYGATVQAAILS  355
             +  +      ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/191 (21%), Positives = 80/191 (42%), Gaps = 41/191 (21%)

Query  431  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------------------  467
            +GK+ + G+P    G  +P+I V    D NG+ +V++ +                     
Sbjct  490  IGKYTISGMPAQEAGAEIPKIRVNVQQDMNGLFSVASSQLMQEIKEEEKPAEAEGDKKEG  549

Query  468  ---------------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIE  512
                           K   ++ ++T+    G LS AD+     +  K   +D   ++   
Sbjct  550  EEKDEKKDDKPAEPKKKRFRKIELTVQAQVGGLSPADVSTATEQELKMAQQDRVIEETFN  609

Query  513  AKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAYESK  570
             +N LE++ Y +RN + D K+   I   +K  ++ K+ E   WL  ++  +  K  Y+ K
Sbjct  610  KRNELESFVYEMRNQITD-KLAGFITGDEKSNLETKLMETEDWLYTDEGFDSTKSVYQQK  668

Query  571  QKELEGVANPV  581
              ++  +++PV
Sbjct  669  LDDMRKLSSPV  679

>PPTG_19375
Length=809

 Score = 204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/391 (32%), Positives = 196/391 (50%), Gaps = 46/391 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    ++    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  160  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K       +   ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
                 +F  K++ +  EN ++  +L ++CE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSSCEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            +T   FE +     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ L+D    
Sbjct  304  VTLEEFETLIEPLLKRLDGPIERALADAGIDKSQLTNVEIVGGGTRVTSVKRHLADVLGL  363

Query  331  KEPNK------SINPDEAVAYGATVQAAILS  355
             +  +      ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/188 (24%), Positives = 80/188 (43%), Gaps = 38/188 (20%)

Query  431  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAV--------------------EK  468
            +GKF + G+P    G  +P+I V    D NG+ +VS+                     E 
Sbjct  491  IGKFTISGMPAQEAGAEIPKIRVNVQQDMNGLFSVSSSQLMQEIKEEEKPAEAEGEQKEG  550

Query  469  STGKENK-------------ITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKN  515
               KE+K             +T+    G LS AD+     +  K   +D   ++    +N
Sbjct  551  EDKKEDKPAEPKKKRFRKIELTVQAQVGGLSVADVTTATEQELKMAQQDRVIEETFNKRN  610

Query  516  ALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAYESKQKE  573
             LE++ Y +RN + D K+   I   +K  ++ K+ E   WL  ++  +  K  Y+ K  +
Sbjct  611  ELESFVYEMRNQITD-KLAGFITSDEKNTLESKLMETEDWLYTDEGFDSTKSVYQQKLDD  669

Query  574  LEGVANPV  581
            +  +++PV
Sbjct  670  MRKLSSPV  677

>H310_12260
Length=424

 Score = 196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 135/391 (35%), Positives = 195/391 (50%), Gaps = 55/391 (14%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V V ++  V ++ +  G+   PS VAF  +   L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDVHGHFLLPSVVAFKPNGGVLVGRDARHYRRVDP  91

Query  68   HNTVFDAKRLIGRKFSDPVV-QADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
             +T+ +AKR IGR+F + +  +A +  +P    +         +   G      P +I  
Sbjct  92   KHTISNAKRFIGRQFDESIAAEAALYDFPLLANTTGDSHVCFGLNLPGHPSCISPVDIGY  151

Query  127  MVLIKMREDA----------GAI---------------------AGLNVLRIINEPTAAA  155
             V+  ++E A          GA+                     AGL V  ++ EPTAAA
Sbjct  152  YVVKALKETAMAFLGHDQIYGAVIAIPAGFDASQRKATVAAFERAGLKVRNVLVEPTAAA  211

Query  156  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            +AYGL  K     VL+FD GGGT DVSLL ++ G F+V  TAGD HLGGED D+ L  H 
Sbjct  212  LAYGLHTKPNVHYVLVFDFGGGTLDVSLLYLQNGSFQVMDTAGDNHLGGEDLDDLLSAHL  271

Query  216  TQEFKR---KHR----------KDITENQRALRRLRTACERAKRTLS------SSAQAYI  256
              EF++    H            D+     A   +R   E+ KR LS      +S     
Sbjct  272  KHEFEQVVGGHSLPDVQTSGDMPDVFPCTAA--GVRGVAEQLKRRLSFANDGEASCVVQQ  329

Query  257  EIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  316
             +     G      +TRA +E++C    ++TMEPV++VL    ++   V EVVLVGGS+R
Sbjct  330  AVGEYVVGDTLRLRMTRAEWEELCLPTLQRTMEPVKEVLVGNMMTAGDVDEVVLVGGSSR  389

Query  317  IPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            IP +Q  L++ F G+ PN  I+PD AVA GA
Sbjct  390  IPWIQGQLTEMF-GRAPNGHIDPDVAVAVGA  419

>PHYCA_120845
Length=444

 Score = 196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 133/392 (34%), Positives = 188/392 (48%), Gaps = 55/392 (14%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V + + + V  IA+ +G+   PS VAF  D   L+G  A+     + 
Sbjct  50   HVVGIDLGTTYSVVAISRKNNVTAIADSEGHVLVPSTVAFLPDGGVLVGREARVHRTTDP  109

Query  68   HNTVFDAKRLIGRKF--SDPVVQADIKHWPF---QVTSGAGDKPQITVQFKGESKTFQPE  122
             +T+F+AKR IG+ +  +    +  +  + F   Q+     D    ++  +G+     P 
Sbjct  110  QHTIFNAKRFIGQSYVMTSETNEKGVTPYEFVVKQMHRDEHDGICFSLSLQGQPDCVTPV  169

Query  123  EISSMVLIKMREDAGAI-------------------------------AGLNVLRIINEP  151
            +I + V+  +R  A                                  AGL V R++ EP
Sbjct  170  QIGTSVVKHLRLMAHQFVGHDQITKAVIAVPVDFNQKQREATVAAFRGAGLEVSRVLEEP  229

Query  152  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  211
            TAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D +L
Sbjct  230  TAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDAQL  289

Query  212  VDHFTQEFKRKHRKDITENQRA----------------LRRLRTACERAKRTLSSSAQAY  255
                  EF+ +    IT                     L  +R A E  KR L+ ++ A 
Sbjct  290  TAWLVGEFEAQLGTAITSRGTGDEVKTFDNDGKDPPCTLSGVRHAAELVKRQLTDASTAT  349

Query  256  IEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGST  315
                S  +G      ITR +FE++CG    +TM PV +VL    +   ++  VVLVGGS+
Sbjct  350  AACISGNEGAKVE--ITRTQFEELCGSLLERTMVPVREVLEANNMESDEIDAVVLVGGSS  407

Query  316  RIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            RIP V++ L+D F G+ P   I+PD AVAYGA
Sbjct  408  RIPWVRRRLTDMFQGRAPLSDIDPDLAVAYGA  439

>PPTG_09003
Length=449

 Score = 196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 138/396 (35%), Positives = 186/396 (47%), Gaps = 57/396 (14%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V + Q + V  I + +G    PS VAF      L+G  A+    ++ 
Sbjct  49   HVVGIDLGTTYSVVAISQKNNVTAIKDKEGYVLVPSTVAFLPHGGVLVGREARAHRTLDP  108

Query  68   HNTVFDAKRLIGRKFSDPVV-QAD---IKHWPFQV---TSGAGDKPQITVQFKGESKTFQ  120
             +TVF+AKR IG+ + D +  +AD   +  + F V        D    T+   G+     
Sbjct  109  QHTVFNAKRFIGQSYGDVLASEADENGVTPYEFGVKMLQDNKHDGVCFTLDLSGQPGCVT  168

Query  121  PEEISSMVLIKMREDAGAI-------------------------------AGLNVLRIIN  149
            P EI + V+  +R  A                                  AGL V R++ 
Sbjct  169  PVEIGTAVVRHLRSMAHNFVGHDQITKAVIAVPVDFNARQRDATVAAFRAAGLEVSRVLE  228

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D 
Sbjct  229  EPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDA  288

Query  210  RLVDHFTQEFKRKHRKDIT----------------ENQRALRRLRTACERAKRTLS--SS  251
            RL     ++F+ +    IT                E    +  +R A E  KR L+  S 
Sbjct  289  RLSAWLLKQFEAQLGAAITSRGSESEGKVSENGSNEPPCTMAGVRQAAELVKRQLTDVSV  348

Query  252  AQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  311
              A          +    T+TRA+FE++C     +TM PV  VL    +   ++  VVLV
Sbjct  349  TTAACISSGNKKPVRVEVTVTRAQFEELCDSLLERTMIPVRDVLESNNMDTDEIDAVVLV  408

Query  312  GGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            GGS+RIP V+Q L+D F G+ P   I+PD AVAYGA
Sbjct  409  GGSSRIPWVRQRLTDMFQGRPPLSDIDPDLAVAYGA  444

>HYAP_01538
Length=130

 Score = 184 bits (467),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)

Query  5   TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64
           T SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  4   TVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63

Query  65  MNAHNTVFDAKRLIGRKFSDPVVQADIKHW  94
           MNAHNTVFDAKRLIGRKFSD VVQAD+KHW
Sbjct  64  MNAHNTVFDAKRLIGRKFSDAVVQADVKHW  93

>PHYRA_82545
Length=806

 Score = 201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/391 (32%), Positives = 197/391 (50%), Gaps = 46/391 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ ++    ++    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQELAQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAGLN LR+INE TA A+A+G
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAFG  183

Query  160  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSVVAFVQGRLTVKSAAFDRFLGGRDFDMVIA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
                 +F  K++ +  EN ++  +L +ACE+AK+ LS       ++ I+ L D  D+N+ 
Sbjct  244  KDVATKFADKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNAQ  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN-  329
            +T   FE +      +  +PVE+ L+DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  VTLEEFETLIAPLLERLDDPVERALKDAGIDKSQLTNVEIVGGGTRVTSVKRHLAEVLGL  363

Query  330  GKEP-----NKSINPDEAVAYGATVQAAILS  355
             KE      + ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNFGLSSTLNADESVARGCALNCAILS  394

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/189 (23%), Positives = 81/189 (43%), Gaps = 39/189 (21%)

Query  431  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSA-----------------------  465
            +GK+ + G+P    G  VP+I V    D NG+ +V++                       
Sbjct  490  VGKYTISGMPAQEAGAEVPKIRVNVQQDMNGLFSVASSQLMQEIKEEEKPAETEGEEKKE  549

Query  466  ---------VEKSTGKENKI--TITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
                     VE    +  KI  T+ +  G LS AD+     +  K   +D   ++    +
Sbjct  550  GEEKKEDKPVEPKKKRFRKIELTVQSQVGGLSTADVSTASEQELKMAQQDRVIEETFNKR  609

Query  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAYESKQK  572
            N LE++ Y +RN ++D K+   I   +K  ++ K+ +   WL  ++  +  K  Y+ K  
Sbjct  610  NELESFVYEMRNQISD-KLAGFITSEEKGNLETKLNDTEDWLYTDEGFDSTKSVYQQKLD  668

Query  573  ELEGVANPV  581
            ++  +++PV
Sbjct  669  DMRKLSSPV  677

>PHYKE_6664
Length=804

 Score = 201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 122/391 (31%), Positives = 196/391 (50%), Gaps = 46/391 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    ++    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYECVELASGDVGIVLSYNDEPVTFSCEQVVAMILN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAGLN LR+INE TA A+A+G
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALMNATKIAGLNCLRLINEHTAIALAFG  183

Query  160  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K           ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
                ++F  K++ D   + ++  +L +ACE+AK+ LS       +I I+ L D  D+N+ 
Sbjct  244  QDVAKKFAEKYKTDPLAHPKSRLKLLSACEKAKKNLSPYGVTATHINIECLADDRDYNAQ  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  330
            ++   FE +     ++   P+E+ L+DA + KSQ+  V +VGG TR+  V++ L+D    
Sbjct  304  VSLEEFEVLIAPLLKRLDGPIERALKDAGIDKSQLTSVEIVGGGTRVTSVKRQLADVLGL  363

Query  331  KEPNK------SINPDEAVAYGATVQAAILS  355
             +  +      ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/184 (21%), Positives = 81/184 (44%), Gaps = 34/184 (18%)

Query  431  LGKFNLDGIPPMPRGV--PQIDVTFDIDANGILNVSAVE---------------------  467
            +GK+ + G+P    G   P+I V    D NG+ +VS+ +                     
Sbjct  491  VGKYTISGMPAQDAGAEAPKIRVNVQQDMNGLFSVSSSQLMQEIKEEEKPAEEKEGEEKV  550

Query  468  --------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALEN  519
                    K + ++ ++T+    G L+ AD+     +  K   +D   +     +N LE+
Sbjct  551  EDKPAEPKKKSFRKIELTVQAQVGGLTTADVSAATEQELKMAQQDRVIEDTFNKRNELES  610

Query  520  YAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAYESKQKELEGV  577
            + Y +RN ++D ++   I   +K  +++++ E   WL  ++  +  K  Y++K   +  +
Sbjct  611  FVYEMRNQISD-RLAGFITAEEKSKLEEQLMETEDWLYTDEGFDSTKSVYQTKLDGMRKL  669

Query  578  ANPV  581
            ++PV
Sbjct  670  SSPV  673

>PYIW_14231
Length=1243

 Score = 203 bits (516),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 167/551 (30%), Positives = 273/551 (50%), Gaps = 94/551 (17%)

Query  9    YSVGIDLG-----TTYSCVGVWQNDRVEII-ANDQGNRTTPSYVAFTDSERLIGDAAKNQ  62
            + +GID+G     TT S  GV  +  +E    +D      P+YV+ TDS+ ++G  A+ +
Sbjct  12   WCIGIDIGAHFFSTTVSKDGVAVDVPLEEHEQDDTKTHLLPAYVSVTDSDFIVGSEARKR  71

Query  63   VAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKT----  118
                  NT+FD  R++GRK SD +   D+  WPF+V  G  DK  + ++      T    
Sbjct  72   AKSGDSNTIFDFVRIVGRKISD-LNAGDLSKWPFKVVPGDNDKAVVEIRTSTNGSTASVS  130

Query  119  ---FQPEEISSMVLIKMRE------------------------------DAGAIAGLNVL  145
               F PEE+ ++++  ++E                              +A  IAGL   
Sbjct  131  FRMFHPEELLAVLVRCIKEKVEMMLGAVVDSAVVCVPGGFNHTQCRAVRNAFTIAGLRTE  190

Query  146  RIINEPTAAAIAYGLDKKGGERN-----VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDT  200
            +++   TA AI++GLD +    N     VL+ D+G  T D++L+S+    FEVKA   D 
Sbjct  191  KLLGAATATAISFGLDIRTDIANAAMQLVLVVDIGASTTDIALVSVLANKFEVKAVDSDL  250

Query  201  HLGGEDFDNRLVDHF----TQEFKRKHRKDITENQ---RALRRLRTACERAKRTLSSSAQ  253
             LGG+DF +R+  H     TQE        +   Q   + + ++R ACE AK+ LSSS  
Sbjct  251  GLGGDDFTDRIAAHCHRKKTQEVTPSGENAVANTQGYVKGVHQIRHACELAKKLLSSSLT  310

Query  254  AYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVH  306
            A +       GIDF +       T+TR  FE +C D ++  +E V +V++++  SK  + 
Sbjct  311  AVV-------GIDFPTSDTFGYYTVTRTGFEALCMDPWQHALERVHRVIQESSASKDDIT  363

Query  307  EVVLVGGSTRIPKVQQLLSDFF-------NGKEPNKSINPDE-AVAYGATVQAAILSGNd  358
             V+LVGGS +IP++Q L  + F        G +    ++P   A A+ + V+  +     
Sbjct  364  TVLLVGGSFQIPRLQTLFKESFPSQEVVVAGAQSPPILSPARGAAAFSSAVRRGVPGAE-  422

Query  359  sseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVF  418
                     LL+VTPLSLG+++  G    +I RNT++P  KS  F  YA+ Q  V++ V 
Sbjct  423  ---------LLEVTPLSLGIQSVAGTRIMMIPRNTSIPVHKS--FLYYANCQHAVIVYVI  471

Query  419  EGERSMTRDNNLLGKFN---LDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENK  475
            EG+ + ++ N +L + +   +DG       V +ID+T DI++   + V+A E+S+G++  
Sbjct  472  EGD-NFSKPNEILHRLSSIRVDGSLATKHLVLKIDITIDINSLDQMTVTAAERSSGRKIA  530

Query  476  ITITNDKGRLS  486
              I+ D   +S
Sbjct  531  TAISGDDTGMS  541

>PYU1_G008851
Length=795

 Score = 200 bits (509),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 127/393 (32%), Positives = 196/393 (50%), Gaps = 50/393 (13%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSVARAHFKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    ++          I +++  E  TF  E+I +MVL 
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQIVAMVLN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAGLN LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDGVQPGYAVVSVPGYYTDVQRRALLNASKIAGLNTLRLINEHTAIALAYG  183

Query  160  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSIVAFVQGKLQVKSAAYDRFLGGRDFDYA  241

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  268
            L     ++F+ K++ D     ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKKFQEKYKTDPLAEAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  269  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  328
            S IT   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ LS+  
Sbjct  302  SQITLELFEELIEPLLQRLEGPIERALNDAGVEKSQLTSVEIVGGGTRVSSVKRRLSEIL  361

Query  329  NGKEP------NKSINPDEAVAYGATVQAAILS  355
               +       + ++N DE+VA G  +Q AI S
Sbjct  362  GLDKDAQNYGLSTTLNADESVARGCALQCAISS  394

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 88/185 (48%), Gaps = 32/185 (17%)

Query  428  NNLLGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------------  467
            N  +GKF + GIP + +G  +P+I V    D NG+  V++ +                  
Sbjct  486  NTTIGKFTVSGIPELEKGAELPKIRVNVQQDINGLFAVASSQLMQEIKEEEKPAEEGKEG  545

Query  468  ---------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALE  518
                     K   ++  + +T + G LS +D+     +  K   +D   ++    +N LE
Sbjct  546  EAEKPTEPKKKRFRKVDLKVTAEVGGLSSSDVLAATEQELKMAHQDRIIEETFNKRNELE  605

Query  519  NYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAYESKQKELEG  576
             + Y +RN ++D K+ E + +++K A++DK+ E+  WL +++  +  K  Y++K  EL  
Sbjct  606  TFVYEMRNQVSD-KLAEFVTDSEKAALEDKLNEMEDWLYSDEGFDTTKSVYQAKLDELRQ  664

Query  577  VANPV  581
              +P+
Sbjct  665  STSPL  669

>PHALS_08498
Length=895

 Score = 201 bits (511),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 184/729 (25%), Positives = 315/729 (43%), Gaps = 159/729 (22%)

Query  1    MTQATTSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  59
            ++ +T      G+D G  Y  V  V      EI+ N    R T + VAF   ERL G  A
Sbjct  16   LSCSTIDAIVAGVDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADA  75

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQA--DIKHWPFQVTSGAGDKPQITVQFKGESK  117
                           +RL+G K SDP V A  D +H P+++   A     + +Q  G+ +
Sbjct  76   ATVGVRRPQTAYMQIRRLLGTKLSDPQVIALRDEEHLPYELIQNATRGGTVMLQH-GKKQ  134

Query  118  TFQPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRI  147
             F  EE+ +MV    R+                              DA  I+G+ VL +
Sbjct  135  FFHAEELVAMVFTHARQITDTFAEASVKDWVLTVPTYFSQAQRQAMLDAADISGVRVLSL  194

Query  148  INEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEE-------------GI  190
            INE TAAA+   +    D +   + +L +++G  +  VS+                   I
Sbjct  195  INENTAAALQLAVHSSFDPEEKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISI  254

Query  191  FEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSS  250
            F+  + A D  LGG  FD RL +H  QEF  K  +DI +  R + ++R   ++ K  LS+
Sbjct  255  FQTISNAWDESLGGAKFDLRLAEHLAQEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSA  314

Query  251  SAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  310
            + +  + + SL + IDF +++TR + E +  D F +T++PVE  L  A L+ + + E+ L
Sbjct  315  NEEIPVVMQSLHNDIDFFTSMTRTKLEALSSDLFERTLKPVEVALEKAGLTAADIDEIEL  374

Query  311  VGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllld  370
            +GG  R+PK+QQ LS+FF GK+    +N DEA+A GA  +AA LS +    ++    +  
Sbjct  375  IGGGVRMPKIQQQLSEFFVGKDLGVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDIAT  434

Query  371  vtplslglETAGGVMT---------------TLIARNTTVPTKKSQTFSTYAD-------  408
                   ++ +   +T                L + +  +  +KS +FS  +D       
Sbjct  435  YPIGVRLVDLSSSELTNNKEEEDMKQWMKRAALFSESHRLGVRKSVSFSHSSDLSCTFRY  494

Query  409  NQPGVL-IQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGI  460
            ++P +L + V          N  +G FN+ G+            G P++ +TF++D+NGI
Sbjct  495  DKPSMLPVGV----------NVHIGTFNVTGVEKFAARMADKNLGEPKVTLTFELDSNGI  544

Query  461  LNVSAVEKS---------------------------------------------------  469
              ++  E +                                                   
Sbjct  545  AQIAKAEATLEEEVEVEVVLKKEKKSKKSKKEDSSTDSSAAGDEKMVEEEEKPETRMEKQ  604

Query  470  --TGKENKITITNDKGRLSQADIDRM-VSEAEKYKS-------EDEANKQR--IEAKNAL  517
              T +E  I +     R  + D+  + +SE  K +S       E++ NK+R  +EAKN L
Sbjct  605  IKTHREKLIVVRAHDAREPEDDVSVLPMSEHAKKESMRMLREMENDDNKRRADLEAKNNL  664

Query  518  ENYAYSLRNSLNDEKMKEK---IPEADKKAVDDKVTEVIQWL-DANQSLEKDAYESKQKE  573
            E + Y+  ++L+ ++ + K   IPE   +++  K+TE  +WL +  +  E   Y+++ +E
Sbjct  665  ETFIYTAHDALSAQESQIKLVTIPE-QLESLQKKLTETEEWLYNDGEHAEAAEYKTRMEE  723

Query  574  LEGVANPVL  582
            L+   + +L
Sbjct  724  LKLELDSIL  732

>PITG_17383
Length=438

 Score = 190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 137/398 (34%), Positives = 185/398 (46%), Gaps = 59/398 (15%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNA  67
            + VGIDLGTTYS V + Q + V  IA+  G+   PS VAF  S   L+G  A+     + 
Sbjct  36   HVVGIDLGTTYSVVAISQKNNVTAIADKNGHVLVPSTVAFLPSGAVLVGREARAHRTTDP  95

Query  68   HNTVFDAKRLIGRKFSDPVV-QADIKHW-PFQVT-----SGAGDKPQITVQFKGESKTFQ  120
             +T+F+AKR IG+ + D +  +AD     P++ +         D    T+  +   K   
Sbjct  96   QHTIFNAKRFIGQSYEDVLTSEADENGGTPYEFSVKMLRDNEHDGVCFTLDLQDHPKCVT  155

Query  121  PEEISSMVLIKMREDAGAI-------------------------------AGLNVLRIIN  149
            P  I + V+  +R  A                                  AGL V R++ 
Sbjct  156  PVNIGTAVVQHLRSMAHQFVGHEQITKAVIAVPVDFNNRQRDATVAAFRAAGLAVSRVLE  215

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D 
Sbjct  216  EPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDA  275

Query  210  RLVDHFTQEFKRKHRKDIT------------------ENQRALRRLRTACERAKRTLS--  249
            RL     +EF+      IT                  E    +  +R A E  KR L+  
Sbjct  276  RLSAWLLKEFEAHLGTAITSRGAETETKATSVDNDSKEPPCTVAGVRQAAELLKRQLTDA  335

Query  250  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  309
            S A A    +     +      TR +FE +CG    +T+ PV +VL    +   ++  VV
Sbjct  336  SVATAACIWNDGKKTVRVEVRATRVQFEKLCGSLLERTIIPVREVLEANNMDTDEIDAVV  395

Query  310  LVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            LVGGS+RIP V+Q L+D F G+ P   I+PD AVAYGA
Sbjct  396  LVGGSSRIPWVRQRLTDMFEGRPPLSDIDPDLAVAYGA  433

>PYU1_G006843
Length=481

 Score = 190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 130/397 (33%), Positives = 187/397 (47%), Gaps = 60/397 (15%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSER-LIGDAAKNQVAMNAHN  69
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  80   VGIDLGTTYSVVAISQKNNVTVIPDVLGHVLIPSMVAFVPGGKVLVGRDARAHRTKDPAH  139

Query  70   TVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQ---ITVQFKGESKTFQPEEISS  126
            T+F+AKR IGR + D V   D   + F V+    D        V   G  K   P  I +
Sbjct  140  TIFNAKRFIGRTYEDVVQSKDAASYEFAVSKAPNDVHHGVCFPVNVPGHRKCVSPIAIGA  199

Query  127  MVLIKMREDAGAI-------------------------------AGLNVLRIINEPTAAA  155
             ++  +R  A A                                AGL+V RI+ EPTAAA
Sbjct  200  TIVGHLRAMAHAFVGHNQITKAVIAVPVDFDGVQRAATQKAFFAAGLHVSRILEEPTAAA  259

Query  156  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  215
            IAYGL +      +L+FD GGGT DVSLL    G   V  T GD +LGGED D ++ +  
Sbjct  260  IAYGLHQDPSVNFILVFDFGGGTLDVSLLFTRAGSINVVDTIGDNNLGGEDLDAKVAEVL  319

Query  216  TQEFKRKHRKDITENQR-------------------ALRRLRTACERAKRTLS--SSAQA  254
            T +   +    +T                        L  +R A E  KRTLS  +SA A
Sbjct  320  THKIAERIGTTLTSATSDMEETYSDRTNDDPDQLPCTLAGIRRAAELLKRTLSYETSATA  379

Query  255  YIEIDSLFDGIDFNSTI----TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  310
               +    + +    T+    TR   E++C +   +T+ PV++++    ++  ++  VVL
Sbjct  380  SCVVQMSGELLQARETVSIEMTRTELEEICSELLARTLVPVKEIIEANHMTSEEIDAVVL  439

Query  311  VGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            VGGS+RIP V++ L+  F+G+ P   I+ D AVAYGA
Sbjct  440  VGGSSRIPWVREHLAKMFDGRAPLSDIDRDVAVAYGA  476

>PHYSO_247517
Length=794

 Score = 194 bits (493),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 170/646 (26%), Positives = 287/646 (44%), Gaps = 117/646 (18%)

Query  46   VAFTDSERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDK  105
            V     +R IG+AA +   M+  NT  D KRLIGRKF  P VQ +I    ++    A   
Sbjct  24   VCVQGKQRFIGEAAISMARMHYKNTATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGD  83

Query  106  PQITVQFKGESKTFQPEEISSMVLIKMREDAGA---------------------------  138
              I + +  E  TF  E++ +M+L KM+  A A                           
Sbjct  84   VGIVLNYNDEPVTFSCEQVVAMILNKMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALL  143

Query  139  ----IAGLNVLRIINEPTAAAIAYGLDK-------KGGERNVLIFDLGGGTFDVSLLSIE  187
                IAGLN LR+INE TA A+AYG+ K       +   ++V+  DLG  ++ VS+++  
Sbjct  144  NATKIAGLNCLRLINEHTAIALAYGIYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFV  203

Query  188  EGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRT  247
            +G   VK+ A D  LGG DFD  +      +F  K++ +  EN ++  +L +ACE+AK+ 
Sbjct  204  QGRLTVKSAAFDRFLGGRDFDMVIAKDAAAKFAAKYKTNPLENPKSRIKLLSACEKAKKN  263

Query  248  LSSSA--QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  305
            LS       ++ I+ L D  D+NS +T   FE++      +   P+E+ L DA + KSQ+
Sbjct  264  LSPYGVTATHLNIECLADDRDYNSQVTLEEFEELIAPLLTRLDGPIERALADAGVEKSQL  323

Query  306  HEVVLVGGSTRIPKVQQLLSDFFNGKEPNK------SINPDEAVAYGATVQAAILS----  355
              V +VGG TR+  V++ L++     +  +      ++N DE+VA G  +  AILS    
Sbjct  324  ANVEIVGGGTRVTSVKRHLAEVLGLDKEQQNYGLSTTLNADESVARGCALNCAILSPMFK  383

Query  356  -------------------GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  396
                               G+ S+         DV   +   E +  V   +++R    P
Sbjct  384  VKEFSVTDRVHLPVRVSWDGSASTATDAADDDEDVNMETPASEDSSLV---ILSRKDEYP  440

Query  397  TKKSQTFSTYADNQPGVLIQVF-EGERSMTRDNNLL--GKFNLDGIPPMPRG--VPQIDV  451
              K  TF     ++P  +  V+ E  ++    + ++  GKF + G+P    G  +P+I V
Sbjct  441  KTKRITFRR---DKPFSIDAVYDESAKAYLPPDYVMDIGKFTVSGMPAQEAGAEIPKIRV  497

Query  452  TFDIDANGILNVSAVE----------------------------------KSTGKENKIT  477
                D NG+ ++++ +                                  K   ++ ++T
Sbjct  498  NVQQDMNGLFSIASSQLMQEIKEEEKPAEAEGEEKKEGEEKKEDKPAEPKKKRFRKIELT  557

Query  478  ITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEKI  537
            +    G LS AD+     +  K   +D   ++    +N LE++ Y +RN + D K+   I
Sbjct  558  VQAQVGGLSAADLTTATEQELKMAQQDRVIEETFNKRNELESFVYEMRNQITD-KLAGFI  616

Query  538  PEADKKAVDDKVTEVIQWLDANQSLE--KDAYESKQKELEGVANPV  581
               +K  ++ K+ E   WL  ++  +  K  Y+ K  +L  +++PV
Sbjct  617  TSEEKGNLEAKLMETEDWLYTDEGFDSTKSVYQQKLDDLRKLSSPV  662

>PHYCA_504114
Length=887

 Score = 193 bits (491),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 145/541 (27%), Positives = 250/541 (46%), Gaps = 100/541 (18%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            G+DLG  +  +  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDLGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  71   VFDAKRLIGRKFSDPVVQA--DIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
                +RL+G + SDP V +  D +H+P+++   A     I+++  G+S+TF  EE+ +MV
Sbjct  88   YAQIRRLLGTRLSDPQVSSLLDEEHFPYELVQNATRGGTISLKH-GKSQTFHAEELVAMV  146

Query  129  LIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAY  158
                R+                              DA  I+G+ VL +INE TAAA+  
Sbjct  147  FAHARQITDTFAEAAVKDWVLTVPSFFSQAQRQALLDAAEISGVRVLSLINENTAAALQL  206

Query  159  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  201
             +    D +   + +L +++G  +  VS+      +             F+  + A D  
Sbjct  207  AVHASYDPEDKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWDES  266

Query  202  LGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  261
            LGG  FD RL +H   EF  K  +DI +  R + ++R   ++ K  LS++ +  + + SL
Sbjct  267  LGGAKFDLRLAEHLATEFSEKIGEDIRKIPRPMAKIRAQAKKTKTVLSANEEIPVVMQSL  326

Query  262  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  321
            ++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG  R+PK+Q
Sbjct  327  YNDIDFFTSMTRSKLEELSSDLFDRTLKPVETALEKAGLTAADIDEIEIIGGGVRMPKIQ  386

Query  322  QLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETA  381
            Q LS+FF+GK+    +N DEA+A GA  +AA LS +    ++    L         ++ +
Sbjct  387  QQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDLATYPIGVRLVDLS  446

Query  382  G---------GVMT-------TLIARNTTVPTKKSQTFS-------TYADNQP-----GV  413
                       V T       +L + +  +  +KS +FS       T+  ++P     GV
Sbjct  447  ATEPKDNNDDDVETKQWMKRASLFSESHRLGLRKSVSFSHSNDISCTFRYDKPSMLPAGV  506

Query  414  LIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAV  466
             +Q+               KFN+ G+            G P++ ++F++D+NGI  ++  
Sbjct  507  SVQI--------------AKFNITGVEKFAARMADKNLGEPKVTLSFELDSNGIAQIAKA  552

Query  467  E  467
            E
Sbjct  553  E  553

 Score = 36.2 bits (82),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 8/87 (9%)

Query  492  RMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLN--DEKMKE-KIPEADKKAVDDK  548
            RM++E EK  ++  AN   +EAKN+LE + Y   ++L+  + ++KE  +PE   +++  K
Sbjct  643  RMLNEMEKTDNKRRAN---LEAKNSLETFIYKAHDALSAQESQIKEVTVPE-QVESLQRK  698

Query  549  VTEVIQWL-DANQSLEKDAYESKQKEL  574
            + E  +WL D    +E   Y+ K  EL
Sbjct  699  LEETEEWLYDDGDKVEAAEYKKKMDEL  725

>HYAP_07918
Length=897

 Score = 193 bits (490),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 125/396 (32%), Positives = 194/396 (49%), Gaps = 51/396 (13%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            G+DLG+ +  V  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  29   GVDLGSEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRKPQTA  88

Query  71   VFDAKRLIGRKFSDPVVQADI--KHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMV  128
                +RL+G K SDP V + +  +H+P+Q+ S A     I ++   ++ TF  EE+ +MV
Sbjct  89   YAQIRRLLGTKLSDPQVVSLLTDEHFPYQLVSNATRGGAIALKHANDA-TFHAEELVAMV  147

Query  129  LIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIAY  158
            L   R+                              DA  IAG+ VL +IN+ TAAA+  
Sbjct  148  LTHARQITNTFAEVPVKDYVLTVPTFFSQAQRQALLDAAEIAGVRVLSLINDNTAAALQL  207

Query  159  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  201
             +    D     + VL ++LG     VS+ ++   +             FE  + A D  
Sbjct  208  AVHTSYDPTEAPKRVLFYNLGSTALQVSIAAMSSQVVPDGFKKNKTVSTFETLSNAWDES  267

Query  202  LGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  261
            LGG  FD RL +H   EF ++  +DI    RA+ ++R    + K  LS++ Q  + + SL
Sbjct  268  LGGSKFDLRLAEHLATEFSQQIGQDIRTVPRAMAKIRAQAMKTKTVLSANEQIPVVMQSL  327

Query  262  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  321
             + +DF +++TR + E++  D F +T++PVE+ L  A L+ + + E+ L+GG  R+PK+Q
Sbjct  328  HNDVDFFTSMTRTKLEELSSDLFERTLKPVEQALEKAGLTVADIDEIELIGGGVRMPKIQ  387

Query  322  QLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  357
              LS FF GK+    +N DEA+A GA  +AA LS +
Sbjct  388  HQLSQFFAGKDLGVHLNGDEAMALGAAFRAANLSNS  423

>CCA27145
Length=463

 Score = 184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 125/403 (31%), Positives = 189/403 (47%), Gaps = 65/403 (16%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMNA  67
            + +GIDLGTTYS V + Q++ V II +   +   PS V F  +   L+G  A+     + 
Sbjct  57   HVIGIDLGTTYSVVAISQHNNVTIIPDRHHHTLIPSIVTFLPEGALLVGRQARAYRTKDP  116

Query  68   HNTVFDAKRLIGRKFSDPVVQADIKHW---PFQVTSGAGDK----PQITVQFKGESKTFQ  120
             +T+++AKR IGR +++ +  A+   +   PF+  S +  +    P  ++   G      
Sbjct  117  RHTIYNAKRFIGRSYNESIQAAEPYGFSIEPFRNESASEPESLPGPCFSLSVSGHPACVT  176

Query  121  PEEISSMVLIKMREDAGAI-------------------------------AGLNVLRIIN  149
            P EI S+++  +   A                                  AGL V R++ 
Sbjct  177  PIEIGSLIIRHLHLMAHEFVKHNQLDRVVIAVPVDFKPAQRRATVQAYEKAGLKVARVLE  236

Query  150  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  209
            EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G   V  T GD +LGGED DN
Sbjct  237  EPTAAAIAYGLHQAPNVNFILVFDFGGGTLDVSLLFVRSGSISVVDTLGDNNLGGEDLDN  296

Query  210  RLVDHFTQEFK------------------RKHRKDITENQRALRRLRTACERAKRTLSSS  251
             + +H T + +                   +  +D  +    +  +R A E  KR LS S
Sbjct  297  LVSNHLTSQLEALLGMKLAEASSEVMETDSEKNEDPDQLPCTIAGIRRAAEILKRKLSFS  356

Query  252  AQAYIEIDSLFDGIDF-------NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQ  304
              A         G            +++R  FE +C     + + PV ++LRD  ++   
Sbjct  357  DSAIASCIVQEPGGKLIPQDNRVEISMSRIEFEALCEPILERALIPVRQILRDNHMNPKS  416

Query  305  VHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            + EVVLVGGS+RIP +   L + F GK+P  +I+PD AVA+GA
Sbjct  417  IDEVVLVGGSSRIPWIHTQLEELF-GKQPRITIDPDVAVAFGA  458

>PHYRA_73661
Length=884

 Score = 189 bits (481),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 151/555 (27%), Positives = 254/555 (46%), Gaps = 108/555 (19%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAA  59
            M +A  +G   G   G  +    V      EI+ N    R T + VAF   ERL G DAA
Sbjct  20   MVEAIVAGVDFG---GEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA  76

Query  60   KNQVAMNAHNTVFDA-KRLIGRKFSDPVVQA--DIKHWPFQVTSGAGDKPQITVQFKGES  116
               V +    T +   +RL+G   SDP V A  D +H+P+ +   A     I+++  G+ 
Sbjct  77   --TVGVRRPQTAYSQIRRLLGTTLSDPQVSALLDEEHFPYDLVQNASRGGTISLK-HGKD  133

Query  117  KTFQPEEISSMVLIKMRE------------------------------DAGAIAGLNVLR  146
            + FQ EE+ +MV    R+                              DA  I+G+ VL 
Sbjct  134  QAFQAEELVAMVFAHARQITNTFAEAPVKDWVLTVPTFFSQAQRQALLDAAEISGVRVLS  193

Query  147  IINEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI------------  190
            +INE TAAA+   +    D +   + +L ++LG  +  VS+      +            
Sbjct  194  LINENTAAALQLAVHASYDPEDKPKKILFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTIS  253

Query  191  -FEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLS  249
             FE  + A D  LGG  FD RL ++   EF  K  +DI +  R + ++R   ++ K  LS
Sbjct  254  TFETISNAWDESLGGAKFDLRLAEYLATEFSEKIGEDIRKVARPMAKIRAQAKKTKTVLS  313

Query  250  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  309
            ++ +  + + SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ 
Sbjct  314  ANEEIPVVMQSLYNDIDFFTSMTRSKLEELSADLFERTIKPVEVALEKAGLTVADIDEIE  373

Query  310  LVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdllll  369
            L+GG  R+P++QQ LS+FF GK+ +  +N DEA+A GA  +AA LS +    ++    + 
Sbjct  374  LIGGGVRMPRIQQQLSEFFEGKDLSVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDIA  433

Query  370  dvtplslglETAGG-----------VMT-------TLIARNTTVPTKKSQTFS-------  404
                    ++ +             V T        L + +  +  +KS +FS       
Sbjct  434  SYPVGVRLVDLSASEPKDNDNNDDEVETKQWMKRAALFSESHRLGLRKSVSFSHSNDVSC  493

Query  405  TYADNQP-----GVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVT  452
            T+  ++P     GV +Q+              GKFN+ G+            G P++ ++
Sbjct  494  TFRYDKPSMLPAGVSVQI--------------GKFNITGVEKFVARMADKNLGEPKVTLS  539

Query  453  FDIDANGILNVSAVE  467
            F++D+NGI  ++  E
Sbjct  540  FELDSNGIAQIAKAE  554

 Score = 33.9 bits (76),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 7/68 (10%)

Query  492  RMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDEKMKEK---IPEADKKAVDDK  548
            RM++E EK  ++  AN   +EAKN+LE + Y   ++L+ ++ + K   +PE   +++  K
Sbjct  646  RMLTEMEKADNKRSAN---LEAKNSLETFIYKAHDALSAQESQIKQVTVPE-QVESLQSK  701

Query  549  VTEVIQWL  556
            + E  +WL
Sbjct  702  LEETEEWL  709

>PITG_15771
Length=883

 Score = 189 bits (480),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 121/406 (30%), Positives = 198/406 (49%), Gaps = 53/406 (13%)

Query  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60
            M +A  +G   G   G  +    V      EI+ N    R T + VAF   ERL G  A 
Sbjct  21   MVEAIVAGVDFG---GEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA  77

Query  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQA--DIKHWPFQVTSGAGDKPQITVQFKGESKT  118
                          +RL+G   SDP V +  D +H+P+++   A     I+++  G+ +T
Sbjct  78   TVGVRRPQTAYAQIRRLLGTTLSDPQVSSLLDEEHFPYELIQNATRGGTISLKH-GKEQT  136

Query  119  FQPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRII  148
            +  EE+ +MV    R+                              DA  I+G+ VL +I
Sbjct  137  YHAEELVAMVFTHARQITDTFAEAPVKDWVLTVPTFFSQAQRQAMLDAAEISGVRVLSLI  196

Query  149  NEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------F  191
            NE TAAA+   +    D +   + +L F++G  +  VS+      +             F
Sbjct  197  NENTAAALQLAVHASYDPEDKPKKILFFNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTF  256

Query  192  EVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSS  251
            +  + A D  LGG  FD RL +H  +EF  K  +DI +  R + ++R   ++ K  LS++
Sbjct  257  QTISNAWDESLGGAKFDLRLAEHLAKEFSDKIGEDIRKVARPMAKIRALAKKTKTVLSAN  316

Query  252  AQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  311
             +  + + SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + EV ++
Sbjct  317  EEIPVVMQSLYNDIDFFTSMTRSKLEELSSDLFERTLKPVEVALEKAGLTAADIDEVEII  376

Query  312  GGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  357
            GG  R+PK+QQ LS+FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  377  GGGVRMPKIQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

>PYAP_19741
Length=885

 Score = 189 bits (479),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 121/405 (30%), Positives = 194/405 (48%), Gaps = 51/405 (13%)

Query  1    MTQATTSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  59
            +  A  S    G+D G  +  +  V      EI+ N    R T + VAF   ERL G  A
Sbjct  17   LAPAAVSANVAGVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADA  76

Query  60   KNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIK--HWPFQVTSGAGDKPQITVQFKGES-  116
                           +R +G    DP + + ++  ++P+++     +  + TV  K E+ 
Sbjct  77   ATVGVRRPQTCYAQVRRFLGTTPEDPAIASLLQEEYFPYELLQ---NDTRGTVALKHEND  133

Query  117  KTFQPEEISSMVLIKMRE------------------------------DAGAIAGLNVLR  146
            + F  EE+ +MV    R+                              DA  I+G+  L 
Sbjct  134  QVFHAEELVAMVFTHARQITDAFAEVPVKDWVLTVPDFFTQAQRQAMLDAAEISGVRALS  193

Query  147  IINEPTAAAIAYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FE  192
            +INE TAAA+   +     E R VL +++G  +  VS++     +             FE
Sbjct  194  LINENTAAALQLAVHSTFPEPRRVLFYNMGSTSLQVSIVEFSSQVVPDGFKKNKTVSGFE  253

Query  193  VKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA  252
            V + A D  LGG  FD RL +H   EF  K  +D+ +  R + ++R   ++ K  LS++ 
Sbjct  254  VLSKAWDPLLGGAKFDLRLAEHLAAEFSEKLGEDVRQIPRPMAKIRAQAKKTKIVLSANE  313

Query  253  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  312
            Q  + + SL+  IDF +++TR +FE+MC D F + M+PVE+ L  A L+ + +HE+ ++G
Sbjct  314  QIPVVMQSLYKDIDFFTSMTRGKFEEMCKDLFAQAMKPVEQALEKAGLTPADIHEIEIIG  373

Query  313  GSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  357
            G  R+PK+QQ L +FF+GK+    +N DEA+A GA   AA LS +
Sbjct  374  GGVRMPKIQQQLKEFFSGKDLGVHLNGDEAMALGAAFHAANLSNS  418

>SDRG_03266
Length=792

 Score = 187 bits (474),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 190/391 (49%), Gaps = 46/391 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF+   VQ +I  + F+       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFSCEQVVGMFLN  123

Query  131  KMRE-------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
            KM+                                 A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSASKIAGMNCLRLMNEHTAVALSYG  183

Query  160  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFIDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
               +++F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--F  328
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+  V++ L+D    
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  329  NGKEPN----KSINPDEAVAYGATVQAAILS  355
            + ++PN     ++N DEAVA G  +Q AILS
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAILS  394

>SPRG_08060
Length=793

 Score = 186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 190/391 (49%), Gaps = 46/391 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF+   VQ +I  + F+       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFTCEQVVGMFLN  123

Query  131  KMRE-------------------------------DAGAIAGLNVLRIINEPTAAAIAYG  159
            KM+                                 A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSAAKIAGMNCLRLMNEHTAVALSYG  183

Query  160  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFVDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  213  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  270
               +++F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  271  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--F  328
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+  V++ L+D    
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  329  NGKEPN----KSINPDEAVAYGATVQAAILS  355
            + ++PN     ++N DEAVA G  +Q AILS
Sbjct  364  DKEKPNMGLSTTLNADEAVARGCALQCAILS  394

>SPRG_11007
Length=426

 Score = 178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 141/208 (68%), Gaps = 7/208 (3%)

Query  227  ITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRK  286
            +T   RA+RRLRTACE+AKR LS S  A +E++ LF  +DF S+ITRARFED+C   FRK
Sbjct  1    MTTCDRAVRRLRTACEKAKRDLSISNTATLELEVLFGNVDFRSSITRARFEDLCSGLFRK  60

Query  287  TMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS-----INPDE  341
              +P+EKVLRDAK+ KSQV +VVL GGS R+PK+QQLLS FF  +  +K      +N +E
Sbjct  61   VTQPIEKVLRDAKIDKSQVRDVVLAGGSMRMPKMQQLLSSFFGERYADKKLCHSILNNNE  120

Query  342  AVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQ  401
            A A+GATV AA+   +D+S  +  LL+L V P S+G+ET GGVMTT+I+RNTT+P+KKS+
Sbjct  121  AAAHGATVMAAL--NDDTSPDVWHLLVLHVVPYSVGIETGGGVMTTVISRNTTIPSKKSE  178

Query  402  TFSTYADNQPGVLIQVFEGERSMTRDNN  429
             F       P      F      T D++
Sbjct  179  EFKISQPQSPPYHPTSFSYRDECTCDDS  206

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 73/169 (43%), Gaps = 41/169 (24%)

Query  402  TFSTYADNQPGV-----LIQVFEGERSMTRDNNLLGKFNLDGI-PPMPRGVPQIDVTFDI  455
            ++  Y   +P +      I++F GERSM RDN  L    + G   P  R     DVTFDI
Sbjct  255  SYPRYGPKEPFIDARDNAIKIFTGERSMVRDNTPLHTIAIHGFYDPTARS----DVTFDI  310

Query  456  DANGILN-VSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514
            D NG+L  +       G    I +  DKG LSQ D+ R+ +  E   + D+  ++R+ A 
Sbjct  311  DGNGLLTAIVTYTPHIGTNETIVVKLDKGYLSQHDVKRLTTNFE--AAADDRTRRRV-AH  367

Query  515  NALE------NYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLD  557
              L+      NY Y                    +A D    EV++WLD
Sbjct  368  EQLQMYLIGGNYPY-------------------WRAAD--AVEVLEWLD  395

>PYAR_22140
Length=353

 Score = 176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 184/326 (56%), Gaps = 8/326 (2%)

Query  212  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  271
            +D+   ++K+    D   + R L+RL    ER +  L    +A + I+S         ++
Sbjct  1    MDYCISQWKQDKHVDTLTDPRTLQRLHVKAERVQYALLEHTEAVVAIESSDGSAVLTQSL  60

Query  272  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  331
            ++A FE +  D+ +  M  V  VLRDA ++K +V  +V  GG+ R+PK+++LL  F  GK
Sbjct  61   SQATFETLTRDFVKTVMGMVGSVLRDANVTKLEVETIVFAGGTWRLPKLRRLLVAFCCGK  120

Query  332  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  391
            EP + ++ +EAV +GA + A ILSG    +   ++ ++ +T LSLG+ETAGGVM  +  R
Sbjct  121  EPVRGVDEEEAVVHGAAILAGILSGQ-VEDGAGEMCIMPLTFLSLGMETAGGVMHRIFPR  179

Query  392  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  451
            N+    KK +T ST   NQ  + I+VFEGER +T++N+ LG+  L G+ P P GVP+I+V
Sbjct  180  NSIYLAKK-RTVSTLRANQTELTIRVFEGERILTKNNHFLGQLKLKGLSPAPPGVPRIEV  238

Query  452  TFDIDAN-GILNVSAVEKSTGKENKITI-----TNDKGRLSQADIDRMVSEAEKYKSEDE  505
             F+ID +  ++ +SA    +     +TI     +    R+   + D ++ EAE+ K ED 
Sbjct  239  QFEIDVDYDMMVISAQAMGSTLSENVTIRLVENSLAYKRMKSEEYDTLLEEAERAKDEDT  298

Query  506  ANKQRIEAKNALENYAYSLRNSLNDE  531
              K RIE   A+ ++A    +  +DE
Sbjct  299  KAKSRIEQYLAIRDHALHGPSEQDDE  324

>PHYSO_255506
Length=1228

 Score = 186 bits (472),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 123/398 (31%), Positives = 200/398 (50%), Gaps = 55/398 (14%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAAKNQVAMNAHN  69
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  364  GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAAT--VGVRRPQ  421

Query  70   TVF-DAKRLIGRKFSDPVVQA--DIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
            T +   +RL+G   SDP V A  D +H+P+Q+   A     +++Q   + + F  EE+ +
Sbjct  422  TAYAQIRRLLGTTLSDPQVAALLDEEHFPYQLLQNATRGGTVSLQH-AKDRVFHAEELVA  480

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MV    R+                              DA  I+G+ VL +INE TA+A+
Sbjct  481  MVFAHARQITDTFAEAPVKDWVLTVPAFFSQAQRQAMLDAAEISGVRVLSLINENTASAL  540

Query  157  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  199
               +    D +   + +L +++G  +  VS+      +             F+  + A D
Sbjct  541  QLAVHASYDPEDKPKRILFYNMGSTSLQVSVAEFSSQVVPDGFKKNKTISTFQTLSNAWD  600

Query  200  THLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  259
              LGG  FD RL +H  +EF  K  +DI +  R + ++R   ++ K  LS++ +  + + 
Sbjct  601  ESLGGAKFDLRLAEHLAKEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEIPVVMQ  660

Query  260  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  319
            SL++ IDF ++ITR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG  R+PK
Sbjct  661  SLYNDIDFFTSITRSKLEELSADLFDRTLKPVEVALEKAGLTVADIDEIEIIGGGVRMPK  720

Query  320  VQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  357
            +QQ LS+FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  721  IQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  758

 Score = 33.9 bits (76),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 42/68 (62%), Gaps = 7/68 (10%)

Query  492   RMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLN--DEKMKE-KIPEADKKAVDDK  548
             RM++E EK  ++  AN   +EAKN+LE + Y   ++L+  + ++KE  +PE   +++  K
Sbjct  982   RMLTEMEKADNKRRAN---LEAKNSLETFIYKAHDALSAQESQIKEVTVPE-QVESLQTK  1037

Query  549   VTEVIQWL  556
             + E  +WL
Sbjct  1038  LEETEEWL  1045

>PYAP_21865
Length=481

 Score = 179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 131/410 (32%), Positives = 188/410 (46%), Gaps = 75/410 (18%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAH  68
            ++VGIDLGTTYS V + QN+ V +I ++ G+  TPS VA+  + R    A + +   +  
Sbjct  71   HTVGIDLGTTYSVVAISQNNSVTVIPDEHGHLITPSIVAYLPNGRREARAYRTK---DPR  127

Query  69   NTVFDAKRLIGRKFSDPVVQADIKHWPFQVT-SGAGDKPQITVQFK----GESKTFQPEE  123
            +T+F+AKR IGR F D    A    WP++ T    G+    TV F+    G      P +
Sbjct  128  HTIFNAKRFIGRSFRDVSDDASTT-WPYEFTIKRYGEHDNATVCFELETVGHPNCISPVD  186

Query  124  ISSMVLIKMREDA---------GAI-----------------------------------  139
            + + ++  ++  A         G I                                   
Sbjct  187  VGTRIVQHLKTLAWRFVGHNQMGMIDNLLSGLTHNYCGQINRAVIAVPVDFDSKQRSATV  246

Query  140  -----AGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVK  194
                 AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V 
Sbjct  247  AAFNAAGLKVSRVLEEPTAAAIAYGLHQDASVNFILVFDFGGGTLDVSLLFARSGSISVI  306

Query  195  ATAGDTHLGGEDFDNRLVDHFTQEFKRK-------------HRK-DITENQRALRRLRTA  240
             T GD +LGGED D  +  H  Q  + K             H + D   +  AL   +  
Sbjct  307  DTMGDNNLGGEDLDAAIAHHLIQNLEVKLGAVSSGGSGVDAHEQLDHDGDSEALPCTKAG  366

Query  241  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTI---TRARFEDMCGDYFRKTMEPVEKVLRD  297
              RA   L  S  + +E  +     D N  I   +R   E +C    ++T+ PV ++L  
Sbjct  367  IRRAAEMLKRSLSSSLEASASCLTTDNNRVIMAMSRYELESICEAILKRTLVPVREILEA  426

Query  298  AKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
              ++   +  VVLVGGSTR+P V++ L+  F G+ P   I+PD AVAYGA
Sbjct  427  NSMTIQDIDAVVLVGGSTRLPWVRRELTAMFGGRPPLTDIDPDVAVAYGA  476

>PYAR_16202
Length=893

 Score = 184 bits (467),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 138/528 (26%), Positives = 235/528 (45%), Gaps = 84/528 (16%)

Query  12   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            G+D G  +  + + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  33   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGEERLYGADAATVGVRRPQTC  92

Query  71   VFDAKRLIGRKFSDPVVQADIK--HWPFQVTSGAGDKPQITVQFKGES-KTFQPEEISSM  127
                +R +G    DP + A I+  ++P+++     +  + TV  K +  + F  EE+ +M
Sbjct  93   YAQIRRFLGTTKEDPAISALIQDEYFPYELLH---NDTRGTVALKHDKGQVFSAEELVAM  149

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            V    R                               DA  I+G+  L ++NE TAAA+ 
Sbjct  150  VFTHARHITDAFAEVPVKDWVVTVPDFFTQAQRQAMLDAAEISGVRALSLLNENTAAALQ  209

Query  158  YGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHLG  203
              +     E R VL ++LG  +  VS+      +             FEV + A D  LG
Sbjct  210  LAVHSTFAEPRRVLFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTVSGFEVLSKAWDASLG  269

Query  204  GEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  263
            G  FD RL +H   EF  K  +D+ +  R + ++R   ++ K  LS++ Q  + + SL+ 
Sbjct  270  GAKFDLRLAEHLAAEFSEKLGEDVRQLPRPMAKIRAQAKKTKIVLSANEQIPVVMQSLYK  329

Query  264  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  323
             +DF +++TR++ E++C D F + M+PVE+ L  A L K  +HE+ ++GG  R+PK+QQ 
Sbjct  330  DVDFFTSMTRSKLEEICKDLFAQAMKPVEQALEKAGLKKDDIHEIEIIGGGVRMPKIQQQ  389

Query  324  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglET--A  381
            L DFF GK+    +N DEA+A GA   AA LS +     +    +         ++   A
Sbjct  390  LKDFFEGKDLGVHLNGDEAMALGAAFHAANLSNSFRVRHVGMTDIAPYAVGVRLVDIDHA  449

Query  382  GG--------VMTTLIARNTTVPTKKSQTF-------STYADNQPGVLIQVFEGERSMTR  426
            G            +L   ++ +  +K+ +F       +T+  ++P  L            
Sbjct  450  GSDDSDKHWVKRASLFTESSKLGLRKAVSFLHSKDISATFRYDKPSSL---------PVG  500

Query  427  DNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAVE  467
             ++ + KFN+ GI            G P++ +TF++D +G+  ++  E
Sbjct  501  ASSHIAKFNITGIEEFAAKFADKNLGEPKVSLTFELDGSGVTKIAKAE  548

 Score = 33.5 bits (75),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (49%), Gaps = 6/90 (7%)

Query  489  DIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSL--NDEKMKEKIPEADKKAVD  546
            D  RM+ E E   ++  AN   +EAKN LE+Y Y+ R++L   +E+          + + 
Sbjct  649  DSMRMLREMELADNQRRAN---LEAKNKLESYVYTARDTLGAQEEEFTAVTTSEQLEKLR  705

Query  547  DKVTEVIQWL-DANQSLEKDAYESKQKELE  575
             K+ E  +WL D  + +    Y  K K L+
Sbjct  706  TKLEETEEWLYDEGEKVSAAEYNKKVKSLD  735

>PYU1_G000896
Length=711

 Score = 179 bits (454),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 158/562 (28%), Positives = 261/562 (46%), Gaps = 99/562 (18%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEI----------IANDQGNRTTPSYVAFTDSERLIGDA  58
            + +GID GT + C      D + +          I +++     P++V+ TD+  LIG  
Sbjct  58   WVLGIDFGT-HLCSAAVSRDGIVVDVPVPGDAAAIDDNKSPLAVPAFVSVTDTGYLIGTE  116

Query  59   AKNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGES--  116
            A+        NTVFD  RL+GRK  D +  AD   WPF V +G  DK  + +     S  
Sbjct  117  ARTLARRGDLNTVFDLTRLVGRKVGD-LSDADQARWPFHVVAGDHDKVLVAILGTNNSVS  175

Query  117  --KTFQPEEISSMVLIKMREDA------------------------------GAIAGLNV  144
              +   PEE+ +++ ++++E+A                              G IAGL+V
Sbjct  176  NPRKLYPEELLAVLFLQLKENAEALLHTKLQTAVLCVPEGFNHTQRRAVRNAGMIAGLSV  235

Query  145  LRIINEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIE-EGIFEVKATAGD  199
             R++   TAAA+++G+          R ++  D+G    +++L++++   +FEVKA A D
Sbjct  236  TRLVCAATAAAVSFGIGSSVPSSLSTRVIMTVDIGASATNMALVAVKNRTVFEVKAVASD  295

Query  200  THLGGEDFDNRLVDHFTQEFKRKHRK------------DITENQ-RALRRLRTACERAKR  246
             +LGG D    +V H  +       +            D +E+Q   +R++R A E AK+
Sbjct  296  LNLGGHDLTEAIVAHCQRRRPTPSPRFCVSSASASTPADTSESQLHGMRQIRHASEVAKK  355

Query  247  TLSSSAQAYIEIDSLFDGIDFNS-TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  305
             LS+S  A + ID   D   F    +TRA FE +C +++++  E + ++L+++  +K  +
Sbjct  356  LLSTSTNAVVGID-FPDPSAFGYYNVTRACFEALCEEHWQRIRELMNQLLQESLATKEGI  414

Query  306  HEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYG----ATVQAAILSGNds--  359
              +VL+GGS  IP+VQ L+ + F          P   V Y     ++ + A L G  S  
Sbjct  415  DAIVLLGGSAWIPRVQTLVQESF----------PLHHVLYTPEDVSSARGAALCGGKSRN  464

Query  360  ----seklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLI  415
                      + L DVT L LG+++A G    +I  NT +P  KS  F  YA+ Q  V+ 
Sbjct  465  TQNGISTAPAVELPDVTLLPLGIQSANGTKIVMIPSNTKLPVHKS--FLYYANCQHAVVF  522

Query  416  QVFEGERSMTRDNNL-----------LGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVS  464
             V EG     +  +L           L    +DG       V +ID+TFD+D    + V+
Sbjct  523  HVIEGRVFNIKPGSLSKNPASAALHELASVRVDGRHATTHVVLKIDITFDVDTLDQIIVT  582

Query  465  AVEKSTGKENKITITNDKGRLS  486
            A E+S+G++  + I  D+  LS
Sbjct  583  ATERSSGRKVTVCIDGDETSLS  604

>PHYKE_9011
Length=902

 Score = 180 bits (457),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 119/398 (30%), Positives = 199/398 (50%), Gaps = 55/398 (14%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAAKNQVAMNAHN  69
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAA--TVGVRRPQ  85

Query  70   TVFDA-KRLIGRKFSDPVVQADIK--HWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
            T +   +RL+G K  +P V+A ++  H+P+ +         ++++ + +   +Q EE+ +
Sbjct  86   TAYQQIRRLLGTKLENPQVKALLEEEHFPYNLLQNVTRGGTVSLKHR-DGHIYQAEELVA  144

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MV    R+                              DA  I+G+ VL +INE TAAA+
Sbjct  145  MVFTHARQITDTFAEAAVKDWVVTVPAFFSQAQRQALLDAAEISGVRVLSLINENTAAAL  204

Query  157  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  199
               +    D +   R +L +++G  +  VS+      +             F+  + A D
Sbjct  205  QLAVHASYDPEDKPRRILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWD  264

Query  200  THLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  259
              LGG  FD RL +H   EF  K  +D+ +  R + ++R   ++ K  LS++ +  + + 
Sbjct  265  ESLGGARFDLRLAEHLATEFSEKIGEDVRKVPRPMAKIRAQAKKTKMVLSANEEIPVVMQ  324

Query  260  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  319
            SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ LVGG  R+PK
Sbjct  325  SLYNDIDFFTSMTRSKLEELSADLFERTLKPVEVALEKAGLTVADIDEIELVGGGVRMPK  384

Query  320  VQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  357
            +QQ L++FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  385  IQQQLAEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

 Score = 33.5 bits (75),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 12/86 (14%)

Query  492  RMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLN---DEKMKEKIPEADKKAVDDK  548
            RM+ E EK  ++ +AN   +EAKN+LE + Y   ++L+    E  K  +PE   +++  K
Sbjct  648  RMLKEMEKADNKRKAN---LEAKNSLETFIYKAHDALSAQESEIKKVTVPE-QVESLQTK  703

Query  549  VTEVIQWL--DANQSLEKDAYESKQK  572
            + E  +WL  D +++   DA E K+K
Sbjct  704  LEETEEWLYEDGDKA---DAAEYKKK  726

>HYAP_04460
Length=818

 Score = 177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 120/393 (31%), Positives = 192/393 (49%), Gaps = 48/393 (12%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSMARMHYKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +++   F     +     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFKHPEVQQELQQLAFTCVELSSGDVGIVLTYNDEPVTFSCEQVVAMILN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IAGLN LR++NE TA A+AYG
Sbjct  124  KMQHIAAAANEGVTPAYCVLSCPGYYTDVQRQALLNASKIAGLNCLRLMNEHTAIALAYG  183

Query  160  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  212
            + K           ++V+  D+G  ++ V++++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDVGHASYTVAVVAFVQGRLTVKSVAFDRFLGGRDFDLAIA  243

Query  213  DHFTQEFKRKHR--KDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  268
                 +F  K++    +  N +A  +L +ACE+AK+ LS    +   + I+ L +  D+N
Sbjct  244  KDAAAKFADKYKVANPLENNPKARMKLLSACEKAKKNLSPYGVSATQLNIECLAEDRDYN  303

Query  269  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  328
            + +T   FE +      +   PVE+ L DA L  + +  V +VGG TR+  V++ L++  
Sbjct  304  AQVTLEEFEALIAPLLERLNGPVEQALADAGLKATDLTNVEIVGGGTRVTSVKRHLAEVL  363

Query  329  N-GKEP-----NKSINPDEAVAYGATVQAAILS  355
               KE      + ++N DE+VA G  +  AILS
Sbjct  364  GLDKEQQNYGLSSTLNADESVARGCALNCAILS  396

>PPTG_13159
Length=197

 Score = 161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 123/227 (54%), Gaps = 46/227 (20%)

Query  131  KMREDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGI  190
            K  +DAG IAGLNV R  +E T A IAYG DKK GE  VL+FDL G TF+ SLL IE GI
Sbjct  11   KATKDAGDIAGLNVPRTFSESTIAVIAYGQDKKDGESKVLVFDLSGRTFNESLLPIEAGI  70

Query  191  FEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSS  250
            FEVKAT  +THLG EDFD                    +   ALR      ER K     
Sbjct  71   FEVKATDRNTHLGDEDFD--------------------KTGGALR------ERVK-----  99

Query  251  SAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  310
            + QAYIE+DSLF GIDFN TI    FE MCG YFRKTM+PVE     A  S S       
Sbjct  100  APQAYIEVDSLFVGIDFNLTIMFTHFEAMCGYYFRKTMDPVESF---ATPSCSSAR----  152

Query  311  VGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  357
                TR P V  L  +   G      I  D AV YGATVQAAILS N
Sbjct  153  ---CTRSPAVGLLQQE---GVHQVDQI--DGAVTYGATVQAAILSRN  191

>CCA21519
Length=929

 Score = 171 bits (433),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 139/554 (25%), Positives = 243/554 (44%), Gaps = 93/554 (17%)

Query  3    QATTSGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  61
            Q        G+D G  Y  V + +  +  EI+ N    R T + VAF   ERL G  A  
Sbjct  32   QCVVHSKVAGLDFGGEYFKVALVKPGKPFEIVTNVHSKRKTETMVAFDGEERLYGADADT  91

Query  62   QVAMNAHNTVFDAKRLIGRKFSDPVVQADI--KHWPFQVTSGAGDKPQITVQFKGE-SKT  118
                  H      +R +G       + + I  +++P+ +++   ++ + ++  K E  K 
Sbjct  92   IGVRRPHTGYAQIRRFLGSSLDQYGIVSLILEEYYPYSLST---NEKRGSIHIKHEDEKH  148

Query  119  FQPEEISSMVLIKMRE------------------------------DAGAIAGLNVLRII  148
            +  EE+ +MV   +R+                              DA  +AGL VL +I
Sbjct  149  YHAEEVVAMVFSHVRQITDVFAETDVKDYVITVPEYYTQAQRQAVLDAAELAGLRVLSLI  208

Query  149  NEPTAAAIAYGLD---KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FE  192
            NE TAAA+   +    +    + V+ ++ G  +  V++  +   +             F+
Sbjct  209  NENTAAALQLCIHTTLEPDTPKRVIFYNQGSTSLQVTIAELFSYVVPVGSSSNKTIIGFK  268

Query  193  VKATAGDTHLGGEDFDNRLVDHFTQEFKRK---HRKDITENQRALRRLRTACERAKRTLS  249
            V + A + HLG    D RL +HF +EF  K   +++D+    + + +LR   ++ K  LS
Sbjct  269  VLSKAWNQHLGSSQIDLRLAEHFAREFNEKVLHNKQDVRSLPKVMAKLRAQAKKTKIVLS  328

Query  250  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  309
            ++ +  + + SL +  D  +T+TR   E++C D F + + PV + L  A L++  +HEV 
Sbjct  329  ANEEIPVVMQSLLEDYDLRTTVTRTLLEELCKDLFDQALGPVHEALEKANLTRQDIHEVE  388

Query  310  LVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdllll  369
            L+GG  R+PKVQ+LL +FFN  E    +N DEA+A GA  +AA LS +     +Q     
Sbjct  389  LIGGGVRVPKVQRLLKEFFNVPELGAHLNGDEAMALGAAFRAANLSNSFRVRPIQMTDTA  448

Query  370  dvtplslglET------------AGGVMTT---LIARNTTVPTKKSQTFSTYADNQPGVL  414
                 +   +                + TT   L AR     T     F T+  +Q   L
Sbjct  449  SYGIGATLADVNAEDGKDSSWTKHAPLFTTAHRLGARKAVSLTHTRDMFCTFRYDQSVAL  508

Query  415  ---IQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVS  464
               + VF            +G++++ GI            G P++ +TF +D++GI++++
Sbjct  509  PEGVSVF------------IGRYSISGIEAFYEQHLEKYLGDPKVTLTFLLDSSGIVSIA  556

Query  465  AVEKSTGKENKITI  478
              E S  +E +I +
Sbjct  557  KAEVSLEEEYQIEV  570

>H310_01493
Length=909

 Score = 170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 120/397 (30%), Positives = 188/397 (47%), Gaps = 57/397 (14%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            G+D G  +  +  V    + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  71   VFDAKRLIGRKFSDPVVQADIK--HWPFQVTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +RL+G   + PVV++ +K  ++P+ +T    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            V    +                               DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSLIDENTAAALQ  205

Query  158  YGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  200
            + L     + G    VL++++G  +  VSL+     I             FEV   A D 
Sbjct  206  HALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVIDFEVLGKAWDD  265

Query  201  HLGGEDFDNRLVDHFTQEFKRKHRK--DITENQRALRRLRTACERAKRTLSSSAQAYIEI  258
             LGG  FD RL D F  EF  K +K  D+ +  RA+ +LR A  + K  LS++ +  + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVLSANEEIPVVV  325

Query  259  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  318
             SL   +DF S+  R  FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSSAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAIEIIGGGVRIP  385

Query  319  KVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILS  355
            K+Q +L  +F  ++    +N DEA+A GA +  A LS
Sbjct  386  KIQSVLKTYFE-RDLGLHLNGDEAMALGAALHGANLS  421

>PHYSO_285382
Length=379

 Score = 162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/354 (33%), Positives = 163/354 (46%), Gaps = 58/354 (16%)

Query  51   SERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKH---WPFQVT-----SGA  102
            +E ++G  A+     +  +T+F+AKR IGR F D V ++++      P++ T       A
Sbjct  22   AEVIVGRKARAHRTTDPTHTIFNAKRFIGRSFDD-VGESEVDSNGVSPYEFTVKPVLDNA  80

Query  103  GDKPQITVQFKGESKTFQPEEISSMVLIKMREDAGA------------------------  138
             D     + F G+     P +I S V+  +R  A                          
Sbjct  81   HDGVCFALGFPGQQDCVTPVQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVDFNARQRD  140

Query  139  -------IAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF  191
                   +AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G  
Sbjct  141  ATVAAFRVAGLEVSRVLEEPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAI  200

Query  192  EVKATAGDTHLGGEDFDNRLVDHFTQEF----------------KRKHRKDITENQRALR  235
             V  T GD HLGGED D  L     +EF                ++    D T+    L 
Sbjct  201  SVLDTLGDNHLGGEDVDALLTAWLVREFEAQIGSRITSRGVEGEEKSLDDDATDPPCTLA  260

Query  236  RLRTACERAKRTLS--SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEK  293
             +R A E  KR L+  ++A A                 +RA+FE++CG    +TM PV  
Sbjct  261  GVRRAAELLKRRLTDATTASATCVWSEGGSKARVEVKASRAQFEELCGPLLERTMIPVRD  320

Query  294  VLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  347
            VL    +   ++  VVLVGGS+RIP V+Q L+  F  + P  +I+PD AVAYGA
Sbjct  321  VLEANNMETEEIDAVVLVGGSSRIPWVRQRLTTMFQDRAPLSTIDPDLAVAYGA  374

>H310_01496
Length=904

 Score = 169 bits (429),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 120/397 (30%), Positives = 187/397 (47%), Gaps = 57/397 (14%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            G+D G  +  +  V    + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  71   VFDAKRLIGRKFSDPVVQADIK--HWPFQVTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +RL+G   + PVV++ +K  ++P+ +T    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            V    +                               DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSLIDENTAAALQ  205

Query  158  YGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  200
            + L     + G    VL++++G  +  VSL+     I             FEV   A D 
Sbjct  206  HALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVIDFEVLGKAWDD  265

Query  201  HLGGEDFDNRLVDHFTQEFKRKHRK--DITENQRALRRLRTACERAKRTLSSSAQAYIEI  258
             LGG  FD RL D F  EF  K +K  D+ +  RA+ +LR A  + K  LS++ +  + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVLSANEEIPVVV  325

Query  259  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  318
             SL   +DF S   R  FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSNAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAIEIIGGGVRIP  385

Query  319  KVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILS  355
            K+Q +L  +F  ++    +N DEA+A GA +  A LS
Sbjct  386  KIQSVLKTYFE-RDLGLHLNGDEAMALGAALHGANLS  421

>PYVX_15061
Length=891

 Score = 168 bits (425),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 117/397 (29%), Positives = 184/397 (46%), Gaps = 54/397 (14%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            G+DLG  +  V  V      EI+ N    R T + VAF   ERL G  A         + 
Sbjct  27   GVDLGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATIGVRRPQSA  86

Query  71   VFDAKRLIGRKFSDPVVQADIK--HWPFQVTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +R +G    DP V A ++    P+++     D  + ++  K   K  F  EE+ +M
Sbjct  87   YAQVRRFLGATLDDPQVVALLEDERLPYELEQ---DLARGSIALKHSDKQLFHAEELVAM  143

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            V    R+                              DA  +AG+ VL +INE TAAA+ 
Sbjct  144  VFSHARQITDAFAEAPVKDWVVTVPVYFSQAQRQALLDAAELAGVRVLSLINENTAAALQ  203

Query  158  YGLD----KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  200
              +      +   + +L ++LG  +  VS+  +   +             F++ ++A D 
Sbjct  204  LAVHASVAPEDKPKRILFYNLGSTSLQVSVAELSAQVVPDGFKKNKTVSTFQMLSSAWDD  263

Query  201  HLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDS  260
             LGG  FD RL DH  +EF  K  +D+    R + ++R   ++ K  LS++ Q  + + S
Sbjct  264  SLGGAKFDLRLADHLAKEFSDKIGEDVRTLARPMAKIRAQAKKTKIVLSANEQIPVVMQS  323

Query  261  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  320
            L+  +DF +++TR   E++C D F + + PV   L  A LS   + E+ LVGG  R+PK+
Sbjct  324  LYKDVDFFTSMTRGDLENLCEDLFPRALAPVAAALEKAGLSVDDIDEIELVGGGVRMPKI  383

Query  321  QQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  357
            QQ L D+F GK+    +N DEA+A GA  +AA LS +
Sbjct  384  QQQLKDYFGGKDLGVHLNGDEAMALGAAFRAANLSNS  420

>PYIR_25979
Length=438

 Score = 162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 116/400 (29%), Positives = 189/400 (47%), Gaps = 83/400 (21%)

Query  9    YSVGIDLGTTYSCVGVWQNDRVEIIANDQ-------GNRTTPSYVAFTDSERLIGDAAKN  61
            +SVGIDLGT      + ++  V  ++ D+        N   PS+V+ TDS  L+G  A+ 
Sbjct  34   WSVGIDLGTQVCSAALIRDGIVIDVSFDEEQQQDSSPNLLLPSFVSATDSGFLVGADARR  93

Query  62   QVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGES-----  116
            +      +TVFD  RL+GRK  D   Q  +  WPF+V  G  DK  I +           
Sbjct  94   RARSGDPSTVFDFVRLVGRKIEDLSSQDILCKWPFKVVPGENDKAMIEISAIDTKDSAST  153

Query  117  ------KTFQPEEISSMVLIKMREDAGA------------------------------IA  140
                  +TF PEE+ + +++K+++ A A                              IA
Sbjct  154  STSDVIRTFHPEELVAALIMKIKQKAEALVSAKVESTVVCVPGGFNHSQRRAVRNACVIA  213

Query  141  GLNVLRIINEPTAAAIAYGLDKKGG-------ERNVLIFDLGGGTFDVSLLSIEEGIFEV  193
            GL V +I++  TAA  ++G+ ++          + VL  D+G  + D+SL+S+    FEV
Sbjct  214  GLRVEKILSAATAAVTSFGMKEQNAGTAAGIPTQVVLAVDVGASSTDISLVSVLANKFEV  273

Query  194  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITEN--------------QRALRRLRT  239
            KA   +  LGG+DF  R+V H  ++  R+      E                +   ++R 
Sbjct  274  KAVDSNLDLGGDDFTERIVTHCRRKKSREEAAAAPEPGDTVKTASSQTHGYSKGASQIRQ  333

Query  240  ACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVE  292
            ACE AK+ LSSS  A +       GIDF +       T+TR  FE +C D ++  +E V 
Sbjct  334  ACELAKKLLSSSENAVV-------GIDFPASDTFGYYTVTRFCFEALCEDLWQSLVEKVH  386

Query  293  KVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  332
            +V+ ++ + K  ++ V+L+GGS++IP++Q L  + F  ++
Sbjct  387  RVIHESSVVKEDINAVLLMGGSSQIPRLQTLFKESFPSQQ  426

>PYIR_18381
Length=747

 Score = 167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/393 (29%), Positives = 185/393 (47%), Gaps = 73/393 (19%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
              D KRLIGRKF  P VQ +I    ++          I +++  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEISQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  131  KMREDAGA-------------------------------IAGLNVLRIINEPTAAAIAYG  159
            KM+  A A                               IA LN LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDNVSPAYAVVSVPGYYTDVQRRALLNAAKIANLNCLRLINEHTAIALAYG  183

Query  160  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  210
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYA  241

Query  211  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  268
            L     + F+ K++ D   + ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKNFQDKYKIDPLADAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  269  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  328
            S +T  +F+++           +E +L+             +VGG TR+  V++ LS+  
Sbjct  302  SQVTLEQFDEL-----------IEPLLQQ------------IVGGGTRVSSVKRRLSEIL  338

Query  329  NGKEP------NKSINPDEAVAYGATVQAAILS  355
               +       + ++N DE+VA G  +Q AI S
Sbjct  339  GLDKDAQNFGLSTTLNADESVARGCALQCAISS  371

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 23/172 (13%)

Query  431  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------KSTGKENKI  476
            +GKF + GIP + +G  +P+I V    D NG+ +VS+ +               GKE + 
Sbjct  469  IGKFTVSGIPELEKGAELPKIRVNVQQDVNGLFSVSSSQLMQEIKEEEKPAAEEGKEGEA  528

Query  477  TITND-----KGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENYAYSLRNSLNDE  531
               +      K R  + D+ ++ +E  K   +D   ++    +N LE++ Y +RN ++D 
Sbjct  529  KADDKPAEPKKKRFRKVDL-KIHAEELKMAHQDRIIEETFNKRNELESFVYEMRNQVSD-  586

Query  532  KMKEKIPEADKKAVDDKVTEVIQWLDANQSLE--KDAYESKQKELEGVANPV  581
            K+ E I +A+K A++DK+ EV  WL +++  +  K  Y++K  E+    +P+
Sbjct  587  KLAEFITDAEKAAIEDKLNEVEDWLYSDEGFDSTKSVYQNKLDEMRENTSPI  638

>PHYKE_7077
Length=631

 Score = 165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 154/470 (33%), Positives = 233/470 (50%), Gaps = 53/470 (11%)

Query  10   SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDSERLI--GDAAKN-Q  62
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  + + +  G+AA   +
Sbjct  155  CLGIDLGTTNSCVGMWHVERNHVKILKNKEDRG-RTTPSVVRFDPTSQSVKTGNAAVALE  213

Query  63   VAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGE-SKTFQP  121
             +    NTV   KRL+G+KF    V     +  ++V         I V+  G+ +   QP
Sbjct  214  TSEPVENTVRSVKRLMGQKFESKAVDVARMYATYKVAPTIHGNVAIQVERGGKKAVVIQP  273

Query  122  EEISSMVLIKMREDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDV  181
            EE+S+                    ++ E  A+A AY  D K    NV+I       F  
Sbjct  274  EEVSAC-------------------VLAELKASAEAYFEDGKTRLDNVVI--TVPAYFSD  312

Query  182  SLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTAC  241
            S         + KAT     + G     RL++  T               + +       
Sbjct  313  S---------QRKATITSASMAGFK-AIRLLNEPTA--AAMAYGLFLSGTKLVTVFDFGG  360

Query  242  ERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLS  301
            E+AK  LSS     I ++ +     F   + R +FE +C   ++K +  V  VL++A + 
Sbjct  361  EKAKILLSSEEFTDITVNDIAGIPTFTYKLMRRKFEQLCDPIWKKCLRIVTSVLKEADVE  420

Query  302  KSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsse  361
             + + EV+LVGGSTRIP ++  +S+ F GKE   S+N DE V  GA +QAAILSG     
Sbjct  421  HADIDEVILVGGSTRIPILRTKVSEVFQGKELCMSVNADEVVCEGAAIQAAILSG-MDQR  479

Query  362  klqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGE  421
              +D+L++DV PL +GLETA G M  ++ RN  +PT  ++ F T+ D+Q G+ ++V+EGE
Sbjct  480  VFRDVLMMDVLPLPIGLETADGTMEVILPRNARIPTTVTKHFQTFEDDQRGLTVEVYEGE  539

Query  422  RSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDIDANGILNVSA  465
              + ++N+ +  FN      +PR      G     VTF ++A+GIL V A
Sbjct  540  NEIAKENDHISYFNF----ALPRDKIGKAGEFAHPVTFTMNASGILQVQA  585

>PYIR_24220
Length=908

 Score = 167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 119/397 (30%), Positives = 201/397 (51%), Gaps = 55/397 (14%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAAKNQVAMNAHN  69
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G DAA   VA+    
Sbjct  31   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVAVRRPQ  88

Query  70   TVFDA-KRLIGRKFSDPVVQADIK--HWPFQVTSGAGDKPQITVQFKGESKTFQPEEISS  126
            T +   +R +G     P V + ++  ++P+ +   A  +  I+++   + K F  EE+ +
Sbjct  89   TAYSQIRRFLGATPDHPQVVSLLQEEYFPYTLLQNAT-RGTISLEHDNK-KVFHAEELVA  146

Query  127  MVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAI  156
            MV    R+                              DA  I+G+ VL +INE TAAA+
Sbjct  147  MVFSHARQITDAFAEAPVKDWVITVPSFFSQAQRQAMLDAAEISGVRVLSLINENTAAAL  206

Query  157  AYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHL  202
             + +     E R +L +++G  +  VS+   +  +             F+V A A D +L
Sbjct  207  QHAVHSTFTEPRKILFYNMGSTSLQVSITEFKSEVVPDGFKKNKTVSGFQVLANAWDENL  266

Query  203  GGEDFDNRLVDHFTQEFKRK--HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDS  260
            GG  FD +L +H  +EF +K  + +DI    R L ++R   ++ K  LS++ +  + + S
Sbjct  267  GGAKFDLQLAEHLAKEFNKKLGNGEDIRTIPRPLAKIRAQAKKTKIVLSANEEIPVVMQS  326

Query  261  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  320
            L+  +DF +++TR++FE++  D F +++EPV++ L  A LS S + E+ +VGG  R+PK+
Sbjct  327  LYKDMDFFTSMTRSKFEEINADLFARSLEPVKQALAKAGLSASDIDEIEIVGGGVRMPKI  386

Query  321  QQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  357
            Q  L +FF+GK+    +N DEA+A G+  +AA LS +
Sbjct  387  QAQLKEFFSGKDLGVHLNGDEAMALGSAFRAANLSNS  423

>PHYSO_339667
Length=160

 Score = 152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 0/126 (0%)

Query  11   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            VGIDLGTT S  GVW+N+ VEII N  G  +TPSYVAFTD+  L G+AAK Q   NA NT
Sbjct  8    VGIDLGTTCSRDGVWRNEDVEIIPNGDGAYSTPSYVAFTDTALLTGNAAKRQPTRNAENT  67

Query  71   VFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  130
            VF+  +LIGRKFSDP +Q  I++WPF+V  G  D  Q+ VQ+KGE+K FQP EI +++L 
Sbjct  68   VFNIHQLIGRKFSDPALQLSIRYWPFKVECGPKDTAQVVVQYKGETKRFQPIEIVAILLC  127

Query  131  KMREDA  136
            +MR+ A
Sbjct  128  EMRKMA  133

>PHYSO_249902
Length=130

 Score = 150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 89/122 (73%), Gaps = 0/122 (0%)

Query  12   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTV  71
            GIDLG+ YS V VW NDRVEI+ +  G+R TP+ VAFT++E LIG+ A +Q+  NA NT+
Sbjct  9    GIDLGSKYSRVAVWLNDRVEIVPSKSGDRFTPTIVAFTETEVLIGEPATHQLLQNAQNTI  68

Query  72   FDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  131
            FD  RLIGRKFSDP +Q  IK WPF+V  G  DKP + V FKG SK+F+  EI +M+L +
Sbjct  69   FDITRLIGRKFSDPEIQEGIKLWPFKVVCGPDDKPLVVVTFKGASKSFEAVEILAMLLSE  128

Query  132  MR  133
            +R
Sbjct  129  LR  130

>HYAP_10418
Length=315

 Score = 155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 126/242 (52%), Gaps = 27/242 (11%)

Query  131  KMREDAGA---IAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIE  187
            K R+D  A    AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL   
Sbjct  71   KQRDDTVASFRAAGLEVSRVLEEPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFAR  130

Query  188  EGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRK--------------HRKDITENQRA  233
             G   V  T GD HLGGED D  L     ++F+ +              H  D  E    
Sbjct  131  NGAITVLDTLGDNHLGGEDLDALLAAWLVKQFEAQLGSPITSRGTDADGHGNDDKELPCT  190

Query  234  LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST--------ITRARFEDMCGDYFR  285
            L  +R A E  KR L+ +  A      ++DG D  +         +TR +FE +CG    
Sbjct  191  LTGVRRAAEFLKRQLTDAPTA--SASCVWDGADSQAVAKTRATVDMTRVQFEVLCGSLLE  248

Query  286  KTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAY  345
            +TM PV KVL    +   ++  VVLVGGS+RIP V++ L+  F G+ P   I+PD AVAY
Sbjct  249  RTMIPVRKVLEANNMESEEIDAVVLVGGSSRIPWVRERLTVMFQGRAPLSDIDPDLAVAY  308

Query  346  GA  347
            GA
Sbjct  309  GA  310

>H310_10060
Length=187

 Score = 151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 119/191 (62%), Gaps = 9/191 (5%)

Query  385  MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR  444
            M+ LI RNT +P KK++ ++T AD Q  V + ++EGER+    NN LG+F + GI    R
Sbjct  1    MSVLIKRNTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKR  60

Query  445  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSED  504
            G PQ++VTF+IDANGILNVSA +K T  + + TI+++ GRLSQ DIDRMV++AEKYK +D
Sbjct  61   GEPQVEVTFEIDANGILNVSAKDKKTHAKAETTISSNGGRLSQEDIDRMVADAEKYKKDD  120

Query  505  EANKQRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEK  564
                ++IEA+N LE + Y         +  E   E    A ++ + E  +WL+ ++    
Sbjct  121  AEVLRKIEARNNLEGFIY---------RALEIAREKGDAAAENTIREAREWLEDHEEATL  171

Query  565  DAYESKQKELE  575
               E K++ LE
Sbjct  172  RELEDKKRSLE  182

>H257_00287
Length=893

 Score = 162 bits (411),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 118/397 (30%), Positives = 186/397 (47%), Gaps = 57/397 (14%)

Query  12   GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            G+D G  +  + + +  +  EI+ N    R T + V+F   ERL G  A N       N 
Sbjct  29   GVDFGGEFFKIALVKPGKSFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQNA  88

Query  71   VFDAKRLIGRKFSDPVVQADIK--HWPFQVTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +RL+G   + P+V++  K  ++P+ +T    ++ + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPLVESMTKSEYFPYTLTH---NETRGSVGLKHDDEHTFHAEELVAM  145

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            V    +                               DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAEGPVRDWVVTVPSYFAEAQRQAVIDAAEIAGIRVLSLIDENTAAALH  205

Query  158  YGLD----KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  200
            + L     + G    V+ +++G  +  VS++     I             FEV   + D 
Sbjct  206  HALSIDVPEVGKPTRVMFYNMGSTSLQVSVVEYTSRIVPDGFKKNKTIVDFEVLGKSWDE  265

Query  201  HLGGEDFDNRLVDHFTQEFKRKHRK--DITENQRALRRLRTACERAKRTLSSSAQAYIEI  258
             LGG  FD RL D F  EF  K +K  DI    RA+ +LR A  + K  LS++    + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDIRLVPRAMAKLRAAARKTKIVLSANEVIPVVV  325

Query  259  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  318
             SL   +DF S   R+ FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSNAKRSEFEALCADLFGRVLGPVESVLQKTGLAKTDLSAIEIIGGGVRIP  385

Query  319  KVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILS  355
            K+Q LL  +F  ++    +N DEA+A GA    A LS
Sbjct  386  KIQSLLKGYFE-RDLGLHLNGDEAMALGAAFHGANLS  421

>CCI11769
Length=372

 Score = 155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 107/361 (30%), Positives = 163/361 (45%), Gaps = 68/361 (19%)

Query  52   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQV---------TSGA  102
            E L+G  A+     + H+T+++AKR IGR +++ +  A  K + F +         TS +
Sbjct  10   EILVGRQARAYRTKDPHHTIYNAKRFIGRSYNESIQAA--KPYGFSIEPIRNESATTSES  67

Query  103  GDKPQITVQFKGESKTFQPEEISSMVLIKMREDAGAI-----------------------  139
               P  ++   G      P +I S+++  +   A                          
Sbjct  68   LPGPCFSLNVSGHPSCVSPIDIGSLIIRHLHSMAREFVKHNQLDRVVIAVPVDFKAAQRR  127

Query  140  --------AGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF  191
                    AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G  
Sbjct  128  ATVQAYEKAGLKVARVLEEPTAAAIAYGLHQTPNVNFILVFDFGGGTLDVSLLFVRSGSI  187

Query  192  EVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRR---------------  236
             V  T GD +LGGED DN + +H   + +      + E+   +                 
Sbjct  188  SVVDTLGDNNLGGEDLDNLVSNHLISQLEALIGMKLAESSSEVMETDSEKTEDPDQLPCT  247

Query  237  ---LRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRK  286
               +R A E  KR LS +  A         G    +       +++R  FE +C     +
Sbjct  248  IAGIRRAAEILKRKLSYTHTAIASCIVQEPGGKLIAQDNRVEISMSRDEFETLCESILER  307

Query  287  TMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYG  346
             + PV ++LRD  +  + + EVVLVGGS+RIP +   L + F GK+P  +I+PD AVA+G
Sbjct  308  VLLPVRQILRDNNMDPNSIDEVVLVGGSSRIPWIHTQLEELF-GKQPRITIDPDVAVAFG  366

Query  347  A  347
            A
Sbjct  367  A  367

>SDRG_01828
Length=866

 Score = 162 bits (410),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 136/558 (24%), Positives = 243/558 (44%), Gaps = 91/558 (16%)

Query  5    TTSGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63
            T S    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N  
Sbjct  17   TVSASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIE  76

Query  64   AMNAHNTVFDAKRLIGRKFSDPVVQA--DIKHWPFQVTSGAGDKPQITVQFKGESKTFQP  121
                       +R +G     P+V +  + +++P+ +T     +  + +Q   E  TF  
Sbjct  77   VRRPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSE-HTFHA  134

Query  122  EEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINEP  151
            EE+++MV    ++                              DA  IAG+ VL +I+E 
Sbjct  135  EELAAMVFGHAKQITNDFAEAPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDEN  194

Query  152  TAAAIAYGLDKKGGERN----VLIFDLGGGTFDVSLLSIEEGI-------------FEVK  194
            TAAA+ + +D +  E N    ++++++G  +  VS++  +  +             F+V 
Sbjct  195  TAAALHHAVDYEAAEPNTPERIMLYNMGSTSLQVSIVEYKTRVVPDGFKKNKTIVEFDVL  254

Query  195  ATAGDTHLGGEDFDNRLVDHFTQEF--KRKHRKDITENQRALRRLRTACERAKRTLSSSA  252
            A A D  LGG  FD RL + F  EF  K K+  D+ +  RA+ +LR A  + K  LS++ 
Sbjct  255  AKAWDETLGGAQFDLRLAEKFANEFNAKLKNGDDVRKIPRAMAKLRAAARKTKIVLSANE  314

Query  253  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  312
               + + SL   +D+    +R   E++  D F + +EPV+  L  A L+   +  V ++G
Sbjct  315  AIPVIVPSLHADLDYKGHASRTELEEIAADLFARVLEPVKSALDQAGLTVGDLSAVEIIG  374

Query  313  GSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvt  372
            G  RIPK+Q LL +F   ++  K +N DEA+A GA   AA LS +     +    +    
Sbjct  375  GGVRIPKIQALLQEFVQ-RDLGKRLNGDEAMALGAAFNAANLSTSFRVRHVGMTDISSFP  433

Query  373  plslglETAGGVM-------------TTLIARNTTVPTKKSQTFS-------TYADNQPG  412
                 ++ A                   L      +  KKS +FS       T+  ++P 
Sbjct  434  IGVRLVDLASHAADDDHPEAKHWVKRAALFGERQKLNVKKSVSFSHADDVSCTFRYDKPS  493

Query  413  VLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSA  465
             L Q           ++++ ++N+ GI    +       G P++ ++F++DA+G+ ++  
Sbjct  494  ALPQGV---------SSIISRYNITGIAAFAKKMEDKKLGEPKVTLSFNLDASGLASIVK  544

Query  466  VEKSTGKENKITITNDKG  483
             E +  +E ++     K 
Sbjct  545  AEATLDEEIEVPAPTKKA  562

>PYU1_G003764
Length=910

 Score = 162 bits (410),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 114/396 (29%), Positives = 193/396 (49%), Gaps = 53/396 (13%)

Query  12   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAHNT  70
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  31   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVSVRRPQTA  90

Query  71   VFDAKRLIGRKFSDPVVQADIK--HWPFQVTSGAGDKPQITVQFKGESK-TFQPEEISSM  127
                +R +G     P V + ++  ++P+ +     ++ + T+  + ++K  F  EE+ +M
Sbjct  91   YSQIRRFLGATPDSPEVVSLLQEEYFPYTLLK---NETRGTISLEHDNKQVFHAEELVAM  147

Query  128  VLIKMRE------------------------------DAGAIAGLNVLRIINEPTAAAIA  157
            V    R+                              DA  I+G+ VL +INE TAAA+ 
Sbjct  148  VFSHARQITDAFAEAPVKDWVITVPTFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQ  207

Query  158  YGLDKKGGE-RNVLIFDLGGGTFDVSLLS-----IEEGI--------FEVKATAGDTHLG  203
            + +     E R +L +++G  +  VS+       I +G         F++ A A D  LG
Sbjct  208  HAVHSTFTEPRRILFYNMGSTSLQVSIAEFNSEVIPDGFKKNKTVSAFQMIANAWDETLG  267

Query  204  GEDFDNRLVDHFTQEFKRK--HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  261
            G  FD +L +H   EF +K    +D+    R L ++R   ++ K  LS++ +  + + SL
Sbjct  268  GAKFDLQLAEHLALEFNKKLGGDEDVRTLPRPLAKIRAQAKKTKIVLSANEEIPVVMQSL  327

Query  262  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  321
            +  IDF +T+TR++FE++  D F + + PV++VL  A L+ + + E+ ++GG  R+PK+Q
Sbjct  328  YKDIDFFTTMTRSKFEEINADLFARALNPVQQVLNKAGLTVNDIDEIEIIGGGVRMPKIQ  387

Query  322  QLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  357
            Q L +FFNGK+    +N DEA+A G+  +AA LS +
Sbjct  388  QRLKEFFNGKDLGVHLNGDEAMALGSAFRAANLSNS  423

 Score = 34.3 bits (77),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (55%), Gaps = 3/82 (4%)

Query  504  DEANKQRIEAKNALENYAYSLRNSLNDEK-MKEKIPEADK-KAVDDKVTEVIQWL-DANQ  560
            D   K  +EAKN LE Y Y+ R++LN +    E++ + ++ + +  K+ E  +WL D  +
Sbjct  664  DNQRKANLEAKNRLETYVYNARDTLNAKADAIEQVTQPEQLEQLQTKLEETEEWLYDDGE  723

Query  561  SLEKDAYESKQKELEGVANPVL  582
             +E   Y  K K+L+   + +L
Sbjct  724  KVEAAEYNKKIKDLDKDLSAIL  745

 Score = 33.5 bits (75),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 15/49 (31%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query  428  NNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAVEKS  469
            N  +GKFN+ GI            G P++ ++F++D+NGI  ++  E +
Sbjct  513  NAHIGKFNITGIKAFAESMKDKNLGEPKVTLSFELDSNGIAKIAKAEAT  561

Lambda      K        H        a         alpha
   0.313    0.131    0.363    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 48678436296

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40