Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_344751475769269233680.0
PHYSO_32115714757118072530240.0
PPTG_1712814757117772230040.0
PITG_1845714757117072429340.0
PHYRA_9590114757107571729100.0
PHALS_0647714757116672526040.0
PYU1_G0017341475780074020640.0
PYIR_1345314757118674920480.0
PYIW_187931475799774020410.0
PYAP_1774614757116972019270.0
SPRG_063541475788473314680.0
SDRG_0176414757109273414330.0
H310_0921214757111373914200.0
H257_0630514757109973814150.0
CCA1889814757114773512766e-161
CCI4512214757110573212545e-158
PHYKE_8394147574282318513e-106
PYAR_13581147577302947156e-83
PYAP_1514945152066141782.6
PYU1_G0021737158368109746.7
PHYCA_1263294285115055708.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_34475

Length=692
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_34475                                                           1301       0.0   
PHYSO_321157                                                          1169       0.0   
PPTG_17128                                                            1161       0.0   
PITG_18457                                                            1134       0.0   
PHYRA_95901                                                           1125       0.0   
PHALS_06477                                                           1007       0.0   
PYU1_G001734                                                          799        0.0   
PYIR_13453                                                            793        0.0   
PYIW_18793                                                            790        0.0   
PYAP_17746                                                            746        0.0   
SPRG_06354                                                            570        0.0   
SDRG_01764                                                            556        0.0   
H310_09212                                                            551        0.0   
H257_06305                                                            549        0.0   
CCA18898                                                              496        6e-161
CCI45122                                                              487        5e-158
PHYKE_8394                                                            332        3e-106
PYAR_13581                                                            280        6e-83 
PYAP_15149                                                            34.7       2.6   
PYU1_G002173                                                          33.1       6.7   
PHYCA_126329                                                          31.6       8.5   

>PHYCA_34475
Length=692

 Score = 1301 bits (3368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/692 (100%), Positives = 692/692 (100%), Gaps = 0/692 (0%)

Query  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
            RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP
Sbjct  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
            LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ
Sbjct  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  121  AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
            AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL
Sbjct  121  AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
            KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS
Sbjct  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
            PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR
Sbjct  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  301  HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
            HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA
Sbjct  301  HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  361  GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
            GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR
Sbjct  361  GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  421  TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480
            TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV
Sbjct  421  TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480

Query  481  PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540
            PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ
Sbjct  481  PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540

Query  541  TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600
            TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA
Sbjct  541  TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600

Query  601  SFACFHLLARGVLDANSGVYRMAAASTPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVC  660
            SFACFHLLARGVLDANSGVYRMAAASTPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVC
Sbjct  601  SFACFHLLARGVLDANSGVYRMAAASTPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVC  660

Query  661  FDVERTLGTLFLLADSLTAGVFGVLSIGETTE  692
            FDVERTLGTLFLLADSLTAGVFGVLSIGETTE
Sbjct  661  FDVERTLGTLFLLADSLTAGVFGVLSIGETTE  692

>PHYSO_321157
Length=1180

 Score = 1169 bits (3024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/725 (83%), Positives = 650/725 (90%), Gaps = 34/725 (5%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             RGYNELLDAYSLHQFLIHKGRTMRDTPEF+SF RVAQELWGSVEEALRALETLLT YFVP
Sbjct  392   RGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVP  451

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LAY DGQRLLSLA+TGQPRFSKRELLSCIVNEEQVMA LRRPGQRYKGRDRKRRAATTIQ
Sbjct  452   LAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQ  511

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             A VRMW+ RRRY RSRA D +AT+IQLAWRA+SCHAALKARLRE+RREQL+ WEA+M+ L
Sbjct  512   ACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEAKMNDL  571

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             K+QW QIA  RRVVVHVPSLSLDE+SRLSAEN AV+QNLQLTRICAAALDS VDLLVYV+
Sbjct  572   KTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVA  631

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             PFELT DVS YF+KLLQLGGLADSRPRVKL+FPEQA RFPAHFSLSS+LLYSPHCLRRIR
Sbjct  632   PFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIR  691

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
             HYTAGK+AYLVMGLPG EDQRLA+ LDLPILGAPP QALPLLTRSGGKRLLIRADVNVP 
Sbjct  692   HYTAGKDAYLVMGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRADVNVPT  751

Query  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
             GTYELYDEHELF+ALAKLAVAHMDQP+WL KLDYDPLGVGEAVVDLSGMQAMRELRREK+
Sbjct  752   GTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKK  811

Query  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480
             TPEYWRQPGPRDAA+KLVL ELERPG LARLA P+H +IFPSW E+ EAI HFGCV+EAV
Sbjct  812   TPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAV  871

Query  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540
             P T+   +PET+++ +EPAY+RANLF+DPDG+VH+TST N+LA+ GGGLNR+TVAFTFPQ
Sbjct  872   PPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLAS-GGGLNRKTVAFTFPQ  930

Query  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600
             T APHEAVKGAC+AAGKLLVETNVWGYVSLDFVVFQDDKS GAPRLWALAVHPFLTDSAA
Sbjct  931   TVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAA  990

Query  601   SFACFHLLARGVLDANSGVYRMAAAS---------------------------------T  627
             SFACFHLLARGVLDA+SG YRMAAA+                                 T
Sbjct  991   SFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAGT  1050

Query  628   PRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSI  687
             PRC+VVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLL DSLTAGVFGVLS+
Sbjct  1051  PRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSV  1110

Query  688   GETTE  692
             GETT+
Sbjct  1111  GETTD  1115

>PPTG_17128
Length=1177

 Score = 1161 bits (3004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/722 (84%), Positives = 647/722 (90%), Gaps = 30/722 (4%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             RGYNELLDAYSLHQFLIHKGRTMRDTPEFISF RVAQELWGSVEEALRALE LLT YFVP
Sbjct  391   RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVEEALRALEALLTQYFVP  450

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LAYVDGQRLL+LA TGQPRFSKRELLSCIVNE+Q+M+ LRRPGQRYKGRDRKRRAATT+Q
Sbjct  451   LAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQ  510

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             A +RMW  RRRYARSRA DINAT+IQLAWRAYSCH ALK RLREVRRE+LEKWE RM  L
Sbjct  511   ACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTALKTRLREVRREKLEKWEKRMCTL  570

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             KSQW+QIA+ RRVVVHVPSLSLDE+ RLSAEN AV+QNLQLTR+CA ALDS VDLLVYVS
Sbjct  571   KSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVS  630

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             PFELT DV QYF+KLLQLGGL DS PRVK +FPEQ+TRFPAHFSLSSLLLYSPHCLRRIR
Sbjct  631   PFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIR  690

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
             HYT GKEAYLVMGLPGAEDQRLA+ LDLPILGAPPAQALPLLTRSGGKRLLIRADVNVP 
Sbjct  691   HYTTGKEAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPN  750

Query  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
             GTYELYDEHEL +ALAKLA+AHMDQPKWL KLDYDPLGVGEAVVDLS +QAMRELRREKR
Sbjct  751   GTYELYDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKR  810

Query  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480
             TPEYWRQPGPRDAAAK++L ELERPG LARLA P+H ++FP+W ++ +A+GHFGCVIEAV
Sbjct  811   TPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAV  870

Query  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540
             P TAIA +PE STAL+EPAY+RANLFVDPDGSVHVTST N+LATGGGGLNR+TVAFTFPQ
Sbjct  871   PPTAIAASPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLATGGGGLNRKTVAFTFPQ  930

Query  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600
             TAAPHEA+KGAC+AAGKLLVETNVWGYVSLDFVVFQD+KSNGAPRLWALAVHPFLTDSAA
Sbjct  931   TAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLTDSAA  990

Query  601   SFACFHLLARGVLDANSGVYRMAA------------------------------ASTPRC  630
             SFACFHLLARGVLD NSG YR+A+                              A  PRC
Sbjct  991   SFACFHLLARGVLDTNSGAYRVASKSLTTVTGRNGSGCTTDLLLREASLAKDSLAGAPRC  1050

Query  631   FVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGET  690
             FVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGET
Sbjct  1051  FVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGET  1110

Query  691   TE  692
              E
Sbjct  1111  ME  1112

>PITG_18457
Length=1170

 Score = 1134 bits (2934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/724 (82%), Positives = 635/724 (88%), Gaps = 32/724 (4%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             RGYNELLD YSLHQFLIHKGRTMRDTPEF+SF RV QELWGSVEEALRALETLL  YFVP
Sbjct  382   RGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVEEALRALETLLAQYFVP  441

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LAYVDGQRLL+LA TGQPRFSKRELLSCIVNE+QVM+ LRRPGQRYKGRDRKRRAATTI+
Sbjct  442   LAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIE  501

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             A VRMW  RRRYAR+RA D NA++IQLAWRAYSCH +LKARLREV  E+LEKWE RMH L
Sbjct  502   ACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNL  561

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             KS W QIA  RRVVVHVPSLSLDE+SRL AEN A++QNLQLTR+CAAALDS V+LL+YVS
Sbjct  562   KSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVS  621

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             PFELT+DVSQYF+KLLQLGGL DSRPRVKL+FPEQ TRFPAHFSLSSLLLYSPHCLRRIR
Sbjct  622   PFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIR  681

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
             HYT GKEAYLVMGLPGAEDQRLAM LDLPILGAPPAQALPLLTRSGGKRLLIRADVNVP 
Sbjct  682   HYTTGKEAYLVMGLPGAEDQRLAMALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPN  741

Query  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
             GTYELYDEHE+ +ALAKLA+AHMDQP+WL KLDYDPL VGEAVVDLS MQAMRELRREKR
Sbjct  742   GTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKR  801

Query  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480
             TPEYWRQPGPRDAAAKL+L ELERPG LAR+A P+  +IFP W EF +A+GHFGCV+EAV
Sbjct  802   TPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAV  861

Query  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540
             P TAIA + E ST L+EPAY+RANLFVDPDGSVH++ST N+LA GGGGLNR+TVAFTFPQ
Sbjct  862   PPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGGGGLNRKTVAFTFPQ  921

Query  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600
             TAAP+EA+KGAC+AAGKLLVETNVWGYVSLDFVVFQD+KSN APRLWALAVHPFLTDSA 
Sbjct  922   TAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWALAVHPFLTDSAT  981

Query  601   SFACFHLLARGVLDANSGVYRMAAASTP--------------------------------  628
             SFACFHLLARGVLD NSGVYR+A  S                                  
Sbjct  982   SFACFHLLARGVLDTNSGVYRVANKSLTTANSGRKSESGSATDLLLREALLAKSSLVGAR  1041

Query  629   RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIG  688
             RCFV CSYVFHPHV TMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFG+LSIG
Sbjct  1042  RCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIG  1101

Query  689   ETTE  692
             ETTE
Sbjct  1102  ETTE  1105

>PHYRA_95901
Length=1075

 Score = 1125 bits (2910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/717 (83%), Positives = 640/717 (89%), Gaps = 32/717 (4%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             RGYN+LLDAYSLHQFLIHKGR+MRDTPEF+SF RVAQELWGSVEEALRALETLLT YFVP
Sbjct  303   RGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVP  362

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LAYVDGQRLLSLAATGQPRFSK ELL+CIVNEEQVM+ LRRPGQRYKGRDRKRRAATTIQ
Sbjct  363   LAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQ  422

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             A VRMW+ RRRY RSRA DI+ATRIQLAWR+YSCHAALK RLREVRREQLE+WEARM  L
Sbjct  423   ACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQDL  482

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             ++QW QIA  RRVVVHVPSLSLDE+SRLSAEN AV+QNLQLTRICAAALDS VDLLVYVS
Sbjct  483   RTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVS  542

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             PFELT DVSQYF+KLLQLGGLADSRPRVKL+FPEQA RFP HFSLSSLLLYSPHCLRRIR
Sbjct  543   PFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIR  602

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
             HYTAGKEAYLVMGLPGAEDQRLA+ LDLPILGAPPAQALPLLTRSGGKRLLIRADVNVP 
Sbjct  603   HYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPT  662

Query  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
             GTYELYDEHELF+ALAKLAVAHM+QPKWL KLDYDPLG+GEAVVDLSGMQAMRELRREKR
Sbjct  663   GTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR  722

Query  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480
             TPEYWRQPGPRDAAAKLVL ELERPG LARLA P+H +IFP+W +F EAIGHFGCVIEAV
Sbjct  723   TPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAV  782

Query  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540
             P   IA TPE+S+ L+EPAY+RANLFV PDG        N+LA+ GGGLNR+TVAFTFPQ
Sbjct  783   PPAGIAATPESSSLLVEPAYVRANLFVYPDGK-------NVLASSGGGLNRKTVAFTFPQ  835

Query  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600
             TAAPHEAV+GAC A GKLLVET+VWGYVSLDFVVFQD+K+ G+PRLWALAVHPFLTDSAA
Sbjct  836   TAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAA  895

Query  601   SFACFHLLARG---------VLDANSG----------------VYRMAAASTPRCFVVCS  635
             SFACFHLLARG         +++AN G                + + A A  PRCFVVCS
Sbjct  896   SFACFHLLARGAYRVAASNSMVNANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCS  955

Query  636   YVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETTE  692
             YVFHPHVTTMQY+AFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFG+LS+GETTE
Sbjct  956   YVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTE  1012

>PHALS_06477
Length=1166

 Score = 1007 bits (2604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/725 (72%), Positives = 587/725 (81%), Gaps = 39/725 (5%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             R YN+L+DAYSLHQ LI+KGR +RDTPEF SF RV  +LWGSVEE LRALE +L  YFVP
Sbjct  385   REYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVP  444

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LA+VDGQRL++LA+T QP+FS+RELLSCIVN+EQVM+ LRRPGQRY GRDRK RAATTIQ
Sbjct  445   LAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQ  504

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             A  RMW    RY +SR+ +INA +IQ A+RAYS   ALKARLRE+R E+  KWEARM+  
Sbjct  505   ACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEF  564

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             KSQW+QIA+ RR+VVHVPS+SL E+SRL+AEN AV+QNLQLTRICAAALD +VDLLVYVS
Sbjct  565   KSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICAAALDLQVDLLVYVS  624

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             P+ELT DVSQYF KLLQL G ADSRPRVK ++PEQA RFPAHFSLSSL+LYSP+CLRRIR
Sbjct  625   PYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIR  684

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
             HYTAG EAYLVMGLPG EDQRLA+TLDLPILGA P+QALPLLTRSGGKRLLI+AD+NVP 
Sbjct  685   HYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPT  744

Query  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
             GTYELYDEHE+  ALAKLAVAH+DQ KWL KLDYDPLGVGEAVVDLS MQAMREL REKR
Sbjct  745   GTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKR  804

Query  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480
             TPEYWRQPG RDAAA L LTE ERPG LARL  P+H +++P+W E+A AIGHFGCVIEAV
Sbjct  805   TPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAV  864

Query  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540
             P TA A + E      EP Y+RAN+FVDP+G+VH+TST N+L T  GGL+R++  F FPQ
Sbjct  865   PPTASAASME------EPTYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEIFAFPQ  918

Query  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600
             T APH A+KGAC+A GK L ETNVWGYVSLDFVVFQD KSN A RLWALA+HPFLT+SAA
Sbjct  919   TVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAA  978

Query  601   SFACFHLLARGVLDANSGVYRMAAAS---------------------------------T  627
             +FACFHLL RG LDANSG+YR+                                      
Sbjct  979   TFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQGA  1038

Query  628   PRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSI  687
              RC+VVCSYVFHP+VT  QYT FF  CRLHGVCFDV R LGTLFLLADSLTAGVFG+LSI
Sbjct  1039  TRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSI  1098

Query  688   GETTE  692
             GET +
Sbjct  1099  GETAQ  1103

>PYU1_G001734
Length=800

 Score = 799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/740 (55%), Positives = 539/740 (73%), Gaps = 68/740 (9%)

Query  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
            RGYNELLD YSLHQF+IHKG+ MR+TPEF+SF RVAQE+WG VEE ++ALETLLT YFVP
Sbjct  12   RGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALETLLTRYFVP  71

Query  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
            LAYVDGQRL+++A+     FSK++LLSCIVNE+QV + +RRPGQRYKG+DRKRRAA TIQ
Sbjct  72   LAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQ  131

Query  121  AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
               RMW+ +++Y+R R    +   IQ  WRAY+ H  L+ +L+  R++Q E+WEARM RL
Sbjct  132  NVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQHEQWEARMQRL  191

Query  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
            + +W +I ++RRV++HVPSLS+DE  R+ A+N AV+QNLQL+R+C   +D+ VD +VYVS
Sbjct  192  QREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLC-GIIDANVD-IVYVS  249

Query  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
            PFELT++V QYF+KLLQLGG+AD   RVKL+FPEQATRFPAHFSL+++LLYSPHCLRRIR
Sbjct  250  PFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSPHCLRRIR  309

Query  301  HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
                GKEAYLV G+PG ED+RLAM L++PILG  P   LPL+T+SG KR  +RADVNVP 
Sbjct  310  RCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMRADVNVPT  369

Query  361  GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
            GTY++YDE EL  +LAKL V+H++Q  WL K+DYDP G G A+VD S + A+RE+RREK+
Sbjct  370  GTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALREIRREKK  429

Query  421  TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480
            +PEYWRQPG RD AA++++ ELER  T+ +L  P+H +++P+W EFA+AI  FG VIEA 
Sbjct  430  SPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADAIAQFGVVIEAA  487

Query  481  PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540
            P   +              YIRANLFV+P G VHV+ST +++ +      R+   + FPQ
Sbjct  488  PSAIV-------------GYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQ  534

Query  541  TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600
            T AP+EA++GA  A GK+LV+ +V+GY S+D++VF++DK++  PRLWA+A+HP+LTDSA+
Sbjct  535  TTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTH-VPRLWAMALHPYLTDSAS  593

Query  601  SFACFHLLARGVLDANSGVYRM---AAASTP-----------------------------  628
            +FA FHLL RG L+ ++G Y +   AA+  P                             
Sbjct  594  TFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATSANLV  653

Query  629  ------------------RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  670
                              R + V  Y+FHP+V+TMQY++FFH CRLHGVCFDVER  GT+
Sbjct  654  LQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTI  713

Query  671  FLLADSLTAGVFGVLSIGET  690
            F+LADSLTAGVFG++  G+T
Sbjct  714  FMLADSLTAGVFGIICCGDT  733

>PYIR_13453
Length=1186

 Score = 793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/749 (55%), Positives = 533/749 (71%), Gaps = 77/749 (10%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             RGYNELLD YSLHQF+IHKGR MR+TPEF+SF RVAQE+WGSVEE +RALE LLT YFVP
Sbjct  390   RGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVP  449

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LAY+DGQRL+++AA     FSKR+LLSCIVNE+QV + +RRPGQRYKG+DRKRRAA TIQ
Sbjct  450   LAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQ  509

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
              F RMW  +++Y R R    +   IQ  WRA++ H +LK +L+  R +Q E+WEA+M RL
Sbjct  510   NFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRL  569

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             K  W  I  +RRVV+HVPSLS+DE SR+SA+N +V+QN+QL+R+C   +D  VD +VYVS
Sbjct  570   KRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLC-GLIDPNVD-IVYVS  627

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             PFELT DV+QY +KLLQLGG+AD   RVKL++PEQA RFPAHFSL++LLLYSPHCLRRI+
Sbjct  628   PFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQ  687

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
              Y   KEAYLV G+PG ED+RLA+ L++PILG  P  ALPL+T+SG KR  +RADVNVP 
Sbjct  688   RYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPT  747

Query  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
             GTY++YDE EL  +LAKL ++H++Q  W+ K+DYDP G G A++D+S M  +RE+RREK+
Sbjct  748   GTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKK  807

Query  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480
             +PEYW+QP  RD AA+ ++ ELER  TLA L  P+H +++PSW EF +AI  FG V+EA 
Sbjct  808   SPEYWKQPSTRDNAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAA  865

Query  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGL-----------  529
             P   I              ++RANLF++P G VHV+ST +++ T                
Sbjct  866   PSAVI-------------GHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKAG  912

Query  530   --NRRTVAFTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLW  587
                 +TV + FPQTAAP+EA++GA +A GKLL +  V+GY S+D++VFQ+DK++ A RLW
Sbjct  913   AYRSKTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA-RLW  971

Query  588   ALAVHPFLTDSAASFACFHLLARGVLDANSGVYRMAA-----------------------  624
             A+A+HP+LTDSA++FA FHLL RG L+A+SG+Y +                         
Sbjct  972   AMALHPYLTDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGA  1031

Query  625   -----------------------ASTPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCF  661
                                    A   R +VV  Y+FHP+V+TMQY+AFFH CRLHGVCF
Sbjct  1032  TGTSAADLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCF  1091

Query  662   DVERTLGTLFLLADSLTAGVFGVLSIGET  690
             DVER +G++FLLADSLTAGVFG++   ++
Sbjct  1092  DVERCVGSVFLLADSLTAGVFGIMCCSDS  1120

>PYIW_18793
Length=997

 Score = 790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/740 (56%), Positives = 531/740 (72%), Gaps = 68/740 (9%)

Query  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
            RGYNELLD YSLHQF+IHKGR MR+TPEF+SF RVAQE+WGSV+E ++ALE LLT YFVP
Sbjct  210  RGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVP  269

Query  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
            LAYVDGQRL+++AA     +SKR+LLSCIVNE+QV + +RRPGQRYKG+DRKRRAA TIQ
Sbjct  270  LAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQ  329

Query  121  AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             F RMW  +++Y+R R    +   IQ  WR Y+ H  LK R++  R +Q  +WEA+M RL
Sbjct  330  NFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRL  389

Query  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
            K  W +I  +RRVV+HVPS S+DE  RLSA+N +V+QNLQL+R+C   +DS VD +VYVS
Sbjct  390  KRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLC-GLVDSNVD-IVYVS  447

Query  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
            PFELTTDV QY +KLLQLGG+AD   RVKL+FPE A RFP HFSL++LLLYSPHCLRRI+
Sbjct  448  PFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQ  507

Query  301  HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
             Y   KEAYLV G+PG ED+RLAM L++PILG  P  ALPL+T+SGGKR  +RADVNVP 
Sbjct  508  RYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPT  567

Query  361  GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
            GTY++YDE EL  +LAKL V+H++Q  W+ K+DYDP   G A++D+S M A+RE+RREKR
Sbjct  568  GTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKR  627

Query  421  TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480
            +PEYWRQPG RD AA++++ ELER  TL  L  P+H +++PSW ++A+AI  FG V+EA 
Sbjct  628  SPEYWRQPGTRDNAARVIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAA  685

Query  481  PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNML--------ATGGGGLNRR  532
            P   +              ++RANLFV+P G VHV+ST ++L           GG    +
Sbjct  686  PSAVV-------------GHVRANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGGAYRHK  732

Query  533  TVAFTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVH  592
            +V + FPQTAAP+EA++GA +A GKLL E NV+GY S+DF+VFQ+DKS+ A RLWA+A+ 
Sbjct  733  SVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALR  791

Query  593  PFLTDSAASFACFHLLARGVLDANSGVYRMAAASTP------------------------  628
            P+LTDSAA+F  FHLL RG L+  SG+Y + AA+                          
Sbjct  792  PYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTSASLVQLQSSSAAFASGASAADLV  851

Query  629  ------------------RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  670
                                +VV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER +G++
Sbjct  852  LHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSV  911

Query  671  FLLADSLTAGVFGVLSIGET  690
            FLLADSLTAGVFG++   +T
Sbjct  912  FLLADSLTAGVFGLMCCSDT  931

>PYAP_17746
Length=1169

 Score = 746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/720 (54%), Positives = 509/720 (71%), Gaps = 47/720 (7%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             RGYNELLDAYSLHQF+IHKGR +RDTPEF SF RVAQE+WGS+EE ++ALE LLT YFVP
Sbjct  360   RGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVP  419

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LAY+DGQRL++LA+    + S  ELL+C+VNE+QV + +RRPGQRYKG+DRKRRAATT+Q
Sbjct  420   LAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQ  479

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             AF RM   R R+ + R    +A  IQ  WR+Y+C  +L+ RL  VR E+L +W+A++ R+
Sbjct  480   AFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRM  539

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             +SQW  I   RRVV+HV S+S+DE +RLS EN +V+QNLQL+R+ A  +D  V+ +VYV+
Sbjct  540   RSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRL-AGLVDQNVE-IVYVT  597

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             PFEL+T+VSQYFIKLLQL G+A++  RV+L+FPE A +FP HFSL++ L+YSP+C+RRI+
Sbjct  598   PFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQ  657

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDl-pilgappaqalpllTRSGGKRLLIRADVNVP  359
                 GKEAYLVMG+PG EDQRLA+ L +  +    P   LPL+TRSG KR  I+ADVNVP
Sbjct  658   RLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVP  717

Query  360   AGTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREK  419
              GTY++YD  EL  +LAKL ++H++Q  WL KLD DPLG G A++D+S M  +R++RREK
Sbjct  718   TGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREK  777

Query  420   RTPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEA  479
             R PEYW+QPG RD  A+ +L ELER   +  L  P H +IF SW EFA AI  FG V+EA
Sbjct  778   RPPEYWKQPGIRDTIARALLQELER--EIGSLLKPSHPEIFASWKEFASAIPEFGVVVEA  835

Query  480   VPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLN---RRTVAF  536
             +P     V             IR N+F++P G VHV ST ++L+  G  L+   RR  AF
Sbjct  836   LPFHVAGV-------------IRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAF  882

Query  537   TFPQTAAPHEAVKGACSAAGKLLVETNVW-GYVSLDFVVFQDD---KSNGAPRLWALAVH  592
              FPQT  PHEA+ GA SA G++L E + + GY S+D  + Q++     + A RLWA+++ 
Sbjct  883   VFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLF  942

Query  593   PFLTDSAASFACFHLLARGVLDANSGVYRMAAAST----------------------PRC  630
             P+LTDSAA+FA FH L RGVL+  +G Y + A  +                      PR 
Sbjct  943   PYLTDSAATFAAFHALHRGVLNPATGRYNLTARESTPPESDSALVSSVIGTLDRIGAPRS  1002

Query  631   FVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGET  690
             + V  YVFHP+V+ M Y AFFH CRLHGVCFDVER +G++FLLADSLTAG+FGVLS GE+
Sbjct  1003  YAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGES  1062

>SPRG_06354
Length=884

 Score = 570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/733 (43%), Positives = 442/733 (60%), Gaps = 61/733 (8%)

Query  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
            RGYN+LLD YSLHQF+I KG+T+ +TPEFISF R+ ++LWGSV  A+R LETLL HY VP
Sbjct  108  RGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVP  167

Query  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
            LAY+DGQ+LL +AA      SK ELL+C++N ++V   + RPGQR+KG D +  AA  IQ
Sbjct  168  LAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQ  227

Query  121  AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
            + V      RR  R       AT IQ  +R Y C   ++ +LR  R      WE +M   
Sbjct  228  S-VYRMHRTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTF  286

Query  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             + W +I   RRVVVHVPS S +E +RL+ +N A+RQNLQ+ R+CA A D  VD ++Y+S
Sbjct  287  HANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIA-DPNVD-VIYIS  344

Query  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
            PFEL+ D+ +Y ++LLQLGG+AD   RV++L PE A RFP HFSL+++LLYSPHCL++I+
Sbjct  345  PFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIK  404

Query  301  HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
             Y  GKEAY+V G  G ED+RLA+ L LP+LG  P +AL   TRSG KRL  +ADVN+P 
Sbjct  405  RYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPY  464

Query  361  GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
            G +++YDE EL  +LAKL  A++ Q  WL KLD DP   G A +D+  ++ + ++R EKR
Sbjct  465  GAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKR  524

Query  421  ---TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVI  477
                 EY+ QP  ++   + ++ EL       RL  P   D++P+W      +   G VI
Sbjct  525  AMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHMRPVVNRIGAVI  582

Query  478  EAVPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFT  537
            EA P   +             A +RAN+F++P G VHVTS    L         ++V   
Sbjct  583  EAYPPKVL-------------ARVRANVFIEPSGGVHVTSAQEQLMHVKN--KHQSVGAV  627

Query  538  FPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKS----NGAP--RLWALAV  591
            +P TA P+ A++GA  A  + +  + + GY S+D+V F D K+     G P  RLWAL +
Sbjct  628  YPPTAVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQL  687

Query  592  HPFLTDSAASFACFHLLARGVLDANSG-------------------------VYRMAAAS  626
             P LT +A SF  F  L+   LDA +G                         V ++   S
Sbjct  688  LPCLTPTAMSFVLFTFLSCATLDAATGRSFLPLPAPRPSSLAGPPATETQLAVEKILGES  747

Query  627  TP-------RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTA  679
            +P       R ++   Y+FHP++ T+QY  FF+ CR+HGV FD+++++G  F+LADSLTA
Sbjct  748  SPAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTA  807

Query  680  GVFGVLSIGETTE  692
            GV G+L IGE+ +
Sbjct  808  GVVGLLCIGESDK  820

>SDRG_01764
Length=1092

 Score = 556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/734 (42%), Positives = 436/734 (59%), Gaps = 62/734 (8%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             RGYN+LLD YSLHQF+I KG+T+ +TPEFISF R+ ++LWGSV  A+R LETLL +Y VP
Sbjct  320   RGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSVP  379

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LAY+DGQ+LL +AA      SK ELL+C++N ++V   + RPGQR+KG D +  AA  +Q
Sbjct  380   LAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILLQ  439

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             + V      RR  R       A+ IQ  +R Y     ++ +LR  R      WE +M   
Sbjct  440   S-VYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAF  498

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
              + W +I   RRVVVHVPS S +E +RL+ +N A+RQNLQ+ R+CA A D  VD ++Y+S
Sbjct  499   HANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-DPNVD-VIYIS  556

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             PFEL+ D+ +Y ++LLQLGG+AD   RV++L PE A RFP HFSL+++LLYSPHCL++I+
Sbjct  557   PFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIK  616

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
              Y  GKEAY+V G  G ED+RLA+ L LP+LG  P +AL   TRSG KRL  +ADVN+P 
Sbjct  617   RYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPF  676

Query  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
             G +++YDE EL  +LAKL  A++ Q  WL KLD DP   G A +D+  ++ + ++R EKR
Sbjct  677   GAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKR  736

Query  421   ---TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVI  477
                  EY+ QP  ++   + ++ EL       RL  P   D++P+W      +   G VI
Sbjct  737   AMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHMRPVVNRIGAVI  794

Query  478   EAVPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFT  537
             EA P   +             A +RAN+F++P G VH+TS    L         ++V   
Sbjct  795   EAYPPKVL-------------ARVRANVFIEPSGGVHLTSAQEQLMQAKN--KHQSVGAV  839

Query  538   FPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKS----NGAP--RLWALAV  591
             +P T  P+ A++GA  A  + +  + + GY S+D+V F D K+     G P  RLWAL +
Sbjct  840   YPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQL  899

Query  592   HPFLTDSAASFACFHLLARGVLDANSG---------------------------------  618
              P LT +A SF  F  L+   LDA +G                                 
Sbjct  900   LPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVEKILSE  959

Query  619   VYRMAAASTPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLT  678
               R +     R ++   Y+FHP++ T+QY  FF+ CR+HGV FD+++++G  F+LADSLT
Sbjct  960   SPRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLT  1019

Query  679   AGVFGVLSIGETTE  692
             AGV G+L IGE+ +
Sbjct  1020  AGVVGLLCIGESDK  1033

>H310_09212
Length=1113

 Score = 551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/739 (41%), Positives = 446/739 (60%), Gaps = 67/739 (9%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             RGYNELLD YSLHQF+I KG+T+ DTPEFISF R  ++LWGSV ++++ LE +LT+Y VP
Sbjct  336   RGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVP  395

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LAYVDGQ+L+ +AA         ELLSCI+N ++V + +RRPGQR+KG+     AA  +Q
Sbjct  396   LAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQ  455

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             + V      ++  ++   + +A  IQ  +R+Y C + L+ RL+ VR   L  W+A+M R 
Sbjct  456   S-VWRMYITKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRF  514

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             ++ W  I   RRVVVHVPS S +E +RL  EN +++QNLQ+ R+CA A D  VD ++Y+S
Sbjct  515   RANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-DPNVD-IIYIS  572

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             PFEL+ D+ +Y ++LLQLGG+AD + R+++L PE   RFP HFSL+++LLYSPHCL++I+
Sbjct  573   PFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIK  632

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
              +  GK+AY+V G  G ED+RLA+ L LP+LG  P +AL   TRSGGKR+ + ADVN+P 
Sbjct  633   RFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPM  692

Query  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
             G +++YDE EL  +L+KL  A +DQ +WL K+D D    G A +++  MQ++ + R EKR
Sbjct  693   GAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKR  752

Query  421   -----TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGC  475
                    EY++QP  RDA  + V +EL      A    P   +++ SW          G 
Sbjct  753   EMKHGAAEYFQQPDVRDAVLRSVYSELNE-SYFAANVTPCFPEMYASWAAMRPIALRVGV  811

Query  476   VIEAVPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRR-TV  534
             VIEA P   +             +++R N+F++P G VH+TS  ++       +N+    
Sbjct  812   VIEAYPSKVL-------------SHVRTNIFIEPSGGVHITSAHDVFMC---PVNKHLPQ  855

Query  535   AFTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKS--NGAP--RLWALA  590
                FPQ++ P++A++GA  A    +    + GY S+D++ F D K+  +G P  RLWA+ 
Sbjct  856   CAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQ  915

Query  591   VHPFLTDSAASFACFHLLARGVLDANSGVYRMAAASTP----------------------  628
             V P LT++A SF  F  L+    +  +G   +  A  P                      
Sbjct  916   VVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATIL  975

Query  629   ---------------RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLL  673
                            R ++V  Y++HP++ T+Q+  FF+ CRLHGV FD++R +G  ++L
Sbjct  976   SPPSSAAAASVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYIL  1035

Query  674   ADSLTAGVFGVLSIGETTE  692
             ADSLTAGV G++ IGE+ +
Sbjct  1036  ADSLTAGVVGLICIGESDK  1054

>H257_06305
Length=1099

 Score = 549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/738 (41%), Positives = 439/738 (59%), Gaps = 65/738 (9%)

Query  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
             RGYNELLD YSLHQF+I KG+T+ DTPEFISF R  ++LWGSV  +++ LET+LT Y VP
Sbjct  322   RGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVP  381

Query  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
             LAYVDGQ+L+ +AA         ELLSCI+N ++V + +RRPGQRYKG      A   IQ
Sbjct  382   LAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQ  441

Query  121   AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
             + V      ++  ++   + +A  IQ  +R+Y C + L+ RL+ VR   L  W+A+M R 
Sbjct  442   S-VWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRF  500

Query  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
             ++ W  +   RRVVVHVPS + D+ +RL  +N ++RQNLQ+ R+CA A D  VD ++Y+S
Sbjct  501   RANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-DPNVD-IIYIS  558

Query  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300
             PFEL+ D+ +Y ++LLQLGG+ D + R+++L PE   RFP HFSL++LLLYSPHCL++I+
Sbjct  559   PFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKIK  618

Query  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPA  360
              +  GK AY+V G  G ED+RLA+ L +P+LG  P +AL   TRSGGKR+ + ADVN+P 
Sbjct  619   RFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAADVNIPM  678

Query  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420
             G +++YDE EL  +L+KL  A +DQ +WL K+D D    G A +++  MQ++ ++R EKR
Sbjct  679   GAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVRAEKR  738

Query  421   -----TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGC  475
                    EY++QP  RDA  + +  EL      A +  P   D++ SW E        G 
Sbjct  739   DMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANIT-PCFPDVYASWAELRPVALRVGV  797

Query  476   VIEAVPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVA  535
             VIEA P   +             + +RAN+F++P G VH+TS  ++  +           
Sbjct  798   VIEAYPSKVL-------------SQVRANVFIEPSGGVHITSAHDLFMSPAN--KHLPQC  842

Query  536   FTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKS---NGAP--RLWALA  590
               FPQT+ P++A++GA  A    +    + GY S+D++ F D K+    G P  RLWA+ 
Sbjct  843   ALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQ  902

Query  591   VHPFLTDSAASFACFHLLARG---------------------------VLDANSGVYRMA  623
             V P LT++A SF  F  L+                             +  A   V  + 
Sbjct  903   VVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQKAVETIL  962

Query  624   AASTPRCFVVC---------SYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLA  674
             +A  P   VVC          Y++HP++ T+ ++ FF+ CRL+GV FD++R +G  F+LA
Sbjct  963   SARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILA  1022

Query  675   DSLTAGVFGVLSIGETTE  692
             DSLTAGV G++ IGE  +
Sbjct  1023  DSLTAGVMGLMCIGENDK  1040

>CCA18898
Length=1147

 Score = 496 bits (1276),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 283/735 (39%), Positives = 424/735 (58%), Gaps = 73/735 (10%)

Query  11    SLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVPLAYVDGQRLL  70
             S H F IH+G   R   +F SF   A ++W +VEE +  LE LL+ YF+P+A+++GQR+L
Sbjct  376   SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRIL  435

Query  71    SLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQAFVrmwaarr  130
             +L+       + R+LLSC+ NE +V   L +PGQR++G ++  RAA  +Q+F+RM   RR
Sbjct  436   TLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRR  495

Query  131   ryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRLKSQWAQIASH  190
              Y    +       IQ  WR Y+ + A K ++  +R  Q   +   M    S W +I + 
Sbjct  496   TYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQ  555

Query  191   RRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVSPFELTTDVSQ  250
             RR V+H+PS+S+D   R+  E  +++QNLQL R+CA  +D  V+L +Y+ PFELT D+ Q
Sbjct  556   RRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIVQ  613

Query  251   YFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIRHYTAGKEAYL  310
             Y++KLLQL G++D+  R+KL+ PE A+RFP+HFSLS+++L SPH ++R+  Y  G+ AYL
Sbjct  614   YYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYL  673

Query  311   VMGLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPAGTYELYDEHE  370
             V G PG ED+RLA  L +PILG  PA+   + T SG KR   + + N   G+ +LYDE+E
Sbjct  674   VPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENE  733

Query  371   LFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKRTPEYWRQPGP  430
             L  +LAKL  A+  Q   + KLDYDP   G A+VD+S +Q+++ LR   RT +YWRQP  
Sbjct  734   LIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPI  793

Query  431   RDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAVPLTAIAVTPE  490
             ++   + ++ E++    ++ L   V+ +++PSW  F +AI  +G VIE  P         
Sbjct  794   QNKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKN-------  844

Query  491   TSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNR----------------RTV  534
                      Y+RANLF++P   V ++ST   L+      N                 RT+
Sbjct  845   ------RQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTI  898

Query  535   AFTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPF  594
              FTFPQT   HE +K A    G+ L +  + GY+S+DF+V  DD++     L+A+A+ PF
Sbjct  899   GFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-LYAMALQPF  957

Query  595   LTDSAASFACFHLLAR-GVLDANSGVYRM--------AAASTP-----------------  628
             LT+SAASF+ F  L+R G  ++ +G++ +          + TP                 
Sbjct  958   LTNSAASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSDTPSSSSLSATDLMIREARL  1017

Query  629   -------------RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLAD  675
                          R +V+  YV +P+V T+ Y +FF  CR  GV FD+ER +GT+FLLAD
Sbjct  1018  SGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLAD  1077

Query  676   SLTAGVFGVLSIGET  690
             SLTAGV G++ I +T
Sbjct  1078  SLTAGVLGIMCISDT  1092

>CCI45122
Length=1105

 Score = 487 bits (1254),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 290/732 (40%), Positives = 418/732 (57%), Gaps = 73/732 (10%)

Query  13    HQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVPLAYVDGQRLLSL  72
             + F+IH+G   R  PEF +F R+A  +W SV+  L AL  +L+ YF+P+AY++GQR+L+L
Sbjct  338   YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397

Query  73    AATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQAFVrmwaarrry  132
             A       + ++L+SCI NE++V   L +PGQR++G +R +RA   +Q+F+RM   R+R+
Sbjct  398   AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457

Query  133   arsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRLKSQWAQIASHRR  192
                R +    T IQ  WR +S H A K ++   R  Q   +   M    S W +I   RR
Sbjct  458   LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517

Query  193   VVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVSPFELTTDVSQYF  252
              ++H+PS+S+D   R+  E  +++QNLQL R+CA  +D  V+L +Y+ PFELT D+ QY+
Sbjct  518   TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAV-IDENVEL-IYICPFELTDDIVQYY  575

Query  253   IKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVM  312
             +KLLQLGG++D+  R+KL+ PE A+RFP+HFSLSS++LYSP  L R+     G+ AY+V 
Sbjct  576   MKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVP  635

Query  313   GLPGAEDQRLAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPAGTYELYDEHELF  372
             G PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +LYDE+EL 
Sbjct  636   GFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELI  695

Query  373   SALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRD  432
              +LAKL  +H  Q   + +LDYDP G G A++D+S +Q+++E+R   +T E W QP    
Sbjct  696   FSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQP---P  752

Query  433   AAAKLVLT-ELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAVPLTAIAVTPET  491
               AKL+    LE    ++     VH +IFPS   F +AI  +G +IE  P          
Sbjct  753   IQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK--------  804

Query  492   STALLEPAYIRANLFVDPDGSVHVTST--LNMLATGGG--------GLNR------RTVA  535
                     ++RANLF++P   V V+ST  ++ L T           GL++      RT  
Sbjct  805   -----RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFG  859

Query  536   FTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFL  595
              TFPQT   HE +K A  A G+ L +  + GY+S+DFVV  DD++     L+A  + PFL
Sbjct  860   VTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYATGLQPFL  918

Query  596   TDSAASFACFHLLARG---------------------------VLDAN---------SGV  619
             T++AASFA F LL+RG                            L A          SG+
Sbjct  919   TNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIREARLSGI  978

Query  620   YRMAAASTP-RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLT  678
                    TP R + +  YV +P V T+  ++FF  CR  GV FD ER  GT+FLLADSLT
Sbjct  979   VSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLT  1038

Query  679   AGVFGVLSIGET  690
             AGVFG++ I +T
Sbjct  1039  AGVFGIMCISDT  1050

>PHYKE_8394
Length=428

 Score = 332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 193/231 (84%), Gaps = 27/231 (12%)

Query  202  LDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVSPFELTTDVSQYFIKLLQLGGL  261
            LD Y+    EN AV+QNLQLTRICAAALDS VDLLVYVSPFELT DVSQYF+KLLQLGGL
Sbjct  173  LDAYT----ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGL  228

Query  262  ADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQR  321
            ADSRPRVKL+FPEQA RFP                        GK+AYLVMGLPGAEDQR
Sbjct  229  ADSRPRVKLVFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQR  265

Query  322  LAMTLDlpilgappaqalpllTRSGGKRLLIRADVNVPAGTYELYDEHELFSALAKLAVA  381
            LA+ LDLPILGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYD+HELF+ALAKLAV 
Sbjct  266  LAIALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVT  325

Query  382  HMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRD  432
            HMDQP+WL KLDYDPLGVGEA++DLSGMQAMRELRREKR PEYWRQPGPRD
Sbjct  326  HMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 1/37 (3%)

Query  513  VHVTSTLNMLATGGGGLNRRTVAFTFPQTAAPHEAVK  549
            VHVTST N+LA+G G LNR+TVA+TFPQTAAPHEAVK
Sbjct  390  VHVTSTQNVLASGSG-LNRKTVAYTFPQTAAPHEAVK  425

>PYAR_13581
Length=730

 Score = 280 bits (715),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 205/294 (70%), Gaps = 28/294 (10%)

Query  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVeealraletlltHYFVP  60
            RGYNELLD YSLHQF+IHKGR MR+TPEF SF RV QE+WG+V+E +RALE LLT YF+ 
Sbjct  92   RGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYFMA  151

Query  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120
                               F    LLSC+VNE+QV + LRRPGQRYKG+DRKRRAATT+Q
Sbjct  152  ------------------SFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQ  193

Query  121  AFVrmwaarrryarsrarDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180
            AF RM   R R+ R   R  +ATRIQ  WR ++   +L+  L   R EQL  W+ +M RL
Sbjct  194  AFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARL  253

Query  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240
            +SQW +I++ RRVVVHVPSLSLDE++R+S ++ AV+QNLQL R+ AA +D+ V+ +VYVS
Sbjct  254  RSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARL-AAVVDATVEYVVYVS  312

Query  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPH  294
            PFEL TD+S          G+A++  RVK++ PE A  FP HFSL++ LLYSPH
Sbjct  313  PFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPH  357

 Score = 168 bits (425),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 140/270 (52%), Gaps = 28/270 (10%)

Query  402  AVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFP  461
            A++D+S +  +RE+RR  + P YW+QPG RD  A+ +L ELER   +  LA P H + FP
Sbjct  389  ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446

Query  462  SWLEFAEAIGHFGCVIEAVPLTAIAVTPETSTALLEPAYIRANLFVDP-----DGSVHVT  516
             W  FA+AIG  G VIEA+P     V             +R N+FV P     D  V V 
Sbjct  447  DWRAFAQAIGRDGVVIEALPARVRGV-------------VRVNIFVTPASSDHDADVPVV  493

Query  517  STLNMLATGGGGLNRRTVAFTFPQTAAPHEAVKGACSAAGKLLVETNVW-GYVSLDFVVF  575
            ST   L    G   R  +AF  PQT  PH+AV GA  A G+LL E   + GY S+D  + 
Sbjct  494  STQEALRASAG---RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLC  550

Query  576  QDDKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDANSGVYRMAAASTPRCFVVCS  635
            +D+ S     L+ L      T +  S A   +L    L A S     + +++PRCFV   
Sbjct  551  RDETSG----LYLLPSPAVDTSAPLSPATPLVLQEAHLLARSSRPLASPSASPRCFVSVD  606

Query  636  YVFHPHVTTMQYTAFFHACRLHGVCFDVER  665
            +  HP++ TM   AFF ACR  GVCFDV R
Sbjct  607  WAVHPNLCTMPTAAFFLACRRRGVCFDVTR  636

>PYAP_15149
Length=2066

 Score = 34.7 bits (78),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 60/141 (43%), Gaps = 18/141 (13%)

Query  543  APHEAVKGACSAAGKLLVETNVWGYVSLDFV------VFQDDKSNGAPRLWALAVH--PF  594
            +P+E +  +C A G +     +W YVS D +      V   D+++ A   W        +
Sbjct  472  SPYEHLAASCGADGSV----RLWDYVSRDCLFAASTTVLTQDETDTASVTWTAEASCIAW  527

Query  595  LTDSAASFACFHLLA--RGVLDANSGVYRMAAASTPRCFVVCSYVFHPHVTTMQYTAFFH  652
            + ++AA     H++   + V+  + G+ R+  A   R   V + VF PH   +   +F H
Sbjct  528  VPNAAAMLTEPHIVKSRQVVVGFSDGLVRVFLADLARKTFVRTNVFKPHRKRVTAASFSH  587

Query  653  ACRLHGVCFDVERTLGTLFLL  673
            +    GV         T+FL 
Sbjct  588  S----GVYLATASADTTVFLF  604

>PYU1_G002173
Length=368

 Score = 33.1 bits (74),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 13/109 (12%)

Query  368  EHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKRTPEYWRQ  427
            E ++      L +   D P W F +DY+ L   E+   L   QA  EL    R  E W +
Sbjct  225  EPKVVGVATSLGMNESDLPGWFFSVDYE-LESAESQKTL--YQAALELFSLLRDEECWTR  281

Query  428  PGPRDAAAKLVLTELERPGTLAR--------LAMPVHKDIFPSWLEFAE  468
               +D+  +   T +E P TLA          A   H  +F +WL+  E
Sbjct  282  --DKDSFPRSSYTSIELPHTLANSDESRSEFFARNGHLVLFSAWLQHPE  328

>PHYCA_126329
Length=150

 Score = 31.6 bits (70),  Expect = 8.5, Method: Composition-based stats.
 Identities = 17/55 (31%), Positives = 23/55 (42%), Gaps = 4/55 (7%)

Query  615  ANSGVYRMAAASTPRCFVVCSYVFHPHVTTMQYTAF-FHACRLHGVCFDVERTLG  668
            +N G+      S  RC   CS+  H  +  +   A  F  CR  G CFD    +G
Sbjct  78   SNDGIMTGCVGSARRC---CSFSVHYQMYALNVQAICFSLCRFTGYCFDSPGKVG  129

Lambda      K        H        a         alpha
   0.324    0.136    0.413    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 54774396942

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40