Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_14729371301791797402e-100
PHYCA_20546376811921796743e-90
PHYCA_16319373032062065703e-74
PHYCA_21815378183031181092e-05
PPTG_056611969425361692.8
PITG_0060354518086665.7
PYAR_2320310511680268668.5
PYIW_197823485138056669.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_14729

Length=179
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_14729                                                           289        2e-100
PHYCA_20546                                                           264        3e-90 
PHYCA_16319                                                           224        3e-74 
PHYCA_21815                                                           46.6       2e-05 
PPTG_05661                                                            31.2       2.8   
PITG_00603                                                            30.0       5.7   
PYAR_23203                                                            30.0       8.5   
PYIW_19782                                                            30.0       9.7   

>PHYCA_14729
Length=179

 Score = 289 bits (740),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)

Query  1    MKLDGPDEENLTTFDEATGTVIVGSAVVTDWTdelledakerdeeraaVYLATVHPAMAS  60
            MKLDGPDEENLTTFDEATGTVIVGSAVVTDWTDELLEDAKERDEERAAVYLATVHPAMAS
Sbjct  1    MKLDGPDEENLTTFDEATGTVIVGSAVVTDWTDELLEDAKERDEERAAVYLATVHPAMAS  60

Query  61   ARFSWeereeaqrrrsaeLKRRILELERSGEGANRLRTGEGATVTDEAKVLDEDSGTVTV  120
            ARFSWEEREEAQRRRSAELKRRILELERSGEGANRLRTGEGATVTDEAKVLDEDSGTVTV
Sbjct  61   ARFSWEEREEAQRRRSAELKRRILELERSGEGANRLRTGEGATVTDEAKVLDEDSGTVTV  120

Query  121  ENEVTSEYENGTVEVLSGTENDSKNDGRYGNSSVAAVDTSSGSDELVKHPNRKGKKNDG  179
            ENEVTSEYENGTVEVLSGTENDSKNDGRYGNSSVAAVDTSSGSDELVKHPNRKGKKNDG
Sbjct  121  ENEVTSEYENGTVEVLSGTENDSKNDGRYGNSSVAAVDTSSGSDELVKHPNRKGKKNDG  179

>PHYCA_20546
Length=192

 Score = 264 bits (674),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)

Query  1    MKLDGPDEENLTTFDEATGTVIVGSAVVTDWTdelledakerdeeraaVYLATVHPAMAS  60
            MKLDGPDEENLTT +EATGTVIVGSAVVTDWTDELLEDAKERDEERAAVYLATVHPAMAS
Sbjct  1    MKLDGPDEENLTTVNEATGTVIVGSAVVTDWTDELLEDAKERDEERAAVYLATVHPAMAS  60

Query  61   ARFSWeereeaqrrrsaeLKRRILELERSGEGANRLRTGEGATVTDEAKVLDEDSGTVTV  120
            ARFSWEEREEAQRRRSAELKRRILELERSGEGANRLRTGEGATVTDEAK LDEDSGTVT+
Sbjct  61   ARFSWEEREEAQRRRSAELKRRILELERSGEGANRLRTGEGATVTDEAKALDEDSGTVTI  120

Query  121  ENEVTSEYENGTVEVLSGTENDSKNDGRYGNSSVAAVDTSSGSDELVKHPNRKGKKNDG  179
            E+EVTSEYE+GTVEVLSGT NDSKNDGR GN SVAAVDTSSGSDELVKHPN K KKNDG
Sbjct  121  EDEVTSEYESGTVEVLSGTGNDSKNDGRNGNGSVAAVDTSSGSDELVKHPNAKDKKNDG  179

>PHYCA_16319
Length=206

 Score = 224 bits (570),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 162/206 (79%), Gaps = 27/206 (13%)

Query  1    MKLDGPDEENLTTFDEATGTVIVGSAVVTDWTdelledakerdeeraaVYLATVHPAMAS  60
            MK DGPDEENLTTFDEATGTVIVGS VVTDWTDELLEDA+ERD ERAAVYLATVHPAMAS
Sbjct  1    MKTDGPDEENLTTFDEATGTVIVGSTVVTDWTDELLEDARERDAERAAVYLATVHPAMAS  60

Query  61   ARFSWeereeaqrrrsaeLKRRILELERSGEGANRLRTGEGATVTDEAKVLDEDSGTVTV  120
            ARFSWEEREEAQRRRSAELKRRILELERS EGANRLRTGEGATVTD A+ LDEDSGTVT 
Sbjct  61   ARFSWEEREEAQRRRSAELKRRILELERSKEGANRLRTGEGATVTDGAETLDEDSGTVTS  120

Query  121  ENEVTSEYENGTVEVLSGTENDSKNDGRYGNSSVAAVDTSS-------------------  161
            E+EV  E  +GTVEVLS  ++D KNDG  GNSS+AAVDTSS                   
Sbjct  121  ESEVIPEDVSGTVEVLSALDDDGKNDGGNGNSSIAAVDTSSSGDTDGNGNTSCGNGTDKE  180

Query  162  --------GSDELVKHPNRKGKKNDG  179
                    GSDELVKHPN KGKKNDG
Sbjct  181  LQLSRRAPGSDELVKHPNGKGKKNDG  206

>PHYCA_21815
Length=303

 Score = 46.6 bits (109),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 63/118 (53%), Gaps = 15/118 (13%)

Query  1    MKLDGPDEENLTTFDEATGTVIVGSAVVTDWTdelledakerdeeraaVYLATVHPAM-A  59
            MK+ G D+E+LTT D  T TV+VG   V DW DE+  DA++RDEE+AAV+  T      A
Sbjct  170  MKVGGSDDEDLTTVDLTTRTVVVGKTRVLDWMDEMQYDAEQRDEEQAAVFPETNEKTCDA  229

Query  60   SARFSWeereeaqrrrsaeLKRRILELERSGEGANRLRTGEGATVTDEAKVLDEDSGT  117
              R  W E+            R  LEL   G+  N L  GEGATV     V +ED GT
Sbjct  230  DDRPDWCEK-----------PRECLEL---GKAQNSLNLGEGATVVGGTVVGNEDGGT  273

>PPTG_05661
Length=253

 Score = 31.2 bits (69),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 34/61 (56%), Gaps = 7/61 (11%)

Query  3   LDGPDEENLTTFDEATGTVIVGSAVVTDWTdelledakerdeeraaVYLATVHPAMASAR  62
           LDG +E+ +  +  A+G          +W   + +D    D+ERAA Y+ TV PAMASA+
Sbjct  31  LDGHNEKAVPRYSSASGEP-------HEWVKRMKKDEASYDKERAARYVMTVRPAMASAK  83

Query  63  F  63
           F
Sbjct  84  F  84

>PITG_00603
Length=180

 Score = 30.0 bits (66),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query  49   VYLATVHPAMASARFSWeereeaqrrrsaeL--KRRILELERSGEGANRLRTGEGATVTD  106
            ++++TV PAMASAR+ +    + Q+     L  KR      ++GEGA  L   +  T   
Sbjct  89   IHVSTVRPAMASARYKYAASADQQQNEGCGLDGKR------QTGEGAY-LSAPQSETNDG  141

Query  107  EAKVLDEDSGTVTVENEVTSEYENGT  132
            E K + E S +  V  E  +E E+ T
Sbjct  142  EVKSIGELSVSTVVRRETMAEAEDTT  167

>PYAR_23203
Length=802

 Score = 30.0 bits (66),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query  91   EGANRLRTGEGATVTDEAKVLDEDSGTVTVENEVTSEYENGTVEVLSGTENDSKNDGRYG  150
            +G   L+  E   VT +    +ED+G V ++  + SE  NG +   SGT    +N+   G
Sbjct  438  DGETNLKLREAPRVTRQMFEAEEDAGEV-LQGYLESEMPNGDINRYSGTLYIEENESVTG  496

Query  151  NSSVAAVD  158
             SS+  VD
Sbjct  497  RSSLKKVD  504

>PYIW_19782
Length=1380

 Score = 30.0 bits (66),  Expect = 9.7, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 31/56 (55%), Gaps = 5/56 (9%)

Query  99   GEGATVTDEAKVLDEDSGTVTVENEVTSEYENGTVEVLSGTEN--DSKNDGRYGNS  152
             EG +  DEAK  DE++G    E + + + E+G  E  SG EN  ++ ++G  G S
Sbjct  820  AEGNSAEDEAKSEDEEAGD---EEQDSGDNEDGGQEEESGDENEHEASHEGDEGES  872

Lambda      K        H        a         alpha
   0.305    0.125    0.344    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7175439843

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40