Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_50470692532247083e-93
PPTG_1667292862225099e-63
PITG_000119160934153e-50
PHYSO_4782539169943824e-45
PHALS_1083592642223419e-38
PHYKE_57209221873126e-34
HYAP_015139248962841e-29
PYVX_158639181652006e-18
PYU1_G00322593697227661536e-11
PYAP_1727210297518265741.0
PYIW_234919369721241703.1
PYAR_194629980111667683.6
PHYKE_57191113063667.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_504706

Length=253
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_504706                                                          277        3e-93
PPTG_16672                                                            200        9e-63
PITG_00011                                                            164        3e-50
PHYSO_478253                                                          151        4e-45
PHALS_10835                                                           135        9e-38
PHYKE_5720                                                            124        6e-34
HYAP_01513                                                            114        1e-29
PYVX_15863                                                            81.6       6e-18
PYU1_G003225                                                          63.5       6e-11
PYAP_17272                                                            33.1       1.0  
PYIW_23491                                                            31.6       3.1  
PYAR_19462                                                            30.8       3.6  
PHYKE_5719                                                            30.0       7.9  

>PHYCA_504706
Length=253

 Score = 277 bits (708),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 224/224 (100%), Positives = 224/224 (100%), Gaps = 0/224 (0%)

Query  30   HVLEQPVADPSPAEVTQPELPTKRKHRGLMRAIGGLFKRKssdaddatapsdseasqrrt  89
            HVLEQPVADPSPAEVTQPELPTKRKHRGLMRAIGGLFKRKSSDADDATAPSDSEASQRRT
Sbjct  30   HVLEQPVADPSPAEVTQPELPTKRKHRGLMRAIGGLFKRKSSDADDATAPSDSEASQRRT  89

Query  90   srwsrwshsnrgsMpeaplevaavaepetapIQENESVASSPHMeeppakkvkkvkaekp  149
            SRWSRWSHSNRGSMPEAPLEVAAVAEPETAPIQENESVASSPHMEEPPAKKVKKVKAEKP
Sbjct  90   SRWSRWSHSNRGSMPEAPLEVAAVAEPETAPIQENESVASSPHMEEPPAKKVKKVKAEKP  149

Query  150  kkeakikppSFNTKQSPTDPSALVASGSSDGSVVEPQRISFLFFGGSDTDSTFQPELRPS  209
            KKEAKIKPPSFNTKQSPTDPSALVASGSSDGSVVEPQRISFLFFGGSDTDSTFQPELRPS
Sbjct  150  KKEAKIKPPSFNTKQSPTDPSALVASGSSDGSVVEPQRISFLFFGGSDTDSTFQPELRPS  209

Query  210  EYDELHENDIRPSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253
            EYDELHENDIRPSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF
Sbjct  210  EYDELHENDIRPSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253

>PPTG_16672
Length=286

 Score = 200 bits (509),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 184/222 (83%), Gaps = 3/222 (1%)

Query  33   EQPVADPSPAEVTQPELPTKRKHRGLMRAIGGLFKRKssdaddatapsdseasqrrtsrw  92
            EQP   P P      E PTKRK RG+MRAIGGLFKRK+SD DDA  PSDSEASQRRTSRW
Sbjct  67   EQPA--PGPVHAAAAEPPTKRKTRGIMRAIGGLFKRKASDVDDAMEPSDSEASQRRTSRW  124

Query  93   srwshsnrgsMpeaplevaavaepetapIQENESVASSPHMeeppakkvkkvkaekpkke  152
            SRWSHS+RGS PEAPLEVAAVA PETAPIQENES ASSPH +EPPAKKVKK   E P  E
Sbjct  125  SRWSHSHRGSFPEAPLEVAAVAAPETAPIQENESAASSPHPDEPPAKKVKKATVEHPTTE  184

Query  153  akikppSFN-TKQSPTDPSALVASGSSDGSVVEPQRISFLFFGGSDTDSTFQPELRPSEY  211
             K  P SFN TKQSPTDPS L+ + SSD S  EPQR+SFLFFGGSD DSTFQPELRPSE 
Sbjct  185  KKASPLSFNKTKQSPTDPSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSEL  244

Query  212  DELHENDIRPSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253
            D+LHENDIRPSLQAKMPLFFSPP+VE+MRRSSILPDPKEYEF
Sbjct  245  DDLHENDIRPSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF  286

>PITG_00011
Length=160

 Score = 164 bits (415),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 0/93 (0%)

Query  161  NTKQSPTDPSALVASGSSDGSVVEPQRISFLFFGGSDTDSTFQPELRPSEYDELHENDIR  220
            +TKQSPTDPS L+ + SSD S  EPQR+SFLFFGGSDTDSTFQPELRPSE D+LH+NDIR
Sbjct  68   STKQSPTDPSDLLLADSSDESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIR  127

Query  221  PSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253
            PSLQAKMPLFFSPP+VENMRRSSILPDPKEYEF
Sbjct  128  PSLQAKMPLFFSPPLVENMRRSSILPDPKEYEF  160

>PHYSO_478253
Length=169

 Score = 151 bits (382),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 81/94 (86%), Gaps = 2/94 (2%)

Query  162  TKQSPTDPSALVASG--SSDGSVVEPQRISFLFFGGSDTDSTFQPELRPSEYDELHENDI  219
             KQSPTDPSAL+ +G  S D    EP R+SFLFFGGSD DSTFQPELRPSE D+LHEN+I
Sbjct  76   VKQSPTDPSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEI  135

Query  220  RPSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253
            RPSLQ KMPLFFSPP+VENMRRSSILPDPKEYEF
Sbjct  136  RPSLQVKMPLFFSPPLVENMRRSSILPDPKEYEF  169

>PHALS_10835
Length=264

 Score = 135 bits (341),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 146/222 (66%), Gaps = 8/222 (4%)

Query  32   LEQPVADPSPAEVTQPELPTKRKHRGLMRAIGGLFKRKssdaddatapsdseasqrrtsr  91
            +E   A+P  A   +P  P KRKHRGLMRAIGG F+R  SDAD  T P DSE+SQRRTSR
Sbjct  51   VESTHAEPVHAATGRP--PKKRKHRGLMRAIGGFFRRNCSDADSDTRPHDSESSQRRTSR  108

Query  92   wsrwshsnrgsMpeaplevaavaepetapIQENESVASSPHMeeppakkvkkvkaekpkk  151
            WS     +    P   +    +    +    ENE +  SPH EEPP KKVKK K +K K 
Sbjct  109  WSHSHRQSMPEAPSTVVVQEILETTRSQNAAENEPLTKSPHTEEPPVKKVKKDKPKKAKN  168

Query  152  eakikppSFNTKQSPTDPSALVASGSSDGSVVEPQRISFLFFGGSDTDSTFQPELRPSEY  211
                      T+QSPT+ S ++++   D   VE QR+SFLFFGGSD D TFQPELRPSE 
Sbjct  169  TPSP------TEQSPTETSEMLSATLVDELGVELQRVSFLFFGGSDVDCTFQPELRPSEL  222

Query  212  DELHENDIRPSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253
            D+LHENDIRPSLQAKMPLF  PP+ +N+RRSSILPDP+EYEF
Sbjct  223  DDLHENDIRPSLQAKMPLFLPPPLPKNVRRSSILPDPEEYEF  264

>PHYKE_5720
Length=221

 Score = 124 bits (312),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 2/87 (2%)

Query  169  PSALVASGSSDGS--VVEPQRISFLFFGGSDTDSTFQPELRPSEYDELHENDIRPSLQAK  226
            P  L+A+ S  G     EP R+SFLFFGGSD +STF P+LRPS+ D+LHEND+RPSLQAK
Sbjct  135  PELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSLQAK  194

Query  227  MPLFFSPPMVENMRRSSILPDPKEYEF  253
            MP FFSPP+VE+MRRSSILPDP+EYEF
Sbjct  195  MPQFFSPPVVEHMRRSSILPDPREYEF  221

 Score = 35.0 bits (79),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 1/21 (5%)

Query  50  PTKRKHRG-LMRAIGGLFKRK  69
           PTKR+H G  +RAIGGLFKR+
Sbjct  12  PTKRRHSGGFIRAIGGLFKRR  32

>HYAP_01513
Length=248

 Score = 114 bits (284),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 2/96 (2%)

Query  160  FNTKQSPTDPSALVASGSSDG--SVVEPQRISFLFFGGSDTDSTFQPELRPSEYDELHEN  217
               K SPTD S L+ + SS G  S V+P R+SFL FGGS+ DSTF+PEL PSEYD++H +
Sbjct  153  VKAKPSPTDSSELLRAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHGS  212

Query  218  DIRPSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253
            +IRP LQ KMPLFFS P+ E +RRSS   DPKEYE 
Sbjct  213  EIRPVLQNKMPLFFSLPLAERLRRSSAKSDPKEYEL  248

 Score = 37.4 bits (85),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  41  PAEVTQPELPTKRKHRGLMRAIGGLFKRK  69
           P  V+QP    K+ HRGL+RA+G  FKRK
Sbjct  31  PESVSQPTEKKKKPHRGLIRAVGVFFKRK  59

>PYVX_15863
Length=181

 Score = 81.6 bits (200),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 1/65 (2%)

Query  190  FLFFGGSDTDSTFQPELRPSEYDELHENDIRPSLQAKMPLFFSPPMVENMRRSSIL-PDP  248
            FLF+GGSD D  F+P+LRPS  D +  + IRP ++  MP+FFS P  EN+RRSSIL  DP
Sbjct  117  FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADP  176

Query  249  KEYEF  253
            +EYEF
Sbjct  177  REYEF  181

>PYU1_G003225
Length=227

 Score = 63.5 bits (153),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 2/66 (3%)

Query  190  FLFFGGSDTDSTFQPELRPSEYDELHENDIRPSLQAKMPLFFSPPMV-ENM-RRSSILPD  247
            FLF+ GS  D++F+PE   S   E+  N IRPSL  +MP+FFSPP    N  RRSSIL D
Sbjct  126  FLFYPGSAEDNSFKPEKVTSSIVEIDYNAIRPSLTLQMPVFFSPPTEPSNFPRRSSILTD  185

Query  248  PKEYEF  253
            P+EYE 
Sbjct  186  PREYEL  191

>PYAP_17272
Length=182

 Score = 33.1 bits (74),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 33/65 (51%), Gaps = 6/65 (9%)

Query  159  SFNTKQSPTDPSALVASGSS-DGSVVEPQRISFLFFGGSDTDSTFQPELRPSEYDE-LHE  216
            +F   +  TD S  + +G+  D  VVEP+R  F  FG S    T     RP+ Y   L+E
Sbjct  34   AFPRHRHDTDRSGNLPAGTVIDSKVVEPRRFDFYLFGHSGILGTS----RPAHYTALLNE  89

Query  217  NDIRP  221
            N +RP
Sbjct  90   NGLRP  94

>PYIW_23491
Length=212

 Score = 31.6 bits (70),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  187  RISFLFFGGSDTDSTFQPELRPSEYDELHENDIRPSLQAKM  227
            R  F F+ GS  D++F+PE   S   E+  N IRP   +K 
Sbjct  141  RYQFHFYSGSAEDNSFKPERVHSTVAEIDYNTIRPRRGSKT  181

 Score = 31.2 bits (69),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)

Query  54  KHRGLMRAIGGLFKRK  69
           K RG MRAIGG+F RK
Sbjct  22  KTRGFMRAIGGMFHRK  37

>PYAR_19462
Length=116

 Score = 30.8 bits (68),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 14/67 (21%)

Query  168  DPSALVASGSSDGSVVE-PQRISFLFFGGSDTDSTFQPELRPSEYDELHENDIRPSLQAK  226
            D +AL  + S + SV E PQ   FLFF GSDT S  +  L+ S+ +        P +  +
Sbjct  54   DQAAL--ARSRESSVNERPQ---FLFFCGSDT-SAARASLKSSKIET-------PMISHR  100

Query  227  MPLFFSP  233
            MP+FF+P
Sbjct  101  MPVFFNP  107

>PHYKE_5719
Length=130

 Score = 30.0 bits (66),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 29/63 (46%), Gaps = 10/63 (16%)

Query  181  SVVEPQRISFLFFGGSDTDSTFQPELRPSEYDELHE--------NDIRPSLQAKMPLFFS  232
            SVVE  R  FLFF GSDT +    EL       L             +P++   MP+FF 
Sbjct  63   SVVE--RPQFLFFCGSDTSAFPSGELTSPNGSTLASRLASITCPTPAQPAINHHMPVFFM  120

Query  233  PPM  235
            PP+
Sbjct  121  PPL  123

Lambda      K        H        a         alpha
   0.312    0.130    0.372    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13924837920

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40