Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_5114151475874474434280.0
PPTG_171291475874574730490.0
PITG_184581475874775029460.0
PHYRA_810981475874175028200.0
PHYSO_3489031475876676227820.0
PHYKE_839514758142075627020.0
PHALS_064761475872675224330.0
HYAP_071041475872168523820.0
PYU1_G0017331475873269416050.0
PYIR_134181475874771015960.0
PYIW_199691475873369915920.0
PYAP_177631475879459914500.0
PYAR_135711475866651413850.0
PYVX_235901475868950611571e-147
CCA22843147585865259076e-112
CCI44111147585765048944e-110
SPRG_06355147587134206564e-74
SDRG_01763147587364206331e-70
SDRG_045751382110032281784e-12
H310_082921382110073531695e-11
SPRG_126211382110033601687e-11
H257_117731382110263531632e-10
PYVX_215131382114463561571e-09
SDRG_079831335559912261562e-09
SPRG_1903013355510001731552e-09
PYIR_141071382111764161491e-08
H257_0193413355510222461472e-08
PYAP_222301382111164251472e-08
PYAR_14788138217953571354e-07
PHYSO_4705331382110843501185e-05
PITG_172501382110461931151e-04
PYIW_157171382111211471132e-04
PPTG_113651382111061991097e-04
PHYKE_92807031100898811.3
PITG_0658055211214104782.9
PYIR_233601252822772745.2
PYVX_217761252820340736.0
PHYSO_49828612293936244756.2
PHYSO_5453781252822443736.4
PPTG_0254318659137393748.6
PHYCA_13237843501284144729.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_511415

Length=744
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_511415                                                          1325       0.0   
PPTG_17129                                                            1179       0.0   
PITG_18458                                                            1139       0.0   
PHYRA_81098                                                           1090       0.0   
PHYSO_348903                                                          1076       0.0   
PHYKE_8395                                                            1045       0.0   
PHALS_06476                                                           941        0.0   
HYAP_07104                                                            922        0.0   
PYU1_G001733                                                          622        0.0   
PYIR_13418                                                            619        0.0   
PYIW_19969                                                            617        0.0   
PYAP_17763                                                            563        0.0   
PYAR_13571                                                            538        0.0   
PYVX_23590                                                            450        1e-147
CCA22843                                                              353        6e-112
CCI44111                                                              348        4e-110
SPRG_06355                                                            257        4e-74 
SDRG_01763                                                            248        1e-70 
SDRG_04575                                                            73.2       4e-12 
H310_08292                                                            69.7       5e-11 
SPRG_12621                                                            69.3       7e-11 
H257_11773                                                            67.4       2e-10 
PYVX_21513                                                            65.1       1e-09 
SDRG_07983                                                            64.7       2e-09 
SPRG_19030                                                            64.3       2e-09 
PYIR_14107                                                            62.0       1e-08 
H257_01934                                                            61.2       2e-08 
PYAP_22230                                                            61.2       2e-08 
PYAR_14788                                                            56.6       4e-07 
PHYSO_470533                                                          50.1       5e-05 
PITG_17250                                                            48.9       1e-04 
PYIW_15717                                                            48.1       2e-04 
PPTG_11365                                                            46.6       7e-04 
PHYKE_9280                                                            35.8       1.3   
PITG_06580                                                            34.7       2.9   
PYIR_23360                                                            33.1       5.2   
PYVX_21776                                                            32.7       6.0   
PHYSO_498286                                                          33.5       6.2   
PHYSO_545378                                                          32.7       6.4   
PPTG_02543                                                            33.1       8.6   
PHYCA_132378                                                          32.3       9.0   

>PHYCA_511415
Length=744

 Score = 1325 bits (3428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/744 (100%), Positives = 744/744 (100%), Gaps = 0/744 (0%)

Query  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFY  60
            MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFY
Sbjct  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFY  60

Query  61   GRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEavtpsasnvsssfsqfsattpsNYA  120
            GRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQFSATTPSNYA
Sbjct  61   GRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQFSATTPSNYA  120

Query  121  ASTPGNVGNNTYHGFSSALNTAGTSRVISEDFelerlrsevlevkeevkAIRREVMNELH  180
            ASTPGNVGNNTYHGFSSALNTAGTSRVISEDFELERLRSEVLEVKEEVKAIRREVMNELH
Sbjct  121  ASTPGNVGNNTYHGFSSALNTAGTSRVISEDFELERLRSEVLEVKEEVKAIRREVMNELH  180

Query  181  VTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdplsAEERAALTRQTSTKTSAA  240
            VTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDPLSAEERAALTRQTSTKTSAA
Sbjct  181  VTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDPLSAEERAALTRQTSTKTSAA  240

Query  241  TRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLA  300
            TRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLA
Sbjct  241  TRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLA  300

Query  301  AHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLL  360
            AHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLL
Sbjct  301  AHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLL  360

Query  361  AAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLV  420
            AAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLV
Sbjct  361  AAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLV  420

Query  421  DPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKL  480
            DPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKL
Sbjct  421  DPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKL  480

Query  481  AKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFT  540
            AKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFT
Sbjct  481  AKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFT  540

Query  541  KQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  600
            KQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV
Sbjct  541  KQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  600

Query  601  VGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPA  660
            VGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPA
Sbjct  601  VGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPA  660

Query  661  RSEEQFYFSIDDALHALRKMRRNvsssghshsgsssdssathhtssrassrvtassKSQQ  720
            RSEEQFYFSIDDALHALRKMRRNVSSSGHSHSGSSSDSSATHHTSSRASSRVTASSKSQQ
Sbjct  661  RSEEQFYFSIDDALHALRKMRRNVSSSGHSHSGSSSDSSATHHTSSRASSRVTASSKSQQ  720

Query  721  RSHTRHEPRTNPGKPVGILKRGKL  744
            RSHTRHEPRTNPGKPVGILKRGKL
Sbjct  721  RSHTRHEPRTNPGKPVGILKRGKL  744

>PPTG_17129
Length=745

 Score = 1179 bits (3049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/747 (86%), Positives = 678/747 (91%), Gaps = 9/747 (1%)

Query  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQ-QQDDAVRFDRSTTLADTVNVTDDVEEMF  59
            M+R+KNKLRSSRLHKKEGAWALDEDSLRLKQ Q DD VRFDRSTTLADTVNVTDDVEEMF
Sbjct  5    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  64

Query  60   YGRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEavtpsasnvsssfsqfsattpsNY  119
            YGR+T  S T+S+MPQYRTTEQIR NN+TLSALHE+    + SNVSSSFSQFS TTPSNY
Sbjct  65   YGRST--SNTSSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPSNY  122

Query  120  AASTPGNVGNNTYHGFSSALNTAGTSRVISEDFelerlrsevlevkeevkAIRREVMNEL  179
            AASTPGN  ++TYHGF++  +T GTSR +S DFELERLRSEVLEVKEEVKAIRREVMNEL
Sbjct  123  AASTPGNF-SSTYHGFNTVHSTTGTSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNEL  181

Query  180  HVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdp-lsAEERAALTRQTSTKTS  238
            HVTRYDVLKEL LLKGAIAQLTA QHS+P   S+  SSS   LSAEERAALTRQTSTKTS
Sbjct  182  HVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSDPLSAEERAALTRQTSTKTS  241

Query  239  AATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSD  298
             ATRDRLAASR N+HKTPPPAARASVRLTQLAPVADNALSTPLS QQINEMFPLIDFTS+
Sbjct  242  QATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSE  301

Query  299  LAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGN  358
            LAAHARGLTPG+RTWALTRVEEWLDARFNVG DTLLAVVGEGGTGKSAF GTVAQQFRGN
Sbjct  302  LAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGN  361

Query  359  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKV  418
            LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLP FKNQLARLNLKYVLEEADP LLAGKV
Sbjct  362  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKV  421

Query  419  LVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSS  478
            LVDPLNAMEEP+HATFMLVDGIDQC+AG NGRNELL+FFAQVIPQLPSW+GFL+SSKPSS
Sbjct  422  LVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSS  481

Query  479  KLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLE  538
            KLAKRLPVSSVLDFSAKNGAFVADVSS+VDDIARNFSDDD AEAKKVLK KSGGNFAYLE
Sbjct  482  KLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLE  541

Query  539  FTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  598
            FTKQALSHPGM A SKEGAVPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ
Sbjct  542  FTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  601

Query  599  LVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSD  658
            L+VGAA+GPYSP+TEEQAKEHFK TAEDLRMLRRSFVDLVAVKHG+YRIESSALCAWLSD
Sbjct  602  LIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSD  661

Query  659  PARSEEQFYFSIDDALHALRKMRRNvsssghshsgsssdssathhtssrassrvtassKS  718
            PARSEEQFYFSIDDAL ALRKMRR    S    S   S SS+    + RASSRV  SSK+
Sbjct  662  PARSEEQFYFSIDDALQALRKMRR---VSSSGSSSGHSGSSSDGKATHRASSRVKTSSKT  718

Query  719  QQRSHTRHEPRTNPG-KPVGILKRGKL  744
             QR+HTRHEPR NP  KPVGILKR KL
Sbjct  719  HQRAHTRHEPRANPDFKPVGILKRNKL  745

>PITG_18458
Length=747

 Score = 1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/750 (85%), Positives = 681/750 (91%), Gaps = 9/750 (1%)

Query  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQ-QQDDAVRFDRSTTLADTVNVTDDVEEMF  59
            M+R+KNKLRSSRLHKKEGAWALDEDSLRLKQ Q DD VRFDRSTTLADTVNVTDDVEEMF
Sbjct  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60

Query  60   YGRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEavtpsasnvsssfsqfsattpsNY  119
            YGR+T  S T+S+MPQYRTTEQ+RGNN+TLSALHE+    + SNVSSSFSQFSATTPSNY
Sbjct  61   YGRST--SNTSSDMPQYRTTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFSATTPSNY  118

Query  120  AASTPGNVGNNTYHGFSSALNTAGTSRVISEDFelerlrsevlevkeevkAIRREVMNEL  179
            AASTPG    +T+ G ++A  T G SR +S DFELERLRSEVLEVKEEVKAIRREVMNEL
Sbjct  119  AASTPGKF-TSTHQGLNTAQTTTGMSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNEL  177

Query  180  HVTRYDVLKELTLLKGAIAQLTAAQHss-psvsstessssdplsAEERAALTRQTSTKTS  238
            HVTRYDVLKEL LLKGAIAQLTA QH +  SVSSTESSSSDPLS +ERAALTRQTSTKTS
Sbjct  178  HVTRYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPDERAALTRQTSTKTS  237

Query  239  AATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSD  298
             ATRDRLAASR N+HKTPPPAARASVRLTQLAPVADNALSTPL+ QQINEMFPLID TS+
Sbjct  238  QATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSE  297

Query  299  LAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGN  358
            LAAHARGLTPG+RTWALTRVEEWLDAR+N+G DTLLAVVGEGGTGKS F GTVAQQFRGN
Sbjct  298  LAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGN  357

Query  359  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKV  418
            LLAAHCCQFDRKSKSSPRNVLLSMVHQLVD+LP FKNQLARLNLKYVLEEADP LLAGKV
Sbjct  358  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKV  417

Query  419  LVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSS  478
            LVDPLNA+EEP+HATF+LVDGIDQC+ G NGRNELL+ FAQVIPQLPSW+GFL+SSKPSS
Sbjct  418  LVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSS  477

Query  479  KLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLE  538
            KLAKRLPVSSVLDFSAKNGAFVAD SSLVDDIARNFSDDDAAEAKKVLK KSGGNFAYLE
Sbjct  478  KLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLE  537

Query  539  FTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  598
            FTKQALSHPG+ A SKEGAVPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ
Sbjct  538  FTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  597

Query  599  LVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSD  658
            LVVGAA+GPYSPVTEEQAKEHF LT EDLRMLRRSFVDLV+VKHGSYRIESSALCAWLSD
Sbjct  598  LVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSD  657

Query  659  PARSEEQFYFSIDDALHALRKMRR---Nvsssghshsgsssdssathhtssrassrvtas  715
            PARSEEQFYFS+DDAL ALRK+RR   + SSSGHS + S   ++   H SSR S+RV  S
Sbjct  658  PARSEEQFYFSVDDALLALRKIRRVGSSSSSSGHSGNSSDGKAAKNGHASSRPSNRVKTS  717

Query  716  sKSQQRSHTRHEPRTNPG-KPVGILKRGKL  744
            SK+ QR+HTR+EPRT+P  KPVGILKR KL
Sbjct  718  SKTHQRAHTRYEPRTSPDYKPVGILKRNKL  747

>PHYRA_81098
Length=741

 Score = 1090 bits (2820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/750 (81%), Positives = 661/750 (88%), Gaps = 19/750 (3%)

Query  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFY  60
            MHRLKNKLR   LHKK+  WALDEDSLRLKQ QDDA+R DRSTTL DTVNVTDDVEEMFY
Sbjct  5    MHRLKNKLR---LHKKDANWALDEDSLRLKQTQDDALRLDRSTTLTDTVNVTDDVEEMFY  61

Query  61   GRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEavtpsasnvsssfsqfsattpsNYA  120
            G    RST  S++PQYRTTEQ+RG ++TLSALHE+A   +AS+  S FS  + +   NYA
Sbjct  62   G---GRSTV-SDVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQFSATTPS---NYA  114

Query  121  ASTPGNVGNN-TYHGFSSALNTAGTSRVISEDFelerlrsevlevkeevkAIRREVMNEL  179
            ASTPG+V N   YH FS+A     T+R IS+ FELERLRSEV+EVKEEVKAIRREVMNEL
Sbjct  115  ASTPGHVPNQGAYHDFSTA---HSTTRAISDAFELERLRSEVVEVKEEVKAIRREVMNEL  171

Query  180  HVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdp--lsAEERAALTRQTSTKT  237
            HVTRYDVLKEL LLKGAIAQL A QH SP+ S + + SS    LSA+ERAALTRQTSTKT
Sbjct  172  HVTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAALTRQTSTKT  231

Query  238  SAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTS  297
            S+ATR+RLAASR N+HKTPPPAARASVRLTQLAPVADNALSTPL+ QQIN+MFPLIDFTS
Sbjct  232  SSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTS  291

Query  298  DLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRG  357
            +LAAHAR LTPGSRTWALTRVEEWLDARFNVG DTLLAVVGEGGTGKSAFLGTVAQQFRG
Sbjct  292  ELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRG  351

Query  358  NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGK  417
            NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVD+LP FKNQLARLNLKYVLEEADP +LAGK
Sbjct  352  NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGK  411

Query  418  VLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPS  477
            VLVDPLNAMEEP+HATFMLVDGIDQCSAGP GRNELL+FFAQVIP LPSW+GF++SSKPS
Sbjct  412  VLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPS  471

Query  478  SKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYL  537
            SKLAKRLPVSSVLDFSAKNGAFV+DVSSLV+D+ARNFSD+DAAEAKKVLK KSGGNFAYL
Sbjct  472  SKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYL  531

Query  538  EFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLL  597
            EFTKQALSHPGM A SKEGAVPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLL
Sbjct  532  EFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLL  591

Query  598  QLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLS  657
            QL+VGAA+GPYS VTEEQAK+HF LTAEDLRMLR SFVDLVAV+HG+YRIESSALC WLS
Sbjct  592  QLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLS  651

Query  658  DPARSEEQFYFSIDDALHALRKMRRNvsssghshsgsssds--sathhtssrassrvtas  715
            DPARSEEQFYF+IDDA+ ALR MRR+VSSS HS+SGSS DS  ++    +S  +S    +
Sbjct  652  DPARSEEQFYFAIDDAIQALRSMRRSVSSSSHSNSGSSDDSPPTSRRGHTSSRASSRVTT  711

Query  716  sKSQQRSHTRHEPR-TNPGKPVGILKRGKL  744
            SKS QR+HTRH+PR T   KPVGILKR KL
Sbjct  712  SKSNQRAHTRHDPRATQEFKPVGILKRNKL  741

>PHYSO_348903
Length=766

 Score = 1076 bits (2782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/762 (78%), Positives = 654/762 (86%), Gaps = 24/762 (3%)

Query  1    MHRLKNKLRSSRL--HKKEGAWALDEDSLRLKQQQDDA-VRFDRSTTLADTVNVTDDVEE  57
            MHR+KNKLRSSRL   KK+ AWALDEDSLRLKQ QDDA VR+DRS TL+DTVNVTDDVE+
Sbjct  6    MHRIKNKLRSSRLGSSKKDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVED  65

Query  58   MFYGRNTNRSTT--ASEMPQYRTTEQIRGNNLTLSALHEEavtpsasnvsssfsqfsatt  115
            MFYGRN NRST   AS++PQYRTTEQ+R  +LTLSALHE+A TPSA+N  SS     + T
Sbjct  66   MFYGRN-NRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVT  124

Query  116  p-sNYAASTPGNVG-----------NNTY-HGFSSALNTAGTSRVISEDFelerlrsevl  162
              SNYAASTPGN             + T+  GFS+   T G++  ++E+ ELERLR+EVL
Sbjct  125  TPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSA--VAEEGELERLRAEVL  182

Query  163  evkeevkAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdp-l  221
            EVKEEVKAIRREVMNELHVTRYDVLKEL LLKGA+AQLTAAQHSSP   S+  SSS   L
Sbjct  183  EVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSLDPL  242

Query  222  sAEERAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPL  281
            SA++RA L RQTSTKTS ATR+RLAASR NV KTPPP ARASVRLTQLAPVAD+ALSTPL
Sbjct  243  SADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPL  302

Query  282  SSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGG  341
            +SQQINEMFPLIDFTS+LAAHARGLTPGSRTWALTRVEEWLD+RFN G+D LLAVVGEGG
Sbjct  303  TSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGG  362

Query  342  TGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLN  401
            TGKSAF GTVAQQFRGN+LAAHCCQFDRKSKS+PRNVLLSMVHQ+VDN P FKNQLARLN
Sbjct  363  TGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLN  422

Query  402  LKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVI  461
            LKYVLEEADP+LLA KVLVDPLNA+EEPV A FM+VDGIDQC+AG  GRNELL+FFAQ+I
Sbjct  423  LKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQII  482

Query  462  PQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAE  521
            PQLP+W+GFL+SSKPSSKLAKRLPVSSVLDFSA+N AFVADV+ LV+DIARNFSDDD  +
Sbjct  483  PQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVK  542

Query  522  AKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDK  581
            AK +LK KSGGNFAYLEFTKQALSHPGM A SKEGAVPLGVL++LPETLYDIYAEIFEDK
Sbjct  543  AKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDK  602

Query  582  FGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVK  641
            FGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQA+EHF LTAEDLRMLRRSFVDLVAV+
Sbjct  603  FGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVR  662

Query  642  HGSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRKMRRNvsssghshsgsssdssat  701
            HGSYRIESSALCAWLSDPARSEEQFYFSIDDAL ALR+MRR+  SSG S   S S S  T
Sbjct  663  HGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRS-GSSGSSSGHSGSSSDGT  721

Query  702  hhtssrassrvtassKSQQRSHTRHEPRTNPG-KPVGILKRG  742
                + + +    ++KS  RSH +HEPR NP  KPVGILKRG
Sbjct  722  TSAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRG  763

>PHYKE_8395
Length=1420

 Score = 1045 bits (2702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/756 (74%), Positives = 633/756 (84%), Gaps = 24/756 (3%)

Query  4     LKNKLRSSRLHKKEGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFYGRN  63
             LKNKLRSS+LHKKEGAWALDEDSLRL +QQ DA RFDR+T + DTVNV+DDVE+MFYGR+
Sbjct  674   LKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVNVSDDVEDMFYGRS  733

Query  64    TNRS--TTASEMPQYRTTEQIRGNNLTLSALHEEavtpsasnvsssfsqfsattpsNYAA  121
             T +S  +  S++P YRTTEQ+RG N TL+ALHEE     +++  S+    S        A
Sbjct  734   TTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPSASHLSNSFASSY-------A  786

Query  122   STPGNVGNN-TYHGFSSALNTAGTSRVISEDFelerlrsevlevkeevkA----IRREVM  176
             STPGN  N  T++GF++  +T G SR ISED       S +    +EVKA    IRREVM
Sbjct  787   STPGNYQNPPTFNGFNTTHST-GLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVM  845

Query  177   NELHVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdplsAEERAALTRQTSTK  236
             NELH+TRYDVLKELTLLKGA+AQL+AAQ ++ SVS + SSSSDPLSAE+RAALTR  S  
Sbjct  846   NELHMTRYDVLKELTLLKGAVAQLSAAQ-TTGSVSPSTSSSSDPLSAEDRAALTRVPSKL  904

Query  237   TSAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFT  296
             TS  T+DRLA SR+N+H  PPPAARASVRLTQLAPVADNALSTPL+ QQINEMFPLIDFT
Sbjct  905   TSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFT  964

Query  297   SDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFR  356
             S+LAAHARGL PG+RTWALTRVEEWLDARFNVG DT+LAVVG+GGTGKSAF GTVAQQFR
Sbjct  965   SELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFR  1024

Query  357   GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAG  416
             GNLLAAHCCQFDRKSKS+PRNVLLS VHQLVDNLP FKNQLARLNLKYVLEE+DP LLA 
Sbjct  1025  GNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAA  1084

Query  417   KVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKP  476
             KV VDPLNA+EEP+HATFMLV+G+DQCSAGPNGRNELL+F +Q+IPQLPSW+GF++SSKP
Sbjct  1085  KVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKP  1144

Query  477   SSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAY  536
              SK AKRLPVSSVLDFSAKNGAFV+DVSSLVDDIARNFSD+D+AEAK+VLK KSGGNFAY
Sbjct  1145  FSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAY  1204

Query  537   LEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPL  596
             LEFTKQALSHPGM   SKEGAVPL VL +LP++L+DIY EIFEDKFGQGRAR+W KAKPL
Sbjct  1205  LEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPL  1264

Query  597   LQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWL  656
             LQL+VGAA+GPYSPVTE QAKEHF  T EDLRMLRRSFVDLV VKHG+YR+ESSALC+WL
Sbjct  1265  LQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWL  1324

Query  657   SDPARSEEQFYFSIDDALHALRKMRRNvsssghshsgsssds-------sathhtssras  709
             SDPARSEEQFY S+DDAL ALRK+RR+ SS  +S    S  S       S T HT SRA+
Sbjct  1325  SDPARSEEQFYLSVDDALTALRKLRRSRSSGSNSDHSHSGSSSSDGSVPSTTSHTPSRAT  1384

Query  710   srvtassKSQQRSHTRHEPRTNPG-KPVGILKRGKL  744
             S   ASSKS QR+HTRHEPR NP  KP+GILKRGK+
Sbjct  1385  SSRAASSKSHQRAHTRHEPRVNPEFKPMGILKRGKM  1420

>PHALS_06476
Length=726

 Score = 941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/752 (70%), Positives = 589/752 (78%), Gaps = 38/752 (5%)

Query  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFY  60
            MH+LKNKLR S L KKE A+ L++DSLR K  QD+ VR DRS TL DTVN+TDDVEEMFY
Sbjct  5    MHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVEEMFY  64

Query  61   GRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEavtpsasnvsssfsqfsattp-sNY  119
                NRST  S +PQYRTTEQIRGNNL L ALHE+  T S ++ +SS     + T  S+Y
Sbjct  65   ----NRSTATSGIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTPSSY  120

Query  120  AASTPGNVGNNTYHGFSSALNTAGTSRVISEDFelerlrsevlevkeevkAIRREVMNEL  179
            AASTPGN     +H FS+  NT  T   IS DF+LERL SEVL++K EVK IRREVMNEL
Sbjct  121  AASTPGNHAG-IHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNEL  179

Query  180  HVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdplsAE--ERAALTRQTSTKT  237
            HVTRYDVLKELTLLKGAIAQL + +  + S S + + SS        ERAALTRQT TKT
Sbjct  180  HVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSSDERAALTRQTPTKT  239

Query  238  SAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTS  297
            S ATRDRLAA R+N +K PP A RAS RLTQLAPVAD+ALSTPL+SQQINE FPLIDFTS
Sbjct  240  SQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTS  299

Query  298  DLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRG  357
            +LAAHAR LTPGSR+WALTR++EWLDARF++G DTLLAVVGEGG+GKSAF GTVAQQFRG
Sbjct  300  ELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRG  359

Query  358  NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGK  417
            NLLAAHCCQFDRKSKS PRNVLLSMVHQLVDNLPLFKNQLARLNL+YVLEE DP LLA K
Sbjct  360  NLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANK  419

Query  418  VLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPS  477
            VL+DPLNA+EEP H+TF+L+DGIDQC+ G NGRNELL+F +Q+I  LPSW+GFL+SSKPS
Sbjct  420  VLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPS  479

Query  478  SKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYL  537
            SKLAK LPVSSVLDFSAKNGAFVAD SSLV+DI++ FSDDDA EAK++L  KSGGNFAYL
Sbjct  480  SKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYL  539

Query  538  EFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLL  597
            EFTKQALSHPGM  TS  G VPL VL ELPETLYDIYAEIFEDKFGQG AR WGKAKPLL
Sbjct  540  EFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLL  599

Query  598  QLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLS  657
            QL+VGAA+GPYS VTEEQAK+   L A+DLRMLRRSFVD+VAVKH               
Sbjct  600  QLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH---------------  644

Query  658  DPARSEEQFYFSIDDALHALRKMRRNvsssghs---hsgsssdssathhtssrassrvta  714
                 EEQFYFSI+DAL ALRKMR N SS   S      S  ++   +   SRA+SR   
Sbjct  645  -----EEQFYFSIEDALLALRKMRLNSSSDSSSGDPGISSDKNAPDHNRRLSRANSRGKL  699

Query  715  ssKSQQRSHTRHEPRTN--PGKPVGILKRGKL  744
             +KSQ     RHEPRTN    KPVGILKRGKL
Sbjct  700  PNKSQ-----RHEPRTNFENYKPVGILKRGKL  726

>HYAP_07104
Length=721

 Score = 922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/685 (71%), Positives = 561/685 (82%), Gaps = 14/685 (2%)

Query  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFY  60
            MHRLKNKLR   LHKK+G W LDEDS+RLKQ QD  VR DRS TL DTVN TDDVEEMFY
Sbjct  1    MHRLKNKLR---LHKKDGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFY  57

Query  61   GRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEavtpsasnvsssfsqfsattpsNYA  120
                 RST     PQYR+TEQ+ G  LTL++L+E+A TPS  + +SS     +    ++A
Sbjct  58   SSTQTRSTNGP--PQYRSTEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFS----DHA  111

Query  121  ASTPGNVGNNTYHGFSSALNTAGTSRVIS-EDFelerlrsevlevkeevkAIRREVMNEL  179
             S       +T+H  +++ +     R +     ELE+LR E++EVK+EV AIR+ V+NEL
Sbjct  112  TSISSVNLTSTHHHLTTSTSMMSHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNEL  171

Query  180  HVTRYDVLKELTLLKGAIAQLTAA--QHsspsvsstessssdplsAEERAALTRQTSTKT  237
            HVTRYDVLKEL LLKGAIAQLT      ++    S + S S+PLS+ +R ALTRQTST T
Sbjct  172  HVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMT  231

Query  238  SAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTS  297
            S+ATRDRLAASR+N +K PPPAARASVRLTQLAPVAD+ALSTPLSS Q+N++FPLIDFT+
Sbjct  232  SSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTT  291

Query  298  DLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRG  357
            +LAAHAR LTPGSRTWALTR EEWL++RF  G D LLAVVGEGG+GKSAF GTVAQQ+RG
Sbjct  292  ELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRG  351

Query  358  NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGK  417
             L+AAHCCQFDRK KSSPRNVLLS+VHQLV NLPLFKNQLARLNLKYVLEEADP+LLA K
Sbjct  352  QLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASK  411

Query  418  VLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPS  477
            VLVDPLNA+E+PV   FMLVDGIDQC+ GP GRNELL+F AQ+IPQLPSW+G ++SSKPS
Sbjct  412  VLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPS  471

Query  478  SKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYL  537
            SKLAKRLPVSSVLDFSAKN AFVADVSSLVD+IA +F  +D  EAK+VLKHKSGGNFAYL
Sbjct  472  SKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYL  531

Query  538  EFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLL  597
            EFTKQALS  GM + SKEG V + VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +L
Sbjct  532  EFTKQALS--GMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVL  589

Query  598  QLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLS  657
            QL +GA +GPYSPVTEEQA+EHF+LT EDLR+LRRSFVDLVAVKHG YRIE+SALCAWL 
Sbjct  590  QLAIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLC  649

Query  658  DPARSEEQFYFSIDDALHALRKMRR  682
            DPAR+EEQFYF+IDDAL ALRKMRR
Sbjct  650  DPARAEEQFYFNIDDALQALRKMRR  674

>PYU1_G001733
Length=732

 Score = 622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/694 (49%), Positives = 452/694 (65%), Gaps = 82/694 (12%)

Query  23   DEDSLRL-KQQQDDAVRFDRSTTL------ADTVNVTDDVEEMFY---------------  60
            DED+LR+ K   +DA R+ R+TT+      + +  ++DDVE+MFY               
Sbjct  32   DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNGGGGITRSTSDYTT  91

Query  61   GRNT---------NRSTTASEMPQYRTTEQIRGNNLTLSALHEEavtpsasnvsssfsqf  111
            GR T         NRST+      YRTTEQ+R  N  L  L+E+ V P+A          
Sbjct  92   GRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTN--LMPLNEDEVLPAAMR--------  141

Query  112  sattpsNYAASTPGNVGNNTYHGFSSALNTAGTSRVISEDFelerlrsevlevkeevkAI  171
                      +T G  G +      + L                      +E+K+E++ I
Sbjct  142  ----------TTTGAAGGSEADALRAEL----------------------VEMKQEMQTI  169

Query  172  RREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdplsAEERAAL--  229
            RRE+MNE+HVTRYDVLKE+T+LKG I QL AA  S    +      ++P      A L  
Sbjct  170  RREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDT  229

Query  230  -TRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINE  288
             TR T+  TS AT+DRLAA    V   P      + RLTQLAPVAD+ALSTPL   QI++
Sbjct  230  ITRTTAVHTSKATKDRLAARE--VTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDD  287

Query  289  MFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFL  348
            MFPL+DF++DL  HA+   P SR WA  R ++W+D+RFNVG D LLA+VG+GG+GKS  +
Sbjct  288  MFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLV  347

Query  349  GTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEE  408
            G +  +F  N++A H C+FDRKSKSSPRNVLLS+V+QL+ NLPLFKNQLARLNLKYVLEE
Sbjct  348  GALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEE  407

Query  409  ADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWI  468
             DP++LA KVLVDPL A+EEP+ A  +LVDGIDQC +    RN+LL F A +IP+ P+W+
Sbjct  408  TDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKS--KDRNDLLDFLAAIIPEFPTWL  465

Query  469  GFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKH  528
            G  ++SKPS +L  +L ++S+LDFS KN  ++ D   L++DI  NFSD D +EA+ +LK 
Sbjct  466  GIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKR  525

Query  529  KSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRAR  588
            KSGGNF +L+FTKQALSHPGM    + G VPL VLH+LPE++Y+IY EIFEDKFG+G  R
Sbjct  526  KSGGNFTFLDFTKQALSHPGM--EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNR  583

Query  589  VWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIE  648
            +W K +PLL L+V AASGPY+ +TEEQA+E F L+ +D+RM+RR+F D++ V+HG+YR+E
Sbjct  584  LWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRME  643

Query  649  SSALCAWLSDPARSEEQFYFSIDDALHALRKMRR  682
            +SA+  WL DP RS EQFY +I  ++  LR++ R
Sbjct  644  TSAMYEWLVDPQRSGEQFYVNISASMDILRRLHR  677

>PYIR_13418
Length=747

 Score = 619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/710 (48%), Positives = 456/710 (64%), Gaps = 96/710 (14%)

Query  21   ALDEDSLRL-KQQQDDAVRFDRSTTL------ADTVNVTDDVEEMFYGRNTN--------  65
            A DE++LR+ K  Q++A RF R+TT+      + +  ++DDVEEMFY  + N        
Sbjct  30   ATDEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEMFYNGSANGNANPSAS  89

Query  66   --------RSTTASE---------------------MPQYRTTEQIRGNNLTLSALHEEa  96
                    RSTT+S                         YRTTEQ+RG N  L  L E+ 
Sbjct  90   ARSTDNFGRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQMRGTN--LMPLQEDE  147

Query  97   vtpsasnvsssfsqfsattpsNYAASTPGNVGNNTYHGFSSALNTAGTSRVISEDFeler  156
            V P+AS  ++               +T  N G N      + L+                
Sbjct  148  VLPAASRATT-------------TMATASN-GGNPIDALRAELS----------------  177

Query  157  lrsevlevkeevkAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstess  216
                  E+K EV+AIRRE+MNE+HVTRYDVLKE+T+LKG I QL  A  S    S   S 
Sbjct  178  ------EMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASG  231

Query  217  ssdplsAE------ERAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQLA  270
            ++    A+      E   ++R T+  TS AT++R    R     + P   RAS RLTQLA
Sbjct  232  AAVGAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLA  287

Query  271  PVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGT  330
            PVAD+ALSTPL   QI+EMFPL++ +++L A A+   P SR WA+ R +EW+D+RFNVG 
Sbjct  288  PVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGV  347

Query  331  DTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNL  390
            D LLA+VG+GG+GKS   G +  +F  N++A H C FDRKSKSSPRNVLLS+V+QL+ NL
Sbjct  348  DNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNL  407

Query  391  PLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGR  450
            PLFKNQLARLNLKYVLEE DP++LA KVLVDPL A+EEP+ A   + DGIDQC +   GR
Sbjct  408  PLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKS--KGR  465

Query  451  NELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDI  510
            N+LL F A +IP+LP+W+G  ++SKPS +L  +L ++S+LDFSAKN  ++ D   L++DI
Sbjct  466  NDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDI  525

Query  511  ARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETL  570
              NFSD D  +A+++LK KSGGNF +L+FTKQALSHPGM      G +PL VLH+LPE++
Sbjct  526  IGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESI  583

Query  571  YDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRML  630
            Y+IY EIFEDKFG+GR+R+W K +PLL+L+V AASGPY+ +TE QA+E F L+ ED+R +
Sbjct  584  YEIYEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTI  643

Query  631  RRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRKM  680
            RR+FVD++AV HG+YRIE+SAL  WL DP R+ EQFY  +   ++ LR++
Sbjct  644  RRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693

>PYIW_19969
Length=733

 Score = 617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/699 (49%), Positives = 456/699 (65%), Gaps = 84/699 (12%)

Query  19   AWALDEDSLRL-KQQQDDAVRFDRSTTLADTVNVT------DDVEEMFY-----------  60
            A A DEDSLR+ K  Q++A RF R+TT+  +   +      DDVE+MFY           
Sbjct  28   ATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDMFYNGGDARSTSSS  87

Query  61   -------GRNTNRSTTASEMPQ------------YRTTEQIRGNNLTLSALHEEavtpsa  101
                   GR+T  ST +++               YRTTEQ+RG    L  L E+ V P  
Sbjct  88   VRSTDTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRGT-ANLIPLQEDEVLP--  144

Query  102  snvsssfsqfsattpsNYAASTPGNVGNNTYHGFSSALNTAGTSRVISEDFelerlrsev  161
                              AAS          +G  S  N+ G S++       + LR+E+
Sbjct  145  ------------------AASRTTTTSQMPTNGNYSNGNSGGGSQL-------DALRTEL  179

Query  162  levkeevkAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdpl  221
             E+K EV+AIRRE+MNE+HVTRYDVLKE+T+LKG I QL  A              +  L
Sbjct  180  SEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTA------------LETKGL  227

Query  222  sAEERAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPL  281
            S +E   ++R T+  TS AT+DR A        + P   RAS RLTQLAPVAD ALSTPL
Sbjct  228  STDEINTISRTTALFTSKATKDRRATRD---ESSSPMLVRASSRLTQLAPVADEALSTPL  284

Query  282  SSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGG  341
               QI+EMFPLI+ + +L A +R     SR WA+ R +EW+D+RFNVG D LLA+VGEGG
Sbjct  285  LQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGG  344

Query  342  TGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLN  401
            +GKS   G ++ +F  N++A H C FDRKSKSSPRNVLLS+V+Q++ NLPLFKNQLARLN
Sbjct  345  SGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLN  404

Query  402  LKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVI  461
            LKYVLEE+DP++LA K+LVDPL A+EEP+ A   ++DG+DQC +   GRN+LL F A +I
Sbjct  405  LKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKS--RGRNDLLDFLAVII  462

Query  462  PQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAE  521
            P+LP+WIG  ++SKPS +L  RL +SS+LDFSAKN  ++ D   +++DI  +FSD D  +
Sbjct  463  PELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQ  522

Query  522  AKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDK  581
            A+++LK KSGGNF +L+FTKQALSHPGM      G +PL VLH+LPE++Y+IY EIFEDK
Sbjct  523  AREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESIYEIYEEIFEDK  580

Query  582  FGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVK  641
            FG+GR R+W K +PLL+L+V AASGPY+ +TE QA+E F L+ ED+R +RRSFVD++ V+
Sbjct  581  FGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVR  640

Query  642  HGSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRKM  680
            HG+YRIE+SAL  WL DP R+ EQFY  +   + ALR++
Sbjct  641  HGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679

>PYAP_17763
Length=794

 Score = 563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/599 (49%), Positives = 407/599 (68%), Gaps = 33/599 (6%)

Query  170  AIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdp---------  220
            AI+RE+MNE+H+TRYDVLKE+T+LKG I QL +    S  V    ++++           
Sbjct  196  AIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTATAAAMGIDVPPQAN  255

Query  221  -lsAEERAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALST  279
             LS EE+ AL+R+T+T  S  T++R+  +R +  + PP     S RLTQLAPV D+ALST
Sbjct  256  ELSPEEKEALSRKTTTVVSKVTKERITTTRED--QIPPVLRSTSSRLTQLAPVDDSALST  313

Query  280  PLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGE  339
            PL  +QI++MFPLIDF++++   +R    GSR W   RV+EWLD+RFNVG D +LA+VG+
Sbjct  314  PLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGD  373

Query  340  GGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLAR  399
             G+GK+    +V  ++   ++A H C+FDRK+KSSPRNVLLS+V+QL  +LP+FK+QLAR
Sbjct  374  AGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLAR  433

Query  400  LNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQ  459
            LNLKYVLEE D   L+ KVL+DPLNA+EEP+   F++ D IDQC  G  G N+L  F + 
Sbjct  434  LNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGV-GYNDLQDFLSA  492

Query  460  VIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDA  519
            +IP+ P W+GFL+SSKPS + A  +PVSSVLDFSA+N  ++ D   L++DIA  F D+D 
Sbjct  493  IIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQ  552

Query  520  AEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFE  579
            AEAK++LK KSGGN++YLEFTKQALS+PGM   S  G VP+ VLH+LP++LY+IY EIFE
Sbjct  553  AEAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS--GFVPVDVLHDLPQSLYEIYEEIFE  610

Query  580  DKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVA  639
            DKFG+GR RVW KA P+LQL+  AASGPY+ +TE+   +    T +++RMLRR+F+D+++
Sbjct  611  DKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIIS  670

Query  640  VKHGSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRKMRR----Nvsssghshsgss  695
            ++HG+Y I SSA+  WL+D  R  EQ++  ++  +  LRK+ R    N+  +  S +   
Sbjct  671  IRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRGEKLNMPGTSSSGTSER  730

Query  696  sdssathhtssrassrvtassKSQQRSHTR--------------HEPRTNPGKPVGILK  740
            S  S +  + S +S+  +  S     +H+               HEP  NP KPVGILK
Sbjct  731  STMSRSGASISTSSTSSSDRSSGGSNNHSTPSTRTSSSSYPAKLHEPNLNPSKPVGILK  789

>PYAR_13571
Length=666

 Score = 538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/514 (51%), Positives = 363/514 (71%), Gaps = 49/514 (10%)

Query  170  AIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHsspsvsstessssdplsAEERAAL  229
            AIRRE+MNE+H +RYDVLKE+T+LKG I QL                            +
Sbjct  120  AIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET-------------------------M  154

Query  230  TRQTSTKTSAATRDRLAASRLNVHKTPPPAARA-SVRLTQLAPVADNALSTPLSSQQINE  288
             R+T+T  S +T++R+  +R ++    PP  RA SVRLTQLAPV D+ALSTPL+ +QI+E
Sbjct  155  ARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQIDE  211

Query  289  MFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFL  348
            +FPL+DF++++   AR    G+R WA  RV+EWLD+RFNVG+D LLA+VG+ GTGK+   
Sbjct  212  LFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT---  268

Query  349  GTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEE  408
                          H C+F+RK KSSPRNVLLS+V+QL   LP FK+QLARLNLKYVLEE
Sbjct  269  --------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEE  314

Query  409  ADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWI  468
             D + LA KVLVDPL ++EEP+ A F+L+DG+DQC    NG N+LL F + V+P+ PSW+
Sbjct  315  TDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPSWL  373

Query  469  GFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKH  528
            GFL+++KPS + A+++PV+S+LDFSAKN A+V D + L+ DI   F  +D A+A ++LK 
Sbjct  374  GFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKT  433

Query  529  KSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRAR  588
            KS GN++YLEFT+QA+S+PGM A   +G+VP+ VLH+LP++LY+IY EIFEDKFG+GR R
Sbjct  434  KSCGNYSYLEFTRQAMSNPGMEA--PQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTR  491

Query  589  VWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIE  648
            +W KA P+LQL+  AASGPY+ +TE+   +      +D+RMLRR+F+D+++++HG+Y I 
Sbjct  492  LWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIV  551

Query  649  SSALCAWLSDPARSEEQFYFSIDDALHALRKMRR  682
            SSAL  WL+DP R  E ++  +   +  LR++ R
Sbjct  552  SSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLR  585

>PYVX_23590
Length=689

 Score = 450 bits (1157),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 327/506 (65%), Gaps = 66/506 (13%)

Query  258  PAARASVRLT-QLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALT  316
            PA RA++ +   LAPV D ALS PL  +Q++E+FPL+D ++D+AA AR   PG+R WA  
Sbjct  231  PADRAAIGVAPTLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATA  290

Query  317  RVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPR  376
            RV+EWLD+RFNVG DTLL VVG  GTGKS F G+V    +GN+LA H C+FDRK+KS+PR
Sbjct  291  RVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPR  350

Query  377  NVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFML  436
             VLLS+V Q+V NLP FK QLARLNLKYVLEE D  +LAGKVL+DPL A EEP+ A  ++
Sbjct  351  VVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLV  410

Query  437  VDGIDQCSAGPNG--RNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSA  494
            +DG+DQC     G  RNELL+F A V+PQLPSW+G L+SSKP+ +LA +L  +S+LDFS 
Sbjct  411  LDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSG  470

Query  495  KNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSK  554
            KN  FV D   LVDDIA NF+D  AAEA+++L+ K+GGNFAYL+FT+QALS PG+     
Sbjct  471  KNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGL----D  526

Query  555  EGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEE  614
            +G + L +LH+LPE+LY+IY EIFED                                  
Sbjct  527  DGELELDMLHDLPESLYEIYLEIFEDN---------------------------------  553

Query  615  QAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFSIDDAL  674
                      +D+R+++RSFVD++AV+ G YRIESSAL  WLSDPARS E F+F  D  +
Sbjct  554  ----------DDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGV  603

Query  675  HALRKMRRNvsssghshsgsssdssathhtssrassrvtas----------------sKS  718
              LR+++++V++     S  +          SR  S  + +                +++
Sbjct  604  DELRRLQQHVAAKAKQQSDEADAQGHERRRMSRRESARSTASNSSSSTSSRSHSPPPART  663

Query  719  QQRSHTRHEPRTNPGKPVGILKRGKL  744
              R  +R+EP  NP KPVGILKRG+L
Sbjct  664  SSRVSSRYEPPANPSKPVGILKRGRL  689

 Score = 43.1 bits (100),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 58/116 (50%), Gaps = 29/116 (25%)

Query  1    MHRLKNKLR----SSRLHK------KEGAWALDEDSLRLKQQ-QDDAVRFDRSTTL-ADT  48
            M +LK KLR    SSR  +       +G    D++SLRL +Q  +DA+RF R TTL + +
Sbjct  1    MTKLKTKLRGGGSSSRRERDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSAS  60

Query  49   VNVTDDVEEMFY---------------GRNTNRSTTAS--EMPQYRTTEQIRGNNL  87
              ++DDVEEMFY                   +RST  S      YRTTEQ+R   L
Sbjct  61   SAMSDDVEEMFYGGGPGGHAGHGGHAGHGGADRSTAGSVRTTDVYRTTEQLRSTGL  116

>CCA22843
Length=586

 Score = 353 bits (907),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 199/525 (38%), Positives = 298/525 (57%), Gaps = 46/525 (9%)

Query  170  AIRREVMNELHVTRYDVLKELTLLKGAIAQL--------------------TAAQHssps  209
            ++R+E++  +  TRYD++KE+  L+G +  +                    T A  ++ S
Sbjct  76   SVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHTTANKTAFS  135

Query  210  vsstessssdplsAEERAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQL  269
             S+ +          ER+ +    S K+   T       RLN   T   +   SV     
Sbjct  136  ESAEDDEIISRFITPERSTIVADCSYKSGFVTE------RLN---TKDSSFSTSV-----  181

Query  270  APVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVG  329
             P+ ++ LS PL   + +EMFP ID  SDL ++A  L  G+R WAL RV+EW+++ F   
Sbjct  182  -PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSE  240

Query  330  TDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDN  389
             D +L ++GEGG+GKS   G + Q+F   L A H CQFDRKS+SS R+V+LS+V Q    
Sbjct  241  NDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASK  300

Query  390  LPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHAT---FMLVDGIDQCSAG  446
             PL+K QL  LNL+Y+L+E++P+++A K+L++PL A+  PV  +   F+L DGIDQC   
Sbjct  301  NPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLV-  357

Query  447  PNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSL  506
             N  N+LL   + +  + PS IGF+++SK S     +    S++    +NG F+ D   L
Sbjct  358  ENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRIL  417

Query  507  VDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHEL  566
            +++   NF      EA  +L  KSGGN  YL+FT++ALSHP +    +   + L VL EL
Sbjct  418  MENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG--ERTFLSLDVLDEL  475

Query  567  PETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAED  626
            P+++ DI+  IFEDKFGQG  RVW   KP+L+ +V AA+G +  V E Q K+ F+L  E+
Sbjct  476  PDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEE  535

Query  627  LRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFSID  671
             RM++RSF D++      YRI +S+L AWL    RS+   +F ID
Sbjct  536  WRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRSQ---HFYID  577

>CCI44111
Length=576

 Score = 348 bits (894),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 194/504 (38%), Positives = 290/504 (58%), Gaps = 22/504 (4%)

Query  171  IRREVMNELHVTRYDVLKELTLLKGAIAQLTAA------QHsspsvsstessssdplsAE  224
            +R+E++  +  TRYD+LKE+  LKG +A ++           +    +T + S+    A+
Sbjct  70   VRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTANGSACSEGAD  129

Query  225  ERAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVR----LTQLAPVADNALSTP  280
            +   L+   +   S    D    +RL         +++S+     L  L  + +  LS P
Sbjct  130  DNEILSNFVTPDRSTVLSDCSHITRL--------VSQSSILRESGLPTLMTMDEANLSKP  181

Query  281  LSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEG  340
            LS  +I+EMFPLID + D+ ++A  L  G+R WAL  + +W+ + F  G + +L +VGEG
Sbjct  182  LSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEG  241

Query  341  GTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARL  400
            G GKS   G V Q+F  NL A H  QFDRK  SS R+V+LS+V Q    L L+K QL RL
Sbjct  242  GAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRL  301

Query  401  NLKYVLEEADPILLAGKVLVDPLNAMEEPVHA-TFMLVDGIDQCSAGPNGRNELLQFFAQ  459
            NL+Y+L E++P+++A K+L+DPL A+ E      F+L DGIDQC    N  N+LL+  + 
Sbjct  302  NLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLV-KNQSNDLLELLSH  360

Query  460  VIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDA  519
            +  + PSWIGF+++SK     A RL  +SV+     N  F+ D   L++++   F     
Sbjct  361  ITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHT  420

Query  520  AEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFE  579
             EA  +L  KSGGN  YL+F  +ALSHP +    ++  + L VL ELPE++ +I   IF+
Sbjct  421  NEACDILMRKSGGNSLYLQFINRALSHPILHG--EQTFLSLDVLDELPESVDEIIFTIFD  478

Query  580  DKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVA  639
            DKFGQG  RVW  AKP+L+++V AA+GPY  V E Q K+ F+L   + RM+ R+F D++ 
Sbjct  479  DKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIH  538

Query  640  VKHGSYRIESSALCAWLSDPARSE  663
                 YRI +S+L  WL    RS+
Sbjct  539  CGTDGYRIINSSLYDWLVVEKRSQ  562

>SPRG_06355
Length=713

 Score = 257 bits (656),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 147/420 (35%), Positives = 236/420 (56%), Gaps = 32/420 (8%)

Query  271  PVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGT  330
            P+ D AL+ P  +  +N+  P ++        A  + P +RTWA+ +  +W         
Sbjct  298  PIKDQALTQPWENV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  352

Query  331  DTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNL  390
              +L VVG  G GKS  L  +   +   ++A+H  ++D +  +S   +L+S+ HQ+   L
Sbjct  353  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKL  410

Query  391  PLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGR  450
            P F+ QL RLNL Y+++E DP++LA K+L++PL +M  P+ +  +++D +D+ ++ P G 
Sbjct  411  PDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTP-GT  469

Query  451  NELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDI  510
            N L+   A V  + PSW+ FL+SS+P   + K LP   VL F  ++  F AD +  V  +
Sbjct  470  N-LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSL  528

Query  511  ARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALS--HPGMTATSKEGAVPLGVLHELPE  568
                  DD      +LK KS G+F YL+F  QA +  H  + A         G++ ELP+
Sbjct  529  MDKHGLDD-KNILFLLKAKSQGSFLYLQFVDQAFAMIHSEIDA---------GMILELPK  578

Query  569  TLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAS-------GPYSPVTEEQAKEHFK  621
            TLY+IY ++FE+K+G+GR RVW K +P+L+ +VGAA+        P+  VTE   +  FK
Sbjct  579  TLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIFK  636

Query  622  LTAEDLRMLRRSFVDLVAVKH--GSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRK  679
            L   DL ++ RSF D+VAV    G YR++S  L  +L D +RS+E  + +++  +H L K
Sbjct  637  LGQPDLALIARSFEDIVAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)

Query  171  IRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQH  205
            IRR+VM ELH T+YD+LKE+T+L+GA+ QL  A H
Sbjct  156  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  190

>SDRG_01763
Length=736

 Score = 248 bits (633),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 145/420 (35%), Positives = 232/420 (55%), Gaps = 32/420 (8%)

Query  271  PVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGT  330
            P+ D AL+ P  +  +N+  P ++        A  + P +RTWA+ +  +W         
Sbjct  321  PIKDQALTQPWENV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  375

Query  331  DTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNL  390
              +L VVG  G GKS  L  +   +   ++A+H  ++D +   +P  +L+S+ HQ+   L
Sbjct  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKL  433

Query  391  PLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGR  450
            P ++ QL RLNL Y+++E DPI+LA K+L++PL +M  P+ +  +++D +D+  + P G 
Sbjct  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTP-GA  492

Query  451  NELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDI  510
            N L+   A V  + PSW+ FL+SS+    + K LP   VL F  ++  F AD +  V  +
Sbjct  493  N-LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSV  551

Query  511  ARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALS--HPGMTATSKEGAVPLGVLHELPE  568
                  DD      +LK KS G+F YL+F  QA S  H  + A         G++ ELP+
Sbjct  552  MDKHGLDD-KNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDA---------GMILELPK  601

Query  569  TLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAS-------GPYSPVTEEQAKEHFK  621
            TL++IY ++FE+K+G+GR RVW K + +L+ +VGAA+        P+  VTE   +  FK
Sbjct  602  TLHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFK  659

Query  622  LTAEDLRMLRRSFVDLVAVKH--GSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRK  679
            L   DL ++ RSF D+V V    G YR++S  L  +L D ARS+E  + +++  +H L K
Sbjct  660  LGQPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)

Query  171  IRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQH  205
            IRR+VM ELH T+YD+LKE+T+L+GA+ QL  A H
Sbjct  169  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  203

>SDRG_04575
Length=1003

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 110/228 (48%), Gaps = 12/228 (5%)

Query  260  ARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVE  319
            A+   RL Q+A      L       ++  +F    F + ++ + +G     R W L +++
Sbjct  399  AKYPQRLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLD  456

Query  320  EWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAH-CCQFDRKSKSSPRNV  378
            +W         D +  + G+ GTGKSA    + Q  R  + A H  C+ D +++S  R  
Sbjct  457  QWKQTH-----DQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSH-RRC  509

Query  379  LLSMVHQLVDNLPLFKNQLARLN-LKYVLEEADPILLAGKVLVDPLNAMEEPVHATF-ML  436
            +LS+ +QL   LP + + L + + L+ V+  +  + L   +LV PL+A+ EP      +L
Sbjct  510  ILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVIL  569

Query  437  VDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRL  484
            +DG+D         N L+     ++ +LPSW+  +++S+    + ++L
Sbjct  570  LDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKL  617

>H310_08292
Length=1007

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 79/353 (22%), Positives = 139/353 (39%), Gaps = 31/353 (9%)

Query  261  RASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEE  320
            + +VR+ QL       L       ++  +F    F +++A   +G     R W + ++ +
Sbjct  407  KYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIAKFTQGF--AGREWVMDQLTQ  464

Query  321  WLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLL  380
            W              V G+ GTGK+A    + Q  +  + A H    D +   +PR  +L
Sbjct  465  W-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCIL  518

Query  381  SMVHQLVDNLPLFKNQLARLN-LKYVLEEADPILLAGKVLVDPLNAMEEPVHATF-MLVD  438
            S+ +QL   LP +   L +   L+ ++  +    L   +LV PLNA+ +P      +L+D
Sbjct  519  SLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILLD  578

Query  439  GIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLP--VSSV-LDFSAK  495
            G+D         N  +     ++ +LPSW+  + +S+    + ++L   V  V LD    
Sbjct  579  GLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALDKCVD  638

Query  496  NGAFVADVSSLVDDIARNFSDDDAA-----EAKKVLKHKSGGNFAYLEFTKQALSHPGMT  550
              +  AD+   +      F   D       E    +  +S G F Y      AL    +T
Sbjct  639  QSS--ADMLKYLQAALVPFVRPDEGAVVPLETLHAIVARSEGLFLYASHIVHALHQKRLT  696

Query  551  ATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGA  603
                     L  L   P  +     + FED+F           +PLL+++  A
Sbjct  697  ---------LDKLESFPVGMGGYLRQFFEDQFSAHHYET--SIRPLLEVLCAA  738

>SPRG_12621
Length=1003

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 85/360 (24%), Positives = 155/360 (43%), Gaps = 36/360 (10%)

Query  311  RTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAH-CCQFDR  369
            R W L ++++W         D +  V G+ GTGKSA    + Q  R  + A H  C+ D 
Sbjct  461  REWVLDQLDQWKQTH-----DQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDE  514

Query  370  KSKSSPRNVLLSMVHQLVDNLPLFKNQLARLN-LKYVLEEADPILLAGKVLVDPLNAMEE  428
            +++S  R  +LS+ +QL   LP + + L + + L+ V+  +  + L   +LV PL A+ E
Sbjct  515  QTQSH-RRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAE  573

Query  429  PVHATF-MLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRL---  484
            P      +L+DG+D         N L+     ++ +LPSW+  +++S+    + ++L   
Sbjct  574  PATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQGF  633

Query  485  PVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAA----EAK-KVLKHKSGGNFAYLEF  539
                 LD  A +     D+ S +      +     A    EA  + +  ++ G F Y   
Sbjct  634  APQIALDKCADHSR--QDIMSYLQKALLPYLPSTTAGVVPEATLQFIAGRAEGLFLYASH  691

Query  540  TKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL  599
               ALS   +T  + EG          P  +     + FE +F     +     +PLL++
Sbjct  692  IVHALSQHRLTLDNLEG---------FPTGMGGYLRQFFESQFTPEHYK--EHIRPLLEV  740

Query  600  VVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGS-YRIESSALCAWLSD  658
            +  A    Y P+T +  +   +  +     +  SF  L+ V   +  +   +++  WL D
Sbjct  741  LCAA----YEPLTLDMLRAIMQWDSYVQHEMLASFKSLLYVTDSNVLKPFHTSVLEWLQD  796

>H257_11773
Length=1026

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 80/353 (23%), Positives = 145/353 (41%), Gaps = 29/353 (8%)

Query  260  ARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVE  319
             + +VRL QL       L       ++  +F    F ++++   +G     R W + ++ 
Sbjct  421  VKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLT  478

Query  320  EWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVL  379
            EW        +     + G+ GTGK+A   +V Q  +  + A H    + +   + R  +
Sbjct  479  EW-----KASSSQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCV  532

Query  380  LSMVHQLVDNLPLFKNQLARLN--LKYVLEEADPILLAGKVLVDPLNAMEEPVHATF-ML  436
            LS+ +QL   LP +   L + +  L+ ++  +    L   +LV PLNA+ +P      +L
Sbjct  533  LSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVIL  592

Query  437  VDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSK--PS--SKLAKRLPVSSV--L  490
            +DG+D         N  +   A  +  LP W+ ++++S+  PS   KL   +P  ++   
Sbjct  593  IDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKC  652

Query  491  DFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMT  550
                ++        +LV  +A N   D  A   + +  +S G F Y      ALS   +T
Sbjct  653  GHQTRDDMLKYLQLALVQFVA-NADKDVPAATLRFIVERSEGLFLYASHIVNALSQKRLT  711

Query  551  ATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGA  603
                     L  L   P  +     + FED+F           +PLL+++  A
Sbjct  712  ---------LDKLESFPVGMGGYLRQYFEDQFTALHYET--SVRPLLEVLCAA  753

>PYVX_21513
Length=1446

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 79/356 (22%), Positives = 142/356 (40%), Gaps = 72/356 (20%)

Query  311  RTWALTRVEEWLDARFNVGTD-TLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDR  369
            R W   RV++W++   + GTD  +  + G+ G+GK++    + Q F   + A H    + 
Sbjct  438  RDWLFKRVQQWINDS-SSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQED  495

Query  370  KSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPI----LLAGKVLVDPLNA  425
                  R  +LS+ +QL   LP +      L  +  LEE  P+     L   +LV+PLN 
Sbjct  496  DQTHIARRCVLSLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLNT  552

Query  426  MEEPVHATFMLVDGIDQCSAGPNGR---------------NELLQFFAQVIPQLPSWIGF  470
            ++ P     +L+DG++   +G                     L+     ++ +LPSW+  
Sbjct  553  IKRPAKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRL  612

Query  471  LMSSKPSSKLAKRLPV---SSVLD-FSAKN--------GAFVADVSSLVDDIARNFSDDD  518
            ++ S+    +  RL     S V+D F+ +N        G+ +A   SL D +       +
Sbjct  613  VLLSREDHDVMTRLQTYIPSVVIDHFAQENECDIKKFVGSALAPKKSLADIV-------E  665

Query  519  AAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATS----------------------KEG  556
            AA A+   + +      ++ F +   + PG T                         +EG
Sbjct  666  AATAETSGRSRLTTLARHVSFIRSPRNRPGATTEQIEMIARRAEGLFLYAANIVQGIEEG  725

Query  557  AVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVT  612
             V L  L +LP  +     + F+  F     +     +P L+++  A    Y P+T
Sbjct  726  RVALNELDKLPTGMGGCLRQFFDSHFDDNTYKT--TIRPALEVLCAA----YEPLT  775

>SDRG_07983
Length=991

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 95/226 (42%), Gaps = 29/226 (13%)

Query  260  ARASVRLTQLAPVADNALSTPLSSQQINEMFPLID---FTSDLAAHARGLTPGSRTWALT  316
            AR   R  QL    D  +      QQ   +F L+    F S ++   +     +R W L 
Sbjct  391  ARYKTRYHQLLSALDGQIGLDHDGQQ-ARLFSLLSPFSFQSQISKLTQLFV--AREWVLA  447

Query  317  RVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPR  376
            + + W+          +  + G  G+GKSA +  + Q  R  + A H    +     S R
Sbjct  448  KYDAWVQ---TPNGSRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEEDQTQSAR  503

Query  377  NVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPIL----LAGKVLVDPLNAMEEPVHA  432
              +LS+V+QL   LP + N    +N +  LEE  P+     L   +L+ PL+A+  P   
Sbjct  504  RCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVKSLVDLIHALLIAPLSAIAHPASI  560

Query  433  TFMLVDGIDQCSAGPNGRNELLQFFAQVIPQL---PSWIGFLMSSK  475
              +L+DGID    G         F A +   +   PSW+ F+  ++
Sbjct  561  LVLLIDGIDCFEPG---------FVATLTAHMDLWPSWVRFVFGTR  597

>SPRG_19030
Length=1000

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 77/173 (45%), Gaps = 23/173 (13%)

Query  310  SRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDR  369
            +R W L + + W+          +  V G  G+GKSA +  + Q  R  + A H    + 
Sbjct  449  AREWVLAKYDAWVQ---TPNGSRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  504

Query  370  KSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPIL----LAGKVLVDPLNA  425
                S R  +LS+V+QL   LP + N    LN +  LEE  P+     L   +L+ PL+A
Sbjct  505  DQTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLSA  561

Query  426  MEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQL---PSWIGFLMSSK  475
            +  P     +L+DGI+    G         F A +   +   PSW+ F+  ++
Sbjct  562  IAHPASILVLLIDGIECFEPG---------FVATLTAHMDLWPSWVRFVFGTR  605

>PYIR_14107
Length=1176

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 82/416 (20%), Positives = 168/416 (40%), Gaps = 81/416 (19%)

Query  311  RTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRK  370
            R W   ++E W+ +        +  V G+ G+GK+A    + Q     + A H    + +
Sbjct  550  REWLFMQLENWIASP---TATQVFWVTGQIGSGKTALAARMVQVI-PEIAAFHFALQEDE  605

Query  371  SKSSPRNVLLSMVHQLVDNLPLFKNQL-ARLNLKYVLEEADPILLAGKVLVDPLNAMEEP  429
               + R  +LS+ +QL   LP +   L +R  L+ ++  ++   L  ++LV+PLN +  P
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  430  --VHATFMLVDGI--------------------------------DQCSAGPNGRNELLQ  455
                   +L+DG+                                D C++ P+G   L+ 
Sbjct  666  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  456  FFAQVIPQLPSWIGFLMSSKPSSKLAKRL---PVSSVLDFSAKNGAFVADVSSLVDDI--  510
                ++ +LP+W+  ++ S+    +  +L     S VLD S K+ +   D+   V+++  
Sbjct  726  ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIVLD-SLKSES-QQDIKRYVENMLG  783

Query  511  -------------------ARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTA  551
                               A  FS+  + E   ++  +S G F Y     Q++       
Sbjct  784  ESPATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI-------  836

Query  552  TSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPV  611
              +E  + +  L  LP  +   + + F+  F + + +     +P+L+++  +    + P 
Sbjct  837  --EEKRLAVDQLESLPIGMGGYFRQFFDGHFDEQQYQ--DSIRPVLEVLCAS----FEPF  888

Query  612  TEEQAKEHFKLTAEDLRMLRRSFVDLVAV-KHGSYRIESSALCAWLSDPARSEEQF  666
            +             D + +  SF  L+++   G+ R   S++C W+ DPA + + F
Sbjct  889  SLWNIVSILNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAGKYF  944

>H257_01934
Length=1022

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 107/246 (43%), Gaps = 25/246 (10%)

Query  251  NVHKTPPPA--ARASVRLTQLAPVADNALSTPLSSQQINEMFPLID---FTSDLAAHARG  305
            + H TP     AR S R  QL    +  +      QQ   +F L+    F S ++   +G
Sbjct  401  SFHTTPWTLHDARYSTRREQLIAALNGRVGLDQEGQQ-ARLFSLLSPFSFQSQISTATQG  459

Query  306  LTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCC  365
                 R W L   +EW+ +  +      L + G  G+GK+A    + Q  R  ++A H  
Sbjct  460  YC--GRAWVLHEFDEWVTSPPSNARRVFL-LTGVIGSGKTALAAHIIQN-RPEVVAFHLA  515

Query  366  QFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEE-------ADPILLAGKV  418
              + +   + R  +L++V+QL   LP + N L   + K  LEE       AD   L  ++
Sbjct  516  SHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEETVFVGNLAD---LVQEL  570

Query  419  LVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSS  478
            L+ PL  +  P     +L+DGI+     P   + L+      + + P+W+ F+ +S+   
Sbjct  571  LIAPLERIATPPSTMVILIDGIE---CFPCADDNLVAILTASLNRWPAWMRFVFTSREDP  627

Query  479  KLAKRL  484
            ++   L
Sbjct  628  RVLSLL  633

>PYAP_22230
Length=1116

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 92/425 (22%), Positives = 153/425 (36%), Gaps = 99/425 (23%)

Query  311  RTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRK  370
            R W L  + +W++     G+     V G+ G+GK++    + Q     + A H    D  
Sbjct  496  RAWLLESIRQWINTPVTSGSKVFW-VTGQIGSGKTSVAARMVQ-LMPEIAAFHFALQDDD  553

Query  371  SKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPI----LLAGKVLVDPLNAM  426
                 R  +LS+ +QL   LP +      L     LEE  P+     L   +LV+PLNA+
Sbjct  554  QTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAI  610

Query  427  EEPV--HATFMLVDGI-------DQCSAGPN------GRNE-------------------  452
              P       +L+DG+       D  + GP       GR                     
Sbjct  611  ARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGSSD  670

Query  453  --LLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPV---SSVLDFSAKNGAFVADVSSLV  507
              L+     +I +LP W+  ++ S+    +  +L V   S  LD   +     AD+   V
Sbjct  671  ECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENE--ADIREFV  728

Query  508  D---------------------------------DIARNFSDDDAAEAKKVLKHKSGGNF  534
            +                                  ++ N     +AE  +V+  +S G F
Sbjct  729  EMALCSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKISAEQVEVITKRSEGLF  788

Query  535  AYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAK  594
             Y     QA+         +EG + +  L  LP  L     + FE  F     +   K +
Sbjct  789  LYAANIVQAI---------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYKT--KIR  837

Query  595  PLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSY-RIESSALC  653
            P+L+++  A    Y P+T       F  +  + + +  SF  L+ V    Y R   S++ 
Sbjct  838  PVLEVLCAA----YEPMTTAMLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSSVL  893

Query  654  AWLSD  658
             W+ D
Sbjct  894  EWVQD  898

>PYAR_14788
Length=795

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 75/357 (21%), Positives = 132/357 (37%), Gaps = 44/357 (12%)

Query  336  VVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKN  395
            V G+ G GK++    + Q     + A H    +       R  +LS+ +QL   LP +  
Sbjct  421  VTGQIGAGKTSVAAKMVQTI-PEIAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPAYA-  478

Query  396  QLARLNLKYVLEEADPIL----LAGKVLVDPLNAMEEPV--HATFMLVDGIDQCSAGPNG  449
                L     LEE  P+     L   +L+ PLNA+  P       +L+DG++  ++   G
Sbjct  479  --VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGG  536

Query  450  RNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLP-VSSVLDFSAKNGAFVADVSSLVD  508
                +     +I +LPSW+  ++ S+    +  +L   S  +    +      D+   V+
Sbjct  537  AGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRREQENEEDIRGFVE  596

Query  509  -DIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATS--------------  553
              +        +A A    +H+S    +    +  A S P +   S              
Sbjct  597  AALCSPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSEQVELITKRSEGL  656

Query  554  -----------KEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVG  602
                       +EG + +  L  LP  L     + FE  F     +   K +P+L+++  
Sbjct  657  FLYAVNIVQSIEEGRLSVDQLASLPLGLGGYLRQFFESHFDDTTYKT--KIRPVLEVLCA  714

Query  603  AASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSY-RIESSALCAWLSD  658
            A    Y P+T       F  +  D   +  SF  L  +    Y R   S++  W+ D
Sbjct  715  A----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCISDDGYMRPFHSSVLEWVQD  767

>PHYSO_470533
Length=1084

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 73/350 (21%), Positives = 137/350 (39%), Gaps = 64/350 (18%)

Query  311  RTWALTRVEEWLDARFNVGTDT---------LLAVVGEGGTGKSAFLGTVAQQFRGNLLA  361
            R W   R ++W+     + T T         +  +VG+ G+GK++    + Q     + A
Sbjct  472  REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTC-PEIAA  530

Query  362  AHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQL-ARLNLKYVLEEADPILLAGKVLV  420
             H  + + +   + R  +LS+ +QL   LP + + L +   L+ ++  A  + L  ++L+
Sbjct  531  FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLI  590

Query  421  DPLNAMEEPV--HATFMLVDGID--------------QCSAGPNGRNELLQFFAQVIPQL  464
             PLNA+  P    +  +L+DGI+                S G      L+     +  +L
Sbjct  591  GPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASRL  650

Query  465  PSWIGFLMSSKPS----SKLAKRLPVSSVLD-FSAKNGAFV------------------A  501
            P W+  ++ S+      SKL    P   ++D F  +N   +                  A
Sbjct  651  PDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDFA  710

Query  502  DVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLG  561
              S    D+  N  +    +  +++  +S G F Y     QA++         EG + L 
Sbjct  711  KASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT---------EGRLRLH  761

Query  562  VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPV  611
             L ELP  +     + F   F         + +P+L+++  A    Y P+
Sbjct  762  ELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLEVLCAA----YEPL  806

>PITG_17250
Length=1046

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 85/193 (44%), Gaps = 20/193 (10%)

Query  311  RTWALTRVEEWLDARF----NVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQ  366
            R W     + W+         +    +  V+G+ G+GKS+    + Q     + A H   
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQAC-PEIAAFHFAT  508

Query  367  FDRKSKSSPRNVLLSMVHQLVDNLPLFKNQL-ARLNLKYVLEEADPILLAGKVLVDPLNA  425
             + +   + R  +LS+ +QL   LP + + L +   L+ ++  A  + L   +L+ PLNA
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNA  568

Query  426  MEEP--VHATFMLVDGID-----QCSAGPNG-----RNE--LLQFFAQVIPQLPSWIGFL  471
            +  P    +  +L+DG++      C+    G     ++E  L+     ++ +LP W+  +
Sbjct  569  IARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIV  628

Query  472  MSSKPSSKLAKRL  484
            + S+    +  +L
Sbjct  629  LLSREEPPVLSKL  641

>PYIW_15717
Length=1121

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 68/147 (46%), Gaps = 14/147 (10%)

Query  311  RTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRK  370
            R W   ++E W+ +        +  V G+ G+GK+A    + Q     + A H    + +
Sbjct  525  REWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMVQLIP-EIAAFHFALQEDE  580

Query  371  SKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPI----LLAGKVLVDPLNAM  426
               + R  +LS+ +QL   LP +    + L  +  LEE  P+     L  ++LV+PLN +
Sbjct  581  QTQNARRCVLSLAYQLTTQLPQYA---SFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDI  637

Query  427  EEPVHAT---FMLVDGIDQCSAGPNGR  450
              P  AT    +L+DG++   +  N +
Sbjct  638  ARPQTATKPLVLLIDGLEHLVSDKNAQ  664

>PPTG_11365
Length=1106

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/199 (21%), Positives = 84/199 (42%), Gaps = 26/199 (13%)

Query  311  RTWALTRVEEWLDARF------NVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHC  364
            R W   + + W+           +    +  VVG+ G+GK++    + Q     + A H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSC-PEIAAFHL  561

Query  365  CQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQL-ARLNLKYVLEEADPILLAGKVLVDPL  423
               + +   + R  +LS+ +QL   LP + + L +   L+ ++  A  + L   +L+ PL
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPL  621

Query  424  NAMEEP--VHATFMLVDGIDQC------------SAGPNGRNELLQFFAQVIP----QLP  465
             A+  P    +  +L+DG++              S G    N+  + F  ++P    +LP
Sbjct  622  TAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLP  681

Query  466  SWIGFLMSSKPSSKLAKRL  484
             W+  ++ S+    +  +L
Sbjct  682  EWVRIVLLSREEPPVLSKL  700

>PHYKE_9280
Length=1008

 Score = 35.8 bits (81),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 47/98 (48%), Gaps = 9/98 (9%)

Query  305  GLTPGS---RTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLA  361
            G TP +   R      + ++   RF   T T L + G  G GK+A L   A +F+ N L 
Sbjct  608  GYTPANFRHREKEFNEIRDFFHDRFQEETKTSLYISGAPGCGKTALLK--ATEFQINELY  665

Query  362  AHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLAR  399
              CC  ++ +K   R+ + +M   L D+  LF  QLA+
Sbjct  666  RECCP-EQGAKEPIRSHINAMA--LADSTTLF-CQLAQ  699

>PITG_06580
Length=1214

 Score = 34.7 bits (78),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 43/104 (41%), Gaps = 10/104 (10%)

Query  331  DTLLAVVGEGGTGKSAFLGTVAQQFR----------GNLLAAHCCQFDRKSKSSPRNVLL  380
            D  L +V    T  S+   +V Q             GNLL+A     D   K+ P NV +
Sbjct  445  DISLKIVNSSRTMSSSKFASVQQALERLMAKYTTLYGNLLSADVHSADDVGKTMPLNVFV  504

Query  381  SMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLN  424
               H  V +L  F+++  R N        + I LA + L+ P+N
Sbjct  505  YSFHVFVVSLLEFEDKFNRKNFSARYRVKNFIKLACRSLLQPVN  548

>PYIR_23360
Length=227

 Score = 33.1 bits (74),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 38/72 (53%), Gaps = 2/72 (3%)

Query  317  RVEEWL-DARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSP  375
            +V+EWL D R +VG D +LA+VG      S+F    AQQF    + A   +   K+    
Sbjct  109  KVKEWLQDLRHHVGDDIVLAIVGNKCDVASSFNFAKAQQF-AQEIGALVFRTSAKTGDGV  167

Query  376  RNVLLSMVHQLV  387
            +N+  S+  QL+
Sbjct  168  QNLFESVAVQLL  179

>PYVX_21776
Length=203

 Score = 32.7 bits (73),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  317  RVEEWL-DARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQF  355
            +++EWL D + +VG D +LAVVG      S+F    AQQF
Sbjct  106  KIKEWLRDLQSHVGEDIVLAVVGNKSDCASSFDFAQAQQF  145

>PHYSO_498286
Length=936

 Score = 33.5 bits (75),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 51/244 (21%), Positives = 96/244 (39%), Gaps = 17/244 (7%)

Query  242  RDRLA-ASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLA  300
            RD+L   S+ + HK     +R     +    V D   + PL  Q ++ + PL+     L 
Sbjct  550  RDKLPRNSKHHFHKPTSIQSRGIHLSSSFFSVGDTMCAAPLMQQALDHLTPLVISEQRLV  609

Query  301  AHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLL  360
            A     +P  R      +EE L        + LL  + E   G++A L  +       +L
Sbjct  610  ARVFFPSPTERADGKHELEE-LTVMMEGVFEKLLKRMNE--FGEAAGLRNILDALALVVL  666

Query  361  AAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLV  420
                 +  R+  +   NV++S           F+ Q+ R+ +K+  EE +  + A  V  
Sbjct  667  VNGNLEEYRQQSAFLYNVMVS-----------FQLQMKRMLIKFT-EEQEAWISAQNVDT  714

Query  421  DPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKL  480
              +  +  PV     ++  +++  AG    + L+  +  ++P    W+  +  S+P    
Sbjct  715  K-MAGVLAPVKKIVNMIARMEESVAGKASDSTLVSIYNMIVPATMQWLDKVSESRPKYAA  773

Query  481  AKRL  484
              RL
Sbjct  774  LTRL  777

>PHYSO_545378
Length=224

 Score = 32.7 bits (73),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  314  ALTRVEEWL-DARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQF  355
            +  +++EWL D + +VG D +LAVVG      S F  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSTFDFSKAQQF  141

>PPTG_02543
Length=1373

 Score = 33.1 bits (74),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 8/93 (9%)

Query  326  FNVGTDTLLAVVGEGGTGKSAFLGTVAQQF--RGNLLAAHCCQFDRKSKSSPRNVLLSMV  383
            F  GT TL  V+G+ G+GKSA +  ++ QF    N+       ++      P+  ++  V
Sbjct  98   FKPGTITL--VLGQPGSGKSALMKMLSAQFPVESNITVEGEITYN----GVPQKDVIKRV  151

Query  384  HQLVDNLPLFKNQLARLNLKYVLEEADPILLAG  416
             Q V+ +P      A L ++  LE A   + AG
Sbjct  152  PQFVEYVPQSDKHFATLTVRETLEYAHKFIGAG  184

>PHYCA_132378
Length=284

 Score = 32.3 bits (72),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 59/144 (41%), Gaps = 21/144 (15%)

Query  298  DLAAHARGLTPGSRTWALTRVEEWLDAR---FNVGTDTLLAVVGEGGTGKSAFLGTVAQQ  354
            D++ H+  L  GS ++AL +    L  R   F  G D L   +  G    S + G +   
Sbjct  101  DVSTHS--LRKGSSSYALRQSLGKLKDRYIHFGEGADQLCGRIIAGLPFNSEWFGQIVGG  158

Query  355  FRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQ-------LVDNLPLFKNQLARLNLKYVLE  407
            +         C + R  +++   +L+S++H        L  N P+FK+++   N    L+
Sbjct  159  Y---------CNYTRGVQAAFPFLLVSIIHHEQYLPTMLNPNHPIFKSRVFTANNLLQLQ  209

Query  408  EADPILLAGKVLVDPLNAMEEPVH  431
                IL  G   V  L A   P H
Sbjct  210  RGSMILAVGVPTVCGLKATGIPAH  233

Lambda      K        H        a         alpha
   0.316    0.130    0.372    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 59780141478

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40