Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_131593825425411162e-155
PPTG_0793282892426342e-81
PITG_0001081841495693e-73
PPTG_2494177543801714786e-57
PHYCA_12080742397134993994e-48
PHYCA_504729440671831194026e-48
PHYCA_11211841626134993882e-46
PHYCA_49721384681031003801e-45
PHYCA_70656392411131113662e-43
PPTG_1466322920146983492e-40
PHYCA_559326453551821193462e-39
PPTG_06351199722251993474e-39
PPTG_2167826348104802792e-30
PPTG_0333875282602232894e-30
PITG_0907275282612232885e-30
PHYRA_7808875282612232851e-29
PHYSO_36201775282732262834e-29
PHYCA_53024375282692202791e-28
H310_097651498671151032113e-20
H310_052931489191431022091e-19
H310_1330668102311082132e-19
PPTG_0379119179108581991e-18
H310_152921516152301082027e-18
H310_046841487961081051894e-17
H310_14146151053109961894e-17
PYAP_15403984871141011885e-17
H310_083391495022301021932e-16
HYAP_1401068103032471952e-16
H310_025611483322561051923e-16
PHYCA_21476377821341281835e-16
H310_06933149217259961898e-16
PPTG_1426468103351011911e-15
SDRG_15163151732921161882e-15
H257_0615281501041812e-15
H310_117551279882591001862e-15
SPRG_0885484121001876e-15
SDRG_1367884151001867e-15
PITG_0817268103201011857e-15
H310_152911516142341071818e-15
SPRG_1416015173319941831e-14
CCA1434668103251281831e-14
H310_041201486681381001732e-14
PHYSO_38364868103191011793e-14
H310_09373149719109981693e-14
PHALS_0885768103521011804e-14
PHYCA_51041568103371011777e-14
H310_128941507262571001722e-13
H310_078491493931921001692e-13
PHYKE_158868103331011742e-13
H257_076411414641871001682e-13
H257_15222127988254991694e-13
H257_094346810257951679e-13
H310_131061507792131041651e-12
SPRG_113201279882741001662e-12
PYVX_1371968103171051672e-12
PHYRA_7865668103471051653e-12
H257_191041475292141041597e-12
H310_147381512712551021572e-11
SPRG_060301250931961161472e-10
SPRG_18521133223291911502e-10
SPRG_085731264412651031493e-10
SPRG_05316124701325911494e-10
SDRG_174061264412641031484e-10
SDRG_173901384462641031484e-10
SDRG_06597124701317911486e-10
SPRG_059291250402651031466e-10
PYU1_G004359940552372281403e-09
H310_14414151141169901365e-09
PPTG_1136821782130971311e-08
PHYCA_5106064455674981252e-08
H310_090711496731121031282e-08
H310_1058115173241911333e-08
PHYCA_10416540824231931315e-08
H257_03945139940230871306e-08
H257_15150145202145931267e-08
H310_12832147529258991281e-07
H257_15235145259178821252e-07
H257_13170144141198991252e-07
PHYCA_6275139088116981212e-07
H257_14889145060157851214e-07
H257_09054142124151891206e-07
H257_02519139347268911237e-07
PHYCA_9638540009135911187e-07
H257_16670146013136991187e-07
H257_14013144554217931228e-07
PHYSO_470381564381451011189e-07
H310_14154151059178431191e-06
PHYSO_376280539901381011171e-06
H310_15369151671209481201e-06
H257_0625315173237851211e-06
PHYKE_61627528201421191e-06
PYAP_24609101386405961221e-06
SDRG_12398126788264921212e-06
SPRG_09172126788265921212e-06
H310_127141506653771001212e-06
H310_04124148672811021112e-06
PHYSO_453976559621381011152e-06
PHYSO_254181462881541011153e-06
H257_049481403342471021183e-06
H257_04778140245147861143e-06
PHYSO_380505541561381011143e-06
CCI4749568102851001184e-06
H310_03385148533223921164e-06
PHYCA_132727435852611101157e-06
H257_18023146763128931117e-06
H310_149541513621491011127e-06
PHYSO_5480724947362971168e-06
PHYSO_32576350528157971128e-06
H257_18152150419209921131e-05
PHYCA_11835042180156911101e-05
PHYSO_37361353883130991091e-05
H257_03208139630105611071e-05
H310_11608150339221991121e-05
PYIW_25658165168148731091e-05
PHYSO_435001556281381011082e-05
H257_19436147818199821102e-05
PHYSO_5364564370212431102e-05
H310_13569138769205931102e-05
H257_05648140669172891083e-05
H257_139784945172721084e-05
PHYKE_40014947496921114e-05
H257_08032126788251871094e-05
PPTG_02416186271251041045e-05
H257_13889144500138841046e-05
PHYSO_44811255854115871036e-05
PPTG_14366228272831051087e-05
PHYSO_49278757729130871037e-05
PHYSO_37714054024105871028e-05
PYIW_25568165102126611038e-05
PHYCA_14089370601991011068e-05
PPTG_1608323457241841061e-04
H310_13824150948169551041e-04
PYIW_263631656851441011021e-04
H257_19019147462229851051e-04
H310_04318148723179421032e-04
PITG_1268610320223901023e-04
H310_04215126788257871033e-04
H257_00956138769202891013e-04
H257_18551147094221841023e-04
PITG_1909815173295901033e-04
PYAP_22661100509218701013e-04
H310_128211506921791021003e-04
H257_076571414752121041013e-04
PHYRA_758774947406991034e-04
PPTG_0663320057292821024e-04
H310_1489815133914041984e-04
H257_1740213074714992984e-04
PHYSO_33009751135203941005e-04
H257_1232514369519192995e-04
PPTG_0379719183210811006e-04
PHYCA_50383349473131051016e-04
PHYCA_3898337995217901006e-04
SPRG_00310122252254431006e-04
PPTG_002724947436921016e-04
H257_13434144330236921006e-04
H310_1531914198422792997e-04
PHYCA_482815173295901007e-04
PHYCA_9897140275295901008e-04
PHYSO_2958194812419391988e-04
H257_0037713860222392989e-04
PHYCA_1256864278529099990.001
HYAP_006304945432101990.001
H257_0775514151518183960.001
PHYCA_124712437020242960.002
PPTG_041181926227476960.002
PITG_05131437020045950.002
PPTG_06289437024055950.002
PHYSO_37873154080138101920.002
PYVX_238859407326156940.004
H257_1854314708932342940.005
H257_1475914495919892910.006
H310_1506815145010891880.006
PITG_05827494736497930.006
SDRG_172941383856844850.007
H310_1384315095311845880.007
H257_0787114156520193910.008
PHYRA_758844970943291920.008
H257_1684514612120963910.008
PITG_08385696820437900.009
H257_0718214124720963900.010
SPRG_1804513278621543900.010
PHYRA_868567330039191920.010
PYAR_2470010589115488880.010
PHYRA_75881494539191910.011
PPTG_112832175026080900.011
PPTG_046011941926080900.012
PYIW_1563716371627285900.012
PHYSO_3407905272927087900.013
H257_1070714290821342890.014
PYAR_204499973723188890.015
PHYCA_1292304312114143870.015
PPTG_067232008814970860.019
PYU1_G0087289548223485880.020
H257_1723514632618685870.020
SDRG_0465312770024370880.023
PHYSO_25977546736213171870.023
PPTG_058431976016990860.024
H310_1516114433023692870.025
PPTG_085002082528580880.025
PPTG_22223268533718790.025
PHYSO_4741015665616643860.025
H257_0883914198615838850.031
PYAP_177001269328495870.036
H257_14499144807170103840.039
H310_0422614405023690860.040
H310_0447414876321090850.040
PYIW_1505816301413136830.044
H310_1025715001130924860.045
H257_0883714198422592840.056
PYAR_163239946280381860.057
SDRG_1726613836027884850.062
H257_0199413911222287840.063
H310_1407513860221790840.065
SDRG_1549913785727884840.067
H257_1865414717316240820.074
H257_0179213902916240820.074
H310_1187515041917246820.077
PPTG_169642373910481790.081
H310_15160151514200100820.091
PYU1_G0106969621529794830.100
PITG_05825494541091830.12
H310_034631485495292750.12
PYIW_2715916644810687780.13
PYAP_201699973723361810.17
H257_1321214418115384790.17
PPTG_1578723348126104780.19
PPTG_002704970924984800.25
H257_0535614052022492790.26
PPTG_079512067328587790.28
PYIW_2403116417928194790.30
PHYSO_3892685437810761750.32
H257_1299814405014196760.33
H257_001651269343478790.34
H257_1530212913934454790.37
H310_1186815041711788750.38
H257_1194214347223284780.42
PPTG_1528146288148104760.43
H310_1430114224024794770.47
H257_1232314369317878760.55
CCI4812615613836487770.59
PPTG_111442171125182770.60
H257_194881478625630700.64
H310_0486814883523886760.65
H257_1322214419118978750.69
PPTG_00266494543784770.73
H310_06262149090226101750.83
H257_1454614483418759740.86
SDRG_0869913643916835740.93
H310_0430814872014543731.0
PHYSO_389597792618898741.1
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_131593

Length=254
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_131593                                                          434        2e-155
PPTG_07932                                                            248        2e-81 
PITG_00010                                                            223        3e-73 
PPTG_24941                                                            188        6e-57 
PHYCA_120807                                                          158        4e-48 
PHYCA_504729                                                          159        6e-48 
PHYCA_112118                                                          154        2e-46 
PHYCA_49721                                                           150        1e-45 
PHYCA_70656                                                           145        2e-43 
PPTG_14663                                                            139        2e-40 
PHYCA_559326                                                          137        2e-39 
PPTG_06351                                                            138        4e-39 
PPTG_21678                                                            112        2e-30 
PPTG_03338                                                            115        4e-30 
PITG_09072                                                            115        5e-30 
PHYRA_78088                                                           114        1e-29 
PHYSO_362017                                                          113        4e-29 
PHYCA_530243                                                          112        1e-28 
H310_09765                                                            85.9       3e-20 
H310_05293                                                            85.1       1e-19 
H310_13306                                                            86.7       2e-19 
PPTG_03791                                                            81.3       1e-18 
H310_15292                                                            82.4       7e-18 
H310_04684                                                            77.4       4e-17 
H310_14146                                                            77.4       4e-17 
PYAP_15403                                                            77.0       5e-17 
H310_08339                                                            79.0       2e-16 
HYAP_14010                                                            79.7       2e-16 
H310_02561                                                            78.6       3e-16 
PHYCA_21476                                                           75.1       5e-16 
H310_06933                                                            77.4       8e-16 
PPTG_14264                                                            78.2       1e-15 
SDRG_15163                                                            77.0       2e-15 
H257_06152                                                            74.3       2e-15 
H310_11755                                                            76.3       2e-15 
SPRG_08854                                                            76.6       6e-15 
SDRG_13678                                                            76.3       7e-15 
PITG_08172                                                            75.9       7e-15 
H310_15291                                                            74.3       8e-15 
SPRG_14160                                                            75.1       1e-14 
CCA14346                                                              75.1       1e-14 
H310_04120                                                            71.2       2e-14 
PHYSO_383648                                                          73.6       3e-14 
H310_09373                                                            69.7       3e-14 
PHALS_08857                                                           73.9       4e-14 
PHYCA_510415                                                          72.8       7e-14 
H310_12894                                                            70.9       2e-13 
H310_07849                                                            69.7       2e-13 
PHYKE_1588                                                            71.6       2e-13 
H257_07641                                                            69.3       2e-13 
H257_15222                                                            69.7       4e-13 
H257_09434                                                            68.9       9e-13 
H310_13106                                                            68.2       1e-12 
SPRG_11320                                                            68.6       2e-12 
PYVX_13719                                                            68.9       2e-12 
PHYRA_78656                                                           68.2       3e-12 
H257_19104                                                            65.9       7e-12 
H310_14738                                                            65.1       2e-11 
SPRG_06030                                                            61.2       2e-10 
SPRG_18521                                                            62.4       2e-10 
SPRG_08573                                                            62.0       3e-10 
SPRG_05316                                                            62.0       4e-10 
SDRG_17406                                                            61.6       4e-10 
SDRG_17390                                                            61.6       4e-10 
SDRG_06597                                                            61.6       6e-10 
SPRG_05929                                                            60.8       6e-10 
PYU1_G004359                                                          58.5       3e-09 
H310_14414                                                            57.0       5e-09 
PPTG_11368                                                            55.1       1e-08 
PHYCA_510606                                                          52.8       2e-08 
H310_09071                                                            53.9       2e-08 
H310_10581                                                            55.8       3e-08 
PHYCA_104165                                                          55.1       5e-08 
H257_03945                                                            54.7       6e-08 
H257_15150                                                            53.1       7e-08 
H310_12832                                                            53.9       1e-07 
H257_15235                                                            52.8       2e-07 
H257_13170                                                            52.8       2e-07 
PHYCA_62751                                                           51.2       2e-07 
H257_14889                                                            51.2       4e-07 
H257_09054                                                            50.8       6e-07 
H257_02519                                                            52.0       7e-07 
PHYCA_96385                                                           50.1       7e-07 
H257_16670                                                            50.1       7e-07 
H257_14013                                                            51.6       8e-07 
PHYSO_470381                                                          50.1       9e-07 
H310_14154                                                            50.4       1e-06 
PHYSO_376280                                                          49.7       1e-06 
H310_15369                                                            50.8       1e-06 
H257_06253                                                            51.2       1e-06 
PHYKE_6162                                                            50.4       1e-06 
PYAP_24609                                                            51.6       1e-06 
SDRG_12398                                                            51.2       2e-06 
SPRG_09172                                                            51.2       2e-06 
H310_12714                                                            51.2       2e-06 
H310_04124                                                            47.4       2e-06 
PHYSO_453976                                                          48.9       2e-06 
PHYSO_254181                                                          48.9       3e-06 
H257_04948                                                            50.1       3e-06 
H257_04778                                                            48.5       3e-06 
PHYSO_380505                                                          48.5       3e-06 
CCI47495                                                              50.1       4e-06 
H310_03385                                                            49.3       4e-06 
PHYCA_132727                                                          48.9       7e-06 
H257_18023                                                            47.4       7e-06 
H310_14954                                                            47.8       7e-06 
PHYSO_548072                                                          49.3       8e-06 
PHYSO_325763                                                          47.8       8e-06 
H257_18152                                                            48.1       1e-05 
PHYCA_118350                                                          47.0       1e-05 
PHYSO_373613                                                          46.6       1e-05 
H257_03208                                                            45.8       1e-05 
H310_11608                                                            47.8       1e-05 
PYIW_25658                                                            46.6       1e-05 
PHYSO_435001                                                          46.2       2e-05 
H257_19436                                                            47.0       2e-05 
PHYSO_536456                                                          47.0       2e-05 
H310_13569                                                            47.0       2e-05 
H257_05648                                                            46.2       3e-05 
H257_13978                                                            46.2       4e-05 
PHYKE_4001                                                            47.4       4e-05 
H257_08032                                                            46.6       4e-05 
PPTG_02416                                                            44.7       5e-05 
H257_13889                                                            44.7       6e-05 
PHYSO_448112                                                          44.3       6e-05 
PPTG_14366                                                            46.2       7e-05 
PHYSO_492787                                                          44.3       7e-05 
PHYSO_377140                                                          43.9       8e-05 
PYIW_25568                                                            44.3       8e-05 
PHYCA_14089                                                           45.4       8e-05 
PPTG_16083                                                            45.4       1e-04 
H310_13824                                                            44.7       1e-04 
PYIW_26363                                                            43.9       1e-04 
H257_19019                                                            45.1       1e-04 
H310_04318                                                            44.3       2e-04 
PITG_12686                                                            43.9       3e-04 
H310_04215                                                            44.3       3e-04 
H257_00956                                                            43.5       3e-04 
H257_18551                                                            43.9       3e-04 
PITG_19098                                                            44.3       3e-04 
PYAP_22661                                                            43.5       3e-04 
H310_12821                                                            43.1       3e-04 
H257_07657                                                            43.5       3e-04 
PHYRA_75877                                                           44.3       4e-04 
PPTG_06633                                                            43.9       4e-04 
H310_14898                                                            42.4       4e-04 
H257_17402                                                            42.4       4e-04 
PHYSO_330097                                                          43.1       5e-04 
H257_12325                                                            42.7       5e-04 
PPTG_03797                                                            43.1       6e-04 
PHYCA_503833                                                          43.5       6e-04 
PHYCA_38983                                                           43.1       6e-04 
SPRG_00310                                                            43.1       6e-04 
PPTG_00272                                                            43.5       6e-04 
H257_13434                                                            43.1       6e-04 
H310_15319                                                            42.7       7e-04 
PHYCA_4828                                                            43.1       7e-04 
PHYCA_98971                                                           43.1       8e-04 
PHYSO_295819                                                          42.4       8e-04 
H257_00377                                                            42.4       9e-04 
PHYCA_125686                                                          42.7       0.001 
HYAP_00630                                                            42.7       0.001 
H257_07755                                                            41.6       0.001 
PHYCA_124712                                                          41.6       0.002 
PPTG_04118                                                            41.6       0.002 
PITG_05131                                                            41.2       0.002 
PPTG_06289                                                            41.2       0.002 
PHYSO_378731                                                          40.0       0.002 
PYVX_23885                                                            40.8       0.004 
H257_18543                                                            40.8       0.005 
H257_14759                                                            39.7       0.006 
H310_15068                                                            38.5       0.006 
PITG_05827                                                            40.4       0.006 
SDRG_17294                                                            37.4       0.007 
H310_13843                                                            38.5       0.007 
H257_07871                                                            39.7       0.008 
PHYRA_75884                                                           40.0       0.008 
H257_16845                                                            39.7       0.008 
PITG_08385                                                            39.3       0.009 
H257_07182                                                            39.3       0.010 
SPRG_18045                                                            39.3       0.010 
PHYRA_86856                                                           40.0       0.010 
PYAR_24700                                                            38.5       0.010 
PHYRA_75881                                                           39.7       0.011 
PPTG_11283                                                            39.3       0.011 
PPTG_04601                                                            39.3       0.012 
PYIW_15637                                                            39.3       0.012 
PHYSO_340790                                                          39.3       0.013 
H257_10707                                                            38.9       0.014 
PYAR_20449                                                            38.9       0.015 
PHYCA_129230                                                          38.1       0.015 
PPTG_06723                                                            37.7       0.019 
PYU1_G008728                                                          38.5       0.020 
H257_17235                                                            38.1       0.020 
SDRG_04653                                                            38.5       0.023 
PHYSO_259775                                                          38.1       0.023 
PPTG_05843                                                            37.7       0.024 
H310_15161                                                            38.1       0.025 
PPTG_08500                                                            38.5       0.025 
PPTG_22223                                                            35.0       0.025 
PHYSO_474101                                                          37.7       0.025 
H257_08839                                                            37.4       0.031 
PYAP_17700                                                            38.1       0.036 
H257_14499                                                            37.0       0.039 
H310_04226                                                            37.7       0.040 
H310_04474                                                            37.4       0.040 
PYIW_15058                                                            36.6       0.044 
H310_10257                                                            37.7       0.045 
H257_08837                                                            37.0       0.056 
PYAR_16323                                                            37.7       0.057 
SDRG_17266                                                            37.4       0.062 
H257_01994                                                            37.0       0.063 
H310_14075                                                            37.0       0.065 
SDRG_15499                                                            37.0       0.067 
H257_18654                                                            36.2       0.074 
H257_01792                                                            36.2       0.074 
H310_11875                                                            36.2       0.077 
PPTG_16964                                                            35.0       0.081 
H310_15160                                                            36.2       0.091 
PYU1_G010696                                                          36.6       0.100 
PITG_05825                                                            36.6       0.12  
H310_03463                                                            33.5       0.12  
PYIW_27159                                                            34.7       0.13  
PYAP_20169                                                            35.8       0.17  
H257_13212                                                            35.0       0.17  
PPTG_15787                                                            34.7       0.19  
PPTG_00270                                                            35.4       0.25  
H257_05356                                                            35.0       0.26  
PPTG_07951                                                            35.0       0.28  
PYIW_24031                                                            35.0       0.30  
PHYSO_389268                                                          33.5       0.32  
H257_12998                                                            33.9       0.33  
H257_00165                                                            35.0       0.34  
H257_15302                                                            35.0       0.37  
H310_11868                                                            33.5       0.38  
H257_11942                                                            34.7       0.42  
PPTG_15281                                                            33.9       0.43  
H310_14301                                                            34.3       0.47  
H257_12323                                                            33.9       0.55  
CCI48126                                                              34.3       0.59  
PPTG_11144                                                            34.3       0.60  
H257_19488                                                            31.6       0.64  
H310_04868                                                            33.9       0.65  
H257_13222                                                            33.5       0.69  
PPTG_00266                                                            34.3       0.73  
H310_06262                                                            33.5       0.83  
H257_14546                                                            33.1       0.86  
SDRG_08699                                                            33.1       0.93  
H310_04308                                                            32.7       1.0   
PHYSO_389597                                                          33.1       1.1   
PYVX_17808                                                            33.1       1.3   
H310_14397                                                            31.2       1.4   
PYU1_G000384                                                          33.1       1.6   
H257_10436                                                            33.1       1.6   
H257_00966                                                            30.8       1.6   
H310_10580                                                            32.3       1.7   
PPTG_19779                                                            32.7       1.7   
H257_04751                                                            31.6       1.8   
H310_04905                                                            32.0       1.8   
H257_06101                                                            32.7       1.8   
H257_09605                                                            32.3       2.0   
PPTG_07779                                                            31.6       2.0   
PHYSO_336240                                                          32.0       2.2   
PHYSO_322347                                                          32.0       2.2   
PHYRA_86617                                                           32.3       2.5   
H257_01534                                                            32.0       2.5   
PITG_00212                                                            32.3       2.7   
PYAR_18059                                                            32.0       2.8   
H257_12985                                                            31.6       2.9   
PHYRA_74884                                                           32.0       2.9   
PHYSO_560624                                                          32.3       3.0   
PHYCA_14293                                                           31.2       3.2   
PPTG_24854                                                            32.0       3.4   
HYAP_09695                                                            32.0       3.6   
PHYCA_60915                                                           30.8       4.1   
H310_09411                                                            31.2       4.2   
SPRG_10836                                                            29.6       5.2   
PYIR_20491                                                            31.2       5.6   
PYIW_22501                                                            31.2       5.6   
SDRG_10751                                                            30.8       5.6   
PHYSO_317488                                                          31.2       6.8   
PHYRA_84895                                                           30.4       7.3   
CCA24051                                                              30.8       7.6   
CCA23866                                                              30.8       7.6   
SPRG_11254                                                            30.4       8.3   
PHYSO_516255                                                          30.8       8.3   
H310_03851                                                            29.3       8.3   
H257_15734                                                            30.4       8.5   
PHYKE_2287                                                            30.4       9.7   

>PHYCA_131593
Length=254

 Score = 434 bits (1116),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 254/254 (100%), Positives = 254/254 (100%), Gaps = 0/254 (0%)

Query  1    METGANTLTVEDLEATNKDCAPgggggggVAGTDTKKRKKAFRFLPSSDVILLKEVIKHT  60
            METGANTLTVEDLEATNKDCAPGGGGGGGVAGTDTKKRKKAFRFLPSSDVILLKEVIKHT
Sbjct  1    METGANTLTVEDLEATNKDCAPGGGGGGGVAGTDTKKRKKAFRFLPSSDVILLKEVIKHT  60

Query  61   PWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTE  120
            PWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTE
Sbjct  61   PWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTE  120

Query  121  AYEEREQLLTDCFELadktekekrdaerreatSADIVRSAMQGMRNKRALSTDTELAtpp  180
            AYEEREQLLTDCFELADKTEKEKRDAERREATSADIVRSAMQGMRNKRALSTDTELATPP
Sbjct  121  AYEEREQLLTDCFELADKTEKEKRDAERREATSADIVRSAMQGMRNKRALSTDTELATPP  180

Query  181  stkkkkrsstDALLGFLEDRASSRNNRHSLKERQLHIDERRLALEEQRLQQDKDKTDRML  240
            STKKKKRSSTDALLGFLEDRASSRNNRHSLKERQLHIDERRLALEEQRLQQDKDKTDRML
Sbjct  181  STKKKKRSSTDALLGFLEDRASSRNNRHSLKERQLHIDERRLALEEQRLQQDKDKTDRML  240

Query  241  AMMSSQMGLMVQLI  254
            AMMSSQMGLMVQLI
Sbjct  241  AMMSSQMGLMVQLI  254

>PPTG_07932
Length=289

 Score = 248 bits (634),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 190/242 (79%), Gaps = 9/242 (4%)

Query  22   PgggggggVAGTDTK-KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGM  80
            P          TDT+ KRKKAFRF+PSSD++LLKE +KH PWAAGH +T+ +W  VA G+
Sbjct  43   PPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL  102

Query  81   KASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELa----  136
            K +LP CTADGKACRRRF  L++VF+R+ELESLRASGT E +EEREQLLTDC  L     
Sbjct  103  KTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECL  162

Query  137  ----dktekekrdaerreatSADIVRSAMQGMRNKRALSTDTELAtppstkkkkrsstDA  192
                DKTEKEK++AERR+  SAD+V+SAM+G+R  R+ S + +++TP S+KKKKRSST+A
Sbjct  163  QAKADKTEKEKKEAERRDRASADVVQSAMEGIRRSRSKSPEDDVSTPSSSKKKKRSSTEA  222

Query  193  LLGFLEDRASSRNNRHSLKERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQ  252
            L+ FL+ +A +R+ R   KERQLH++ERRLALEEQRLQQD++KTD+++ MM+SQMGLM +
Sbjct  223  LVEFLDAKAETRSTREKQKERQLHLEERRLALEEQRLQQDREKTDKLMEMMASQMGLMSK  282

Query  253  LI  254
            LI
Sbjct  283  LI  284

>PITG_00010
Length=184

 Score = 223 bits (569),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 122/149 (82%), Gaps = 18/149 (12%)

Query  1    METGANTLTVEDLEATNKDCAPgggggggVAGTD--------------TKKRKKAFRFLP  46
            ME GA+TLT E LEAT+KDCAPGG     VA TD               KKRKKAFRFLP
Sbjct  1    MEAGASTLTDEALEATDKDCAPGGD----VADTDRADGAPGDAADDSAQKKRKKAFRFLP  56

Query  47   SSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFK  106
            SSDVILLKEVIKHTPWAAGH KTEA WG+VASG+KA+LPLCTADGKACRRRFYTLMEVFK
Sbjct  57   SSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFK  116

Query  107  REELESLRASGTTEAYEEREQLLTDCFEL  135
            REELESLRASGTTE YEEREQLLTDCFEL
Sbjct  117  REELESLRASGTTEDYEEREQLLTDCFEL  145

>PPTG_24941
Length=380

 Score = 188 bits (478),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 135/171 (79%), Gaps = 10/171 (6%)

Query  94   CRRRFYTLM---EVFKREELESLRASGTTEAYEEREQLLTDCFELadktekekrdaerre  150
            C   +Y  M   + F REELESLRASG  E YEEREQLLTDCFEL ++  ++K D   ++
Sbjct  196  CFLEYYEKMSSADAFTREELESLRASGAAEDYEEREQLLTDCFELTERHAQQKADKTEKK  255

Query  151  -------atSADIVRSAMQGMRNKRALSTDTELAtppstkkkkrsstDALLGFLEDRASS  203
                   A SADIVRSAM+GMRNKRALS+DT+LATPPSTKKKKRS TDALLGFLEDRASS
Sbjct  256  RDAERREAASADIVRSAMEGMRNKRALSSDTDLATPPSTKKKKRSGTDALLGFLEDRASS  315

Query  204  RNNRHSLKERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQLI  254
            RNNR SLKERQL ++ERRL LEE R QQ+KDKTDRMLA+M S+MGLM QLI
Sbjct  316  RNNRDSLKERQLQVEERRLTLEEHRPQQNKDKTDRMLAIMPSEMGLMAQLI  366

>PHYCA_120807
Length=134

 Score = 158 bits (399),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            KRKKAFRF+PSSD++LLKE +KH PWAAGH +TE +W  VA G+K +LP CTADGKACRR
Sbjct  27   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETEVSWSSVAIGLKTALPSCTADGKACRR  86

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            RF  L++VF+R+ELESLRASG+ E +EEREQLLTDC  L
Sbjct  87   RFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMAL  125

>PHYCA_504729
Length=183

 Score = 159 bits (402),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 89/119 (75%), Gaps = 1/119 (1%)

Query  17   NKDCAPgggggggVAGTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRV  76
            N DC         V      KRKKAFRF+PSSD++LLKEV+KH PWAA H +T A W  V
Sbjct  3    NADCN-TEEPPNPVRSPSISKRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSV  61

Query  77   ASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            A+G+KA+L  CTADGKACRRRF TL+EVF+R+ELESLRASG+ E YEEREQLLTDC  L
Sbjct  62   ATGLKAALTSCTADGKACRRRFNTLLEVFRRDELESLRASGSAEDYEEREQLLTDCMTL  120

>PHYCA_112118
Length=134

 Score = 154 bits (388),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            KRKKAFRF+PSSD++LLKE +KH PWAAGH + + +W  VA G+K +LP CT DGKACRR
Sbjct  27   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGEAQVSWSSVAIGLKTTLPSCTGDGKACRR  86

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            RF  L++VF+R+ELESLRASG+ E +EEREQLLTDC  L
Sbjct  87   RFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMAL  125

>PHYCA_49721
Length=103

 Score = 150 bits (380),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)

Query  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR  95
            +KRKKAFRFL SSDV+LLKEV+KHTPW+AGH +T+  W +VASG+K +LP C ADGKACR
Sbjct  4    QKRKKAFRFLQSSDVVLLKEVVKHTPWSAGHGETQVAWEKVASGIKEALPACIADGKACR  63

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            RRF  L + F+REE+ESLRA GT+E Y EREQLLTD  EL
Sbjct  64   RRFGALYDAFRREEMESLRALGTSEEYTEREQLLTDLTEL  103

>PHYCA_70656
Length=113

 Score = 145 bits (366),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 83/111 (75%), Gaps = 1/111 (1%)

Query  17   NKDCAPgggggggVAGTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRV  76
            N DC         V      KRKKAFRF+PSSD++LLKEV+KH PWAA H +T A W  V
Sbjct  4    NADCN-TEEPPNPVRSPSISKRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSV  62

Query  77   ASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQ  127
            A+G+KA+L  CTADGKACRRRF TL+EVF+R+ELESLRASG+ E YEEREQ
Sbjct  63   ATGLKAALTSCTADGKACRRRFNTLLEVFRRDELESLRASGSAEDYEEREQ  113

>PPTG_14663
Length=146

 Score = 139 bits (349),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 75/98 (77%), Gaps = 0/98 (0%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRR  97
            RKKAFRFLPSSDV+LLKEV  HTPWAA H +T   W  VA+ +K ++   TAD KACRRR
Sbjct  30   RKKAFRFLPSSDVLLLKEVTAHTPWAAAHGETNTAWTTVANELKNAISASTADDKACRRR  89

Query  98   FYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            F  L++ F+REE++SLR SGT E Y EREQLLTDC EL
Sbjct  90   FTALLDTFRREEMKSLRVSGTAEEYREREQLLTDCLEL  127

>PHYCA_559326
Length=182

 Score = 137 bits (346),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 80/119 (67%), Gaps = 1/119 (1%)

Query  17   NKDCAPgggggggVAGTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRV  76
            N DC         V      KRKKAF F PSSD++L KEV+K  PWAA H +T A W   
Sbjct  3    NADCN-TEEPSNPVRSPSISKRKKAFNFGPSSDIMLFKEVLKRRPWAASHGETLAAWTSF  61

Query  77   ASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            A+ +KA+L  CTADG ACRRRF TL+ VF R+ELESLRASG+ E YEEREQLLTDC  L
Sbjct  62   ATRLKAALTSCTADGNACRRRFNTLLGVFCRDELESLRASGSAEDYEEREQLLTDCMTL  120

>PPTG_06351
Length=225

 Score = 138 bits (347),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 10/199 (5%)

Query  66   HRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEER  125
            H KT   W +VASG+ A+LP CTADGK CRR F  L + F+REE ESLRASGT+E Y ER
Sbjct  17   HGKTPVAWEKVASGINAALPACTADGKVCRRPFGALHDAFRREEKESLRASGTSEEYTER  76

Query  126  EQLLTDCFELadktekekrda--erreatSADIVRSAMQGMRNKRALSTDTE-----LAt  178
            EQLLTD  EL    + EK     E REA +A++VR A+ G+R  R+ S + E       +
Sbjct  77   EQLLTDRTELEKADKTEKEKRDAEAREAATAEVVRDALVGLRRTRSSSPEYEQQTTTPPS  136

Query  179  ppstkkkkrsstDALLGFLEDRAS---SRNNRHSLKERQLHIDERRLALEEQRLQQDKDK  235
              S +     S+D L G   +R +    R  +H+L+ER L I+ERRL  E +R +Q++D+
Sbjct  137  KRSKQSHTERSSDYLEGKAAERKARVEGRQQQHALEERCLDIEERRLNHERERNKQERDR  196

Query  236  TDRMLAMMSSQMGLMVQLI  254
             D+ +AMMSS+M +M +LI
Sbjct  197  NDKFMAMMSSKMHMMAKLI  215

>PPTG_21678
Length=104

 Score = 112 bits (279),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 1/80 (1%)

Query  33   TDTK-KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG  91
            +DT+ KRKKAFRF+PSSD++LLKE +KH PWAAGH +T+ +    A G+K +LP CTADG
Sbjct  22   SDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSLSSFAIGLKTALPSCTADG  81

Query  92   KACRRRFYTLMEVFKREELE  111
            KACRRRF   ++VF+R+ELE
Sbjct  82   KACRRRFNAPLDVFRRDELE  101

>PPTG_03338
Length=260

 Score = 115 bits (289),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 117/223 (52%), Gaps = 7/223 (3%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            KR KAFRF   +D+ LL+EVI H PWA+ H     TW  VA+  K  +P  T DG+AC+R
Sbjct  29   KRAKAFRFTTVTDIALLREVIDHKPWASSHGDMAKTWEVVAAAFKRIVPWSTNDGRACKR  88

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELadktekekrdaerreatSADI  156
            R+  L+E +  E+L+ LR +GT     ER +LL  C +L    +  +R A +       +
Sbjct  89   RYLALIEAYGSEKLQKLRGAGTPAMNAERAKLLAQC-QLMTDEDHRRRKAAKESERQPPV  147

Query  157  VRSAMQGM----RNKRA-LSTDTELAtppstkkkkrsstDALLGFLED-RASSRNNRHSL  210
             + A+Q       N R   S  TE       +     + + L   L D R   R     +
Sbjct  148  AQLALQDAARLSNNGRTDFSAMTEEEAATRAENSVTPTGEHLTQLLNDPRVVLRQRELEI  207

Query  211  KERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQL  253
            +ER++ ++ERR+ LEE+R +Q +   ++ + MM++Q  ++++L
Sbjct  208  EERRIKLEERRIKLEEERFEQQRQTAEKQMEMMAAQTNVLLKL  250

>PITG_09072
Length=261

 Score = 115 bits (288),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 116/223 (52%), Gaps = 7/223 (3%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            KR KAFRF   +D+ LL+EVI H PWA  H     TW  VA+  K  +P  T DG+AC+R
Sbjct  30   KRAKAFRFTTVTDIALLREVIDHKPWACSHGDMAKTWEVVATAFKRIVPWSTNDGRACKR  89

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELadktekekrdaerreatSADI  156
            R+  LME +  E+L+ LR +GT     ER +LL  C ++    +  KR A +       +
Sbjct  90   RYLALMEAYGSEKLQKLRGAGTPAMNAERAKLLMQC-QIMTDEDHRKRKAVKESERQPPV  148

Query  157  VRSAMQGM-----RNKRALSTDTELAtppstkkkkrsstDALLGFLED-RASSRNNRHSL  210
             + A++         +   ST  +       +     +  AL   L D R   R     +
Sbjct  149  AQLALEDAARLTSSGRTDFSTMADQEAAIRAENTIAPTGQALTQLLNDPRVLLRQRELEV  208

Query  211  KERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQL  253
            +ER++ ++ERR+ LEEQR +Q +  T++ + MM++Q  ++++L
Sbjct  209  EERRIKLEERRVQLEEQRFEQQRQTTEKQMEMMAAQTNVLLKL  251

>PHYRA_78088
Length=261

 Score = 114 bits (285),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 117/223 (52%), Gaps = 10/223 (4%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            KR KAFRF   +D+ LL+EVI H PWA  H     TW  VA+  K  +P  T DG+AC+R
Sbjct  32   KRAKAFRFTTVTDIALLREVIDHKPWACSHGDMAKTWDVVATAFKRIVPWSTNDGRACKR  91

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELadktekekrdaerreatSADI  156
            R+  L E +  ++L  LR SGT +   +RE+LL  C  L ++    ++  +  +      
Sbjct  92   RYLALAEAYGTQKLHKLRGSGTPQMNAQREKLLAQCKALTEEAHYRRKALKEADRRPV--  149

Query  157  VRSAMQGMRNKRALST--DTELA----tppstkkkkrsstDALLGFLEDRASSRNNRHSL  210
               A   M +   LS+  D+E +    T  +  +   +  D  L   + R   R     L
Sbjct  150  --VAQLAMEDAARLSSNGDSEFSGFDVTETNRPEAPMAGQDLTLLLNDPRVLLRQRELEL  207

Query  211  KERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQL  253
            +ER++ ++ERR+ LEEQR +Q +   ++ L MM++Q  ++++L
Sbjct  208  EERRMKLEERRVKLEEQRFEQQRQTAEKQLEMMAAQTNVLLKL  250

>PHYSO_362017
Length=273

 Score = 113 bits (283),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 116/226 (51%), Gaps = 13/226 (6%)

Query  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR  95
            +KR KAFRF   +D+ LL+EVI H PWA+ H     TW  VA+  K ++P  T DG+AC+
Sbjct  44   EKRAKAFRFTTVTDIALLREVINHKPWASSHGDMAKTWDVVAAAFKRTVPWSTNDGRACK  103

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELadktekekrdaerreatSAD  155
            RR+  L E +   +L+ LR SGT     +RE LL  C  +      E+    RR A  AD
Sbjct  104  RRYLALAEAYGTAKLQKLRGSGTPVMNAQRESLLAQCHAM-----TEEDLRRRRAAKEAD  158

Query  156  IVRSAMQGMRNKRALS--TDTEL------AtppstkkkkrsstDALLGFLEDRASSRNNR  207
                A   + +   LS   D E+      A   +      +  D  L   + R   R   
Sbjct  159  RRPIAQLALEDATRLSGNVDPEINALATEAARVTEATAGPTGQDLTLLLNDPRVLMRQRE  218

Query  208  HSLKERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQL  253
              L+ER++ ++ERR+ LEEQR +Q +   ++ L M+++Q  ++++L
Sbjct  219  LELEERRMKLEERRVKLEEQRFEQQRQTAEKQLEMIAAQTNVLLKL  264

>PHYCA_530243
Length=269

 Score = 112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 116/220 (53%), Gaps = 4/220 (2%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            KR KAFRF   +D +LL+EV+ H PW+  H     TW  VA G K  +P  T DG+AC+R
Sbjct  40   KRAKAFRFTTVTDTLLLREVLDHKPWSCSHGDMAKTWDVVAVGFKRLVPWSTNDGRACKR  99

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELadktekekrdaerreatSADI  156
            R+  L E +  E+L+ LR SGT     +RE+LL+ C +L    +  +R A +       +
Sbjct  100  RYLALAEAYGTEKLQKLRGSGTPAQNAQRERLLSQC-QLLTDEDHRRRKAAKEADRRPPV  158

Query  157  VRSAMQGMRNKRALSTDTELAtppstkkkkrsstDA--LLGFLED-RASSRNNRHSLKER  213
             + A++            +L    + +  +  +  A  L   L D R   R     L+ER
Sbjct  159  AQLALEDAARLTENGDAEQLTGIVADEPFRADTGPAQDLTQLLNDPRLVMRQRELELEER  218

Query  214  QLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQL  253
            ++ ++ERR+ LEEQR +Q +   D+ L MM++Q  ++++L
Sbjct  219  RMKLEERRVKLEEQRFEQQRQTADKQLEMMAAQTSVLLKL  258

>H310_09765
Length=115

 Score = 85.9 bits (211),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 1/103 (1%)

Query  33   TDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGK  92
            +DT KRK A+RF  ++DV LLKEV+   P+ AG+ +T A W  +   M+ S+        
Sbjct  5    SDTTKRKPAYRFTIAADVDLLKEVVLVAPFDAGYGQTTARWDEIGDNMR-SIHGEAVTAI  63

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             CRRRF  L+  FK+  L++LR+SGT E Y +R+QLL D  +L
Sbjct  64   CCRRRFDELLAAFKKATLKALRSSGTEEEYNDRDQLLQDIVDL  106

>H310_05293
Length=143

 Score = 85.1 bits (209),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 7/102 (7%)

Query  33   TDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG-  91
             ++ KRK AFRF  +SDV LLKEVI   P+ A +   ++ W  VA+ M     +   DG 
Sbjct  2    NESAKRKAAFRFKSASDVDLLKEVIHIQPYDAPYGAVKSRWDEVAANM----CMTYGDGL  57

Query  92   --KACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
               +CR+RF  L++ FKR  + SLRASGT E Y EREQLL D
Sbjct  58   TSVSCRKRFDDLLDAFKRNTISSLRASGTEEEYNEREQLLQD  99

>H310_13306
Length=231

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 64/108 (59%), Gaps = 11/108 (10%)

Query  33   TDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK-----ASLPLC  87
            +DT KRK A+RF  ++DV LL EV+   P+ AG+ +T A W  +   M+     A   +C
Sbjct  5    SDTTKRKPAYRFTNTADVDLLNEVVLVAPFDAGYGQTTARWDEIGDNMRSIHGEAITAIC  64

Query  88   TADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
                  CRRRF  L+  FK+  L++LR+SGT E Y ER+QLL D  +L
Sbjct  65   ------CRRRFDDLLAAFKKATLKALRSSGTEEEYNERDQLLQDIVDL  106

>PPTG_03791
Length=108

 Score = 81.3 bits (199),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)

Query  37  KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
           KRKKAFRF+PSSD++LLKE +KH PWAA H +T A W  VA+G+K +L  C AD KAC
Sbjct  19  KRKKAFRFVPSSDIMLLKEALKHRPWAAIHGETLAAWTSVATGLKVALTSCAADDKAC  76

>H310_15292
Length=230

 Score = 82.4 bits (202),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 60/108 (56%), Gaps = 11/108 (10%)

Query  33   TDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGK  92
             D+ KRK AF F P+SD  LLK VI   P+ A +   +  W  VA+ M      C   G 
Sbjct  2    NDSSKRKVAFLFKPASDFDLLKVVIHIQPFDAPYEADKTRWEEVAANM------CITHGD  55

Query  93   -----ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
                 +CR+RF  L+  FK ++L SLRASGT E Y EREQL+ D  +L
Sbjct  56   TLTAVSCRKRFDDLIVAFKDDKLNSLRASGTEEEYNEREQLMQDIVDL  103

>H310_04684
Length=108

 Score = 77.4 bits (189),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 6/105 (6%)

Query  34   DTKKRKK-AFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTAD  90
            D  KRKK AFR+  S+D+ LLKEV+   P+ A + +T A W  +   M+      L TA 
Sbjct  6    DANKRKKTAFRYSVSADIDLLKEVVMVAPYDARYGQTSARWEEICDHMRQLHGDSLTTA-  64

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
              +CR+RF  L+  FK+  L++LRASGT E Y ER+QL+ D  ++
Sbjct  65   --SCRKRFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDM  107

>H310_14146
Length=109

 Score = 77.4 bits (189),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 61/96 (64%), Gaps = 5/96 (5%)

Query  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASL--PLCTADGKA  93
            +++K AFRF  S+D+ LLKEV+   P+ A + +T A W  +   M+ S    L TA   +
Sbjct  9    RRKKTAFRFSVSADIDLLKEVVMIAPFEAAYGQTGAGWEGICEHMRVSHGDTLTTA---S  65

Query  94   CRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
            CR+RF  L   FK+  L++LRASGT E Y+ER+QLL
Sbjct  66   CRKRFDDLYSAFKKATLKALRASGTEEEYQERDQLL  101

>PYAP_15403
Length=114

 Score = 77.0 bits (188),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 60/101 (59%), Gaps = 5/101 (5%)

Query  39   KKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG-----KA  93
            ++ FRF PS DV+LL+E+ +  PWAA H +T ++W  +       L +   +G     +A
Sbjct  12   RRTFRFKPSHDVLLLREIARLKPWAALHGETMSSWEAIGQAFNTQLAVVRPNGPEIDARA  71

Query  94   CRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFE  134
            C+RR+  L++ F   +L SLR+SG+ E   ERE+L+ +  +
Sbjct  72   CQRRYKALIDSFLSGDLASLRSSGSAEEINEREELIAEVHQ  112

>H310_08339
Length=230

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 61/102 (60%), Gaps = 11/102 (11%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK-----ASLPLCTA  89
            T+++K AFRF  S+D+ LLKEV+   P+ A + +T A W  V   M+     A   +C  
Sbjct  8    TRRKKTAFRFSVSADIDLLKEVVMVVPFDAAYGQTSARWDEVCEHMRQLHGNAMTSVC--  65

Query  90   DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
                CR+RF  L+  FK+  L++LRASGT E Y ER+QL+ D
Sbjct  66   ----CRKRFDDLLPAFKKSSLKALRASGTEEEYLERDQLMQD  103

>HYAP_14010
Length=303

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 117/247 (47%), Gaps = 38/247 (15%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA--------  89
            +++ FRF P+ DV+L +EVI+  PWAAG+ +T + W  VA+ ++++L             
Sbjct  50   KRRLFRFKPAFDVVLAREVIRCFPWAAGYGRTRSAWMNVAARVQSTLESLKGVAFTRGSA  109

Query  90   -DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD--------------CFE  134
             D    +RR   L+E F++ E+ SLR +GT E ++ R +LL                 F 
Sbjct  110  LDHAIVKRRVDMLLEAFRKHEMSSLRGTGTPEEFDMRNKLLAILTRVVGRSALIIWVLFW  169

Query  135  LadktekekrdaerreatSADIVRSAMQGMRNKRALSTDTELAtppstkkkkrsstDALL  194
            +      +   +      +  +  +      +KR++ T +  A     + K+        
Sbjct  170  VLFVGVTKGSLSPGPVPQTVAVSHNEQPNGSSKRSVRTTSAFAPALMHEVKRPR------  223

Query  195  GFLEDRASSRNNRHSLKERQLHIDERRLALEEQRL-------QQDKDKTDRMLAMMSSQM  247
              +E  A + +   S +E++L ++ERR+ALEE+RL       QQD  +   +L ++ +Q 
Sbjct  224  --VEKTAVTMDVALSFEEQKLRLEERRVALEEERLEWEKQKAQQDGHERQALLDLLRAQS  281

Query  248  GLMVQLI  254
             L+ +L+
Sbjct  282  SLVAELL  288

>H310_02561
Length=256

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 6/105 (6%)

Query  34   DTKKRKK-AFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTAD  90
            D  KRKK AFR+  S+D+ LLKEV+   P+ A + +T A W  +   M+      L TA 
Sbjct  6    DANKRKKTAFRYSVSADIDLLKEVVMVAPYDAPYGQTSARWEEICDHMRQLHGDSLTTA-  64

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
              +CR+RF  L+  FK+  L++LRASGT E Y ER+QL+ D  ++
Sbjct  65   --SCRKRFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDM  107

>PHYCA_21476
Length=134

 Score = 75.1 bits (183),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 77/128 (60%), Gaps = 21/128 (16%)

Query  122  YEEREQLLTDCFELadk-tekekrdaerreatSADIVRSAMQGMRNKRALSTDTELAtpp  180
            +EEREQLLTDC  L D+  + +    E+ +   + ++ S  Q M  K+  ST+       
Sbjct  15   FEEREQLLTDCTALVDECLQAKADKTEKEKRRQSGVIES--QLMWFKKRSSTE-------  65

Query  181  stkkkkrsstDALLGFLEDRASSRNNRHSLKERQLHIDERRLALEEQRLQQDKDKTDRML  240
                       AL+ FL+ +A +R+ R   KERQLH++ERRLALEEQRLQQD++KTD+++
Sbjct  66   -----------ALVEFLDAKAETRSTREKQKERQLHLEERRLALEEQRLQQDREKTDKLM  114

Query  241  AMMSSQMG  248
             M SS +G
Sbjct  115  EMYSSILG  122

>H310_06933
Length=259

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASL-PLCTADGKACR  95
            KRK A+RF    D+ +LKEV+   P  A + +T + W  V   M+A L P  +A G  CR
Sbjct  8    KRKAAYRFSIPVDIDMLKEVMFACPHDAPYGQTSSRWQEVGEHMRALLGPELSAGG--CR  65

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            +R   LM  FK+E ++S+RASGT E Y EREQLL D
Sbjct  66   KRHDDLMAAFKKETVKSMRASGTEEEYLEREQLLQD  101

>PPTG_14264
Length=335

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 61/101 (60%), Gaps = 9/101 (9%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA--------  89
            +++ FRF P+ DV+L++EVI+  PWAAG+ +T + W  VAS ++A+L             
Sbjct  33   KRRLFRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQAALESMKGVVFTRGSA  92

Query  90   -DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
             D    +RR   L+E F++ EL +LR SGT E ++ R +LL
Sbjct  93   LDHAIVKRRVDMLLEAFRKNELSALRGSGTPEEFDMRNKLL  133

 Score = 35.4 bits (80),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 37/57 (65%), Gaps = 7/57 (12%)

Query  205  NNRHSLKERQLHIDERRLALEE-------QRLQQDKDKTDRMLAMMSSQMGLMVQLI  254
            +N  S++ER+L ++ERR++LEE       Q+ QQD ++   +L ++ +Q  L+ +L+
Sbjct  264  DNAQSIEERKLRLEERRVSLEEERLAWEKQKAQQDANERQALLDVLRAQGSLVTELL  320

>SDRG_15163
Length=292

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 58/116 (50%), Gaps = 2/116 (2%)

Query  19   DCAPgggggggVAGTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVAS  78
            +  P       VA  +      A +F    D+++L+ V    PWAA H    +TW  +A 
Sbjct  7    ESVPAIEPRTEVAPEEVATGSNASKFACKHDIVMLRSVGLLEPWAAAHGAVMSTWEAIAE  66

Query  79   GMK--ASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
             +   +   L    G A + RF ++M  FK+ E +SLR SGT E YEEREQLLTD 
Sbjct  67   SLADASDFGLKNKKGPALKTRFESIMNKFKKSEFQSLRKSGTVEEYEEREQLLTDI  122

>H257_06152
Length=150

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (56%), Gaps = 7/104 (7%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG---  91
            +++ K  FRF   +DV LLKE+I   P+ A H +    W  V   ++    LC  DG   
Sbjct  12   SQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR---LC-GDGITV  67

Query  92   KACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             A R+RF  LM  F  + + +LRASGT E YEEREQLL D  +L
Sbjct  68   NATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDL  111

>H310_11755
Length=259

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA-SLPLCTADGKACR  95
            KRK A+RF    D+ LLKEV+   P  A + +T + W  V   M+A   P  +A G  CR
Sbjct  8    KRKAAYRFSIPVDIDLLKEVMFACPHDAPYGQTSSRWQEVGEHMRALHGPELSAGG--CR  65

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +R   LM  FK+E ++S+RASGT E Y EREQLL D  ++
Sbjct  66   KRHDDLMAAFKKETVKSMRASGTEEEYLEREQLLQDLSDM  105

>SPRG_08854
Length=412

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 1/100 (1%)

Query  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR  95
            +KRK AFRF  +SD+ LL+EV+   P+AA H +T   W +VA+ + A +          R
Sbjct  46   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATQV-AQIHGSGITPNNVR  104

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +RF  LM  FK++ L +LRASG+ E Y+ER  LL D  + 
Sbjct  105  KRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDF  144

>SDRG_13678
Length=415

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 1/100 (1%)

Query  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR  95
            +KRK AFRF  +SD+ LL+EV+   P+AA H +T   W +VA+ + A +          R
Sbjct  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV-ARIHGSGITPNNVR  110

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +RF  LM  FK++ L +LRASG+ E Y+ER  LL D  + 
Sbjct  111  KRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDF  150

>PITG_08172
Length=320

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 60/101 (59%), Gaps = 9/101 (9%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA--------  89
            +++ FRF P+ DV+L++EVI+  PWAAG+ +T + W  VAS ++ +L             
Sbjct  17   KRRLFRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQTALESLKGVVFTRGSA  76

Query  90   -DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
             D    +RR   L+E F++ EL +LR SGT E ++ R +LL
Sbjct  77   LDHAIVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLL  117

 Score = 34.7 bits (78),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 34/53 (64%), Gaps = 7/53 (13%)

Query  209  SLKERQLHIDERRLALEEQRL-------QQDKDKTDRMLAMMSSQMGLMVQLI  254
            + +ER+L ++ERR+ALEE+RL       QQD  +   +L ++ +Q  L+ +L+
Sbjct  253  NFEERKLRLEERRVALEEERLAWEKQKAQQDGKERQALLDVLHAQGSLVTELL  305

>H310_15291
Length=234

 Score = 74.3 bits (181),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 61/107 (57%), Gaps = 3/107 (3%)

Query  30   VAGTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASL-PLCT  88
            ++  D  KRK A+RF    D+ LLKEV+   P  A + +T A W  V   M+    P  T
Sbjct  1    MSEVDGVKRKTAYRFTTQVDIDLLKEVMAVRPHDAPYGQTLARWEEVVEHMREMRGPDLT  60

Query  89   ADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
              G  CR+R   LM  FK++ ++SLRA+GT E Y EREQL+ D  ++
Sbjct  61   TAG--CRKRLDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDM  105

>SPRG_14160
Length=319

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query  41   AFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRRRF  98
            A +F    D+ +L+ V    PWAA H    +TW  +A  +   +   L    G A + RF
Sbjct  22   ASKFACKHDIAMLRTVNLLEPWAAAHGAVMSTWDAIAESLADASDFGLKNKKGPALKTRF  81

Query  99   YTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
              +M  FK+ E +SLR SGT E YEEREQLLTD 
Sbjct  82   EIIMNRFKKSEFQSLRKSGTVEEYEEREQLLTDI  115

>CCA14346
Length=325

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 61/128 (48%), Gaps = 29/128 (23%)

Query  33   TDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASL--------  84
            T+  ++KKAFRF P  D++LL  + +  PWAA H      W   A     S+        
Sbjct  15   TNDYRKKKAFRFKPKHDIVLLNTIKQFMPWAAVHGYVREVWASAADAFSLSMREKFTNLD  74

Query  85   ---------PLCTADG------------KACRRRFYTLMEVFKREELESLRASGTTEAYE  123
                      +  A+G             AC+RRF TL++  +R +LESLRASG+ E   
Sbjct  75   EYFGEEGNNEISPANGLIGSGSTFHVNHIACKRRFDTLIDAHRRGDLESLRASGSEEECC  134

Query  124  EREQLLTD  131
            EREQLL D
Sbjct  135  EREQLLMD  142

>H310_04120
Length=138

 Score = 71.2 bits (173),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query  33   TDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA-SLPLCTADG  91
             D  KR+ A+RF+   D+  LKEV+   P  A + +T A W      M+    P  T  G
Sbjct  4    VDGGKRRTAYRFITQVDIDFLKEVMAVCPHDAPYGQTLARWEDFVEHMREMHGPDLTTAG  63

Query  92   KACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
              CR+R   LM  +K+  ++SLRASGT E Y EREQL+ D
Sbjct  64   --CRKRLDDLMAAYKKNTVQSLRASGTEEEYNEREQLIQD  101

>PHYSO_383648
Length=319

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 60/101 (59%), Gaps = 9/101 (9%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA--------  89
            +++ FRF P+ DV+L++EVI+  PWAAG+ +T + W  VA+ ++++L             
Sbjct  10   KRRLFRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVATRVQSTLESMKGVAFTRGSA  69

Query  90   -DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
             D    +RR   L+E F++ E+  LR SGT E ++ R +LL
Sbjct  70   LDHAIVKRRVDMLLEAFRKNEMAGLRGSGTPEEFDMRNKLL  110

 Score = 33.1 bits (74),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 34/53 (64%), Gaps = 7/53 (13%)

Query  209  SLKERQLHIDERRLALEE-------QRLQQDKDKTDRMLAMMSSQMGLMVQLI  254
            S +ER+L ++ERR+ALEE       Q+ QQ+  +   +L ++S+Q  L+ +L+
Sbjct  254  SFEERKLRLEERRVALEEERLAWEKQKAQQEGKERQALLDVLSTQGSLVTELL  306

>H310_09373
Length=109

 Score = 69.7 bits (169),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 5/98 (5%)

Query  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASL--PLCTADGKA  93
            +++K AFRF   +D+ LLKEV+   P+ A   +T A W       + S    L TA   +
Sbjct  9    RRKKTAFRFSVVADIDLLKEVVIIAPFEAASGQTGARWEEFCEHKRVSHGDTLTTA---S  65

Query  94   CRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            CR+R   L+  FK+  L++LRASGT E Y+ER+QLL D
Sbjct  66   CRKRVDDLLSAFKKATLKALRASGTEEEYQERDQLLQD  103

>PHALS_08857
Length=352

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 60/101 (59%), Gaps = 9/101 (9%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA--------  89
            +++ FRF P+ DV+L++EVI   PW+AG+ +T + W  VA+ ++++L             
Sbjct  54   KRRLFRFKPAFDVVLVREVIHDFPWSAGYGRTRSAWMAVATRVQSTLEEMKGVTFTRGSA  113

Query  90   -DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
             D    +RR   L+E F++ EL +LR SGT E ++ R +LL
Sbjct  114  LDHAIVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLL  154

>PHYCA_510415
Length=337

 Score = 72.8 bits (177),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 61/101 (60%), Gaps = 9/101 (9%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPL---------CT  88
            +++ FRF P+ DV+L +EVI++ PWAAG+ +T + W  VA+ ++++L            +
Sbjct  33   KRRLFRFKPAFDVVLAREVIRNFPWAAGYGRTRSAWMAVANRVQSTLESMKGVTFTKGSS  92

Query  89   ADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
             D    +RR   L+E +++ E+  LR SGT E ++ R +LL
Sbjct  93   LDHAIVKRRVDMLLEAYRKNEMSGLRGSGTPEEFDMRNKLL  133

 Score = 31.6 bits (70),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 31/45 (69%), Gaps = 0/45 (0%)

Query  210  LKERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQLI  254
            L+ER++ ++E RLA E+Q+ +QD  +   +L ++ +Q  L+ +L+
Sbjct  278  LEERRVALEEERLAWEKQKAEQDDKERQALLDVLRAQGSLVTELL  322

>H310_12894
Length=257

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA-SLPLCTADGKACR  95
            KRK A+RF    D+ LLKE +   P  A + +  A W  +A  M+    P  T  G  CR
Sbjct  8    KRKTAYRFTTQVDIDLLKEAMFVCPHDAPYGQASARWEEIAEHMRQLHGPDLTTAG--CR  65

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +R   L+  FK++ ++SLRASGT E Y ER+QLL D  ++
Sbjct  66   KRLDDLIAAFKKDTVKSLRASGTEEEYNERDQLLQDLADM  105

>H310_07849
Length=192

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPL-CTADGKACR  95
            K+K A RF    DV L+KEVI  +P  A + +    W  V   M+A      TA G  C+
Sbjct  5    KKKPAHRFTLQQDVDLIKEVISVSPHDAPYGQLSTRWAEVGQNMQAIYASNLTASG--CQ  62

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +R   L+  F ++ + SLRASGT E Y EREQLL D  ++
Sbjct  63   KRCDELLVAFHKDNIASLRASGTEENYNEREQLLQDLSDM  102

>PHYKE_1588
Length=333

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 59/101 (58%), Gaps = 9/101 (9%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASL----PLCTADGKA  93
            +++ FRF P  DV+L++EVI   PWAAG+ +T + W  VA  ++A L     L  + G A
Sbjct  27   KRRLFRFKPRFDVVLVREVICSFPWAAGYGRTRSAWMNVAQRVQAELEDMGSLSFSKGAA  86

Query  94   -----CRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
                  +RR   L++ F++ E+  LR SGT E ++ R +LL
Sbjct  87   LDHAIVKRRVDMLLDAFRKNEMSGLRGSGTPEDFDMRNKLL  127

>H257_07641
Length=187

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query  39   KKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG---KACR  95
            K AFRF   +DV LLKEVI   P+   H +    W  V       L     DG    A R
Sbjct  16   KTAFRFKGCTDVELLKEVIHVRPYEGPHGEVRKRWTEVTE----HLQRLYGDGITVNATR  71

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +RF  LM  F    + +LRASGT + YEEREQLL D  +L
Sbjct  72   KRFDDLMTAFHANTMAALRASGTEQDYEEREQLLQDIHDL  111

>H257_15222
Length=254

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 1/99 (1%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            K+K A  F    DV L+KEV+   P  A + +T A W  V   M+ ++ + +     CR+
Sbjct  12   KKKPAHGFTTPQDVDLIKEVMSICPHDAPYGQTSARWAEVGEHMR-TIHVDSLSATGCRK  70

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R   L+  F++  L SLRASGT E Y+EREQLL D  ++
Sbjct  71   RCDDLLVAFQKAMLASLRASGTDEEYDEREQLLQDLSDM  109

>H257_09434
Length=257

 Score = 68.9 bits (167),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 52/95 (55%), Gaps = 1/95 (1%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            KRK A RF    DV LLKEV+   P  A + +T   W  V   M+ ++   +     CR+
Sbjct  9    KRKPAHRFTIPQDVDLLKEVLTICPHDAPYGQTSGRWAEVGDRMR-TIHGDSLSATGCRK  67

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            R   L+  F ++ L SLRASGT E + EREQLL D
Sbjct  68   RCDDLLAAFHKDSLASLRASGTDEQHHEREQLLQD  102

>H310_13106
Length=213

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 57/104 (55%), Gaps = 5/104 (5%)

Query  34   DTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADG  91
            D  KRK A+RF    D+ LLKEV+   P  A + +  A W  V   ++      L TA  
Sbjct  5    DGVKRKTAYRFTTQVDIDLLKEVMAVCPHEAPYGQILARWEEVVEHIREMHGPDLITA--  62

Query  92   KACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
              CR+    LM  FK++ ++SLRA+GT E Y EREQL+ D  ++
Sbjct  63   -GCRKSLDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDM  105

>SPRG_11320
Length=274

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 3/100 (3%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA-SLPLCTADGKACR  95
            K KK FRF  +SDV LLKEVI   P+ A   +T A W  V   M+       T  G  CR
Sbjct  8    KTKKTFRFSVASDVDLLKEVINVAPYDAPFGQTIARWEEVTEHMRGIHGEHVTFTG--CR  65

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +RF  LM  FK++ L+++RASGT     ER+ LL D  +L
Sbjct  66   KRFDDLMAAFKKDALKAMRASGTAAEVCERDLLLEDISDL  105

>PYVX_13719
Length=317

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 58/105 (55%), Gaps = 8/105 (8%)

Query  32   GTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPL-----  86
            G ++  ++  FRF P  D+ LL+EVIK  PW AG+  T A W  VA+ ++  L       
Sbjct  19   GGESAAKRSMFRFRPRYDIALLREVIKRFPWGAGYGHTRAAWTAVAADVQTELEAQGVAF  78

Query  87   ---CTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQL  128
                + D    +RR   L+E F++ ++ESLR +G+    E+R++L
Sbjct  79   EQGSSLDHTLAKRRADVLLETFRQGDMESLRGTGSPSEVEKRDKL  123

>PHYRA_78656
Length=347

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 59/105 (56%), Gaps = 9/105 (9%)

Query  34   DTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA----  89
            D   +++ FRF P+ DV+L++EVI+  PWAAG+ +T + W  VA  ++ +L         
Sbjct  43   DDGGKRRLFRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVALRVQTALESLKGVAFT  102

Query  90   -----DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
                 D    +RR   L++ F++ E+  LR SG+ E ++ R +LL
Sbjct  103  RGSALDHAIVKRRVDMLLDAFRKSEMSGLRGSGSPEEFDLRNKLL  147

 Score = 33.1 bits (74),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 37/53 (70%), Gaps = 7/53 (13%)

Query  209  SLKERQLHIDERRLALEEQRLQQDKDKTDR-------MLAMMSSQMGLMVQLI  254
            +L+ER+L ++ERR+ALEE+RL  +K K+++       +L ++ +Q  L+ +L+
Sbjct  280  TLEERKLCLEERRVALEEERLAWEKHKSEQDAKERQTLLDVLRTQGVLVTELL  332

>H257_19104
Length=214

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 53/104 (51%), Gaps = 7/104 (7%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG---  91
            +++RK AFRF   +DV LLKEVI   P+ A H +    W  V       L     DG   
Sbjct  12   SQRRKTAFRFKGCTDVELLKEVIHVQPYEAPHGEVRKRWTEVTE----HLQRLYGDGITV  67

Query  92   KACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             A R+R   L+  F    + +L ASGT E YEEREQLL D   L
Sbjct  68   NATRKRSDDLITAFHANTMAALCASGTDEEYEEREQLLQDIHGL  111

>H310_14738
Length=255

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 55/102 (54%), Gaps = 5/102 (5%)

Query  34   DTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADG  91
            ++ K K A RF    D+ LLKEVI   P  A + +T   W  V   M+A   +   T D 
Sbjct  5    ESSKLKPAHRFTVQEDIDLLKEVILVRPHDAPYGQTAGRWEEVGDHMRAIHGMTTTTVD-  63

Query  92   KACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
              CR+R   LM  FK++ ++SLRASGT +   E+EQLL D  
Sbjct  64   --CRKRHDDLMVAFKQDTIKSLRASGTEKQNSEQEQLLQDLL  103

>SPRG_06030
Length=196

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 57/116 (49%), Gaps = 21/116 (18%)

Query  39   KKAFRFL------------------PSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGM  80
            KKAFRF                   P SDV LLKE    +P    H +T   W  VA  M
Sbjct  10   KKAFRFTVSSCGLTSLASLRRSTSGPHSDVDLLKEAKLVSPHDCPHGQTAKRWEEVAEHM  69

Query  81   KA-SLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +A    L +  G  CRRRF  L+  FK + + +LRASGT E  ++R++LL D  +L
Sbjct  70   RAIHGDLVSIVG--CRRRFDDLLTAFKNDTVNALRASGTEEDVKKRDELLHDIADL  123

>SPRG_18521
Length=291

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 48/91 (53%), Gaps = 2/91 (2%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKAS--LPLCTADGKACRRRFYT  100
            +F  S DV +L+ V++  PW A H    ATW RVA  +  S    L    G A + RF T
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTD  131
            L+  F   +++ LR  GT   + ERE LLTD
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTD  124

>SPRG_08573
Length=265

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 5/103 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGK  92
            TK +K  +RF   +D+ LL+EVI   P  A + +T A W  V + M+A     L  A   
Sbjct  6    TKSKKPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMRALHGEHLTVA---  62

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             CR+RF  LM  FK + +  LRASGT E   +R  LL +  +L
Sbjct  63   GCRKRFDDLMAAFKTDSVNGLRASGTEEEMSQRFVLLEEMSDL  105

>SPRG_05316
Length=325

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 48/91 (53%), Gaps = 2/91 (2%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKAS--LPLCTADGKACRRRFYT  100
            +F  S DV +L+ V++  PW A H    ATW RVA  +  S    L    G A + RF T
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTD  131
            L+  F   +++ LR  GT   + ERE LLTD
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTD  124

>SDRG_17406
Length=264

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 5/103 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGK  92
            TK +K  +RF   +D+ LL+EVI   P  A + +T A W  V S M+      L  A   
Sbjct  6    TKSKKPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRTLHGEHLTVA---  62

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             CR+RF  LM  FK + ++ LRASGT E   +R  LL +  +L
Sbjct  63   GCRKRFDDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDL  105

>SDRG_17390
Length=264

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 5/103 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGK  92
            TK +K  +RF   +D+ LL+EVI   P  A + +T A W  V S M+      L  A   
Sbjct  6    TKSKKPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRTLHGEHLTVA---  62

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             CR+RF  LM  FK + ++ LRASGT E   +R  LL +  +L
Sbjct  63   GCRKRFDDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDL  105

>SDRG_06597
Length=317

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 48/91 (53%), Gaps = 2/91 (2%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKAS--LPLCTADGKACRRRFYT  100
            +F  S DV +L+ V++  PW A H    ATW RVA  +  S    L    G A + RF T
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWERVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTD  131
            L+  F   +++ LR  GT   + ERE LLTD
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTD  124

>SPRG_05929
Length=265

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 54/103 (52%), Gaps = 5/103 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGK  92
            TK +K  +RF   +D+ LL+EVI   P  A + +T A W  V + M+      L  A   
Sbjct  6    TKTKKPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMRTLHGEHLTVA---  62

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             CR+RF  LM  FK + +  LRASGT E   +R  LL +  +L
Sbjct  63   GCRKRFDDLMAAFKTDNVNGLRASGTEEEMSQRYVLLEEMSDL  105

>PYU1_G004359
Length=237

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 103/228 (45%), Gaps = 17/228 (7%)

Query  32   GTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG  91
            G   K+RK  FRF  + D  LL E +   P+AA H +  A W +VA  M   +     D 
Sbjct  16   GAHKKQRKVQFRFSHADDARLLTETVAVNPFAAPHGRVAARWAQVADNMGVDV-----DA  70

Query  92   KACRRRFYTLMEVFKREELESLRASGTTEAYE--EREQLLTDCFELadktekekrdaerr  149
            + CR R   L+  F+    +  RA+ +    E    +QLL D   L       + DA  +
Sbjct  71   RRCRERVILLLSQFRERGADDSRATDSANEGEADSMQQLLADVATLESIKAGSRDDALPQ  130

Query  150  eatSADIVRSAMQGMRNKRALSTDTE-LAtppstkkkkrsstDALLGFLEDRASSRNN--  206
                 D  R  ++  R +   + + E L     TK+     TD    F  D    RN   
Sbjct  131  TQE--DSERDVIESNRERAPRTPERESLERTMPTKRPHVEDTDESSSF-RDETKRRNEER  187

Query  207  RHSLKERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQLI  254
            R ++ E++L I ER+LALEE++LQ  + K     AM + +  L+++++
Sbjct  188  RLAMMEKELEISERKLALEERKLQLMEQKQ----AMETEEKRLLIEML  231

>H310_14414
Length=169

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPL-CTADGKACRRRFYTL  101
            +F    D+ LL ++   +P  A H K    W  +A  +  S+       G A + RF  L
Sbjct  24   KFACHHDIKLLLQIAFASPCEADHGKQLQAWSAIADALGQSVTFGLKKKGPAMKARFDVL  83

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTD  131
            M  F R E  SLR SGT E Y+EREQLL D
Sbjct  84   MSRFVRGESASLRKSGTAEEYKEREQLLQD  113

>PPTG_11368
Length=130

 Score = 55.1 bits (131),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTAD--------GKAC  94
            +F    DV+LL+ V    PW    R     +  +    +     C AD        G A 
Sbjct  31   KFAAVDDVVLLRAVNAFRPW----RAPVGIFNGIMKVFEDIAFQCGADPDFGVDKPGVAL  86

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            R RF TLM+ FKR++  S+R SGT E YEER++L  D
Sbjct  87   RTRFGTLMKEFKRDQCRSMRKSGTVEQYEERDRLSVD  123

>PHYCA_510606
Length=74

 Score = 52.8 bits (125),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 57/98 (58%), Gaps = 24/98 (24%)

Query  76   VASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            VA+G+KA+L  CTADGKACRRRF TL+E                  Y E  Q   D  E 
Sbjct  1    VATGLKAALTSCTADGKACRRRFNTLLE------------------YNEHVQAKADKTE-  41

Query  136  adktekekrdaerreatSADIVRSAMQGMRNKRALSTD  173
                 KE R+AERRE+ SA++V+ AM+G+R  R+ S++
Sbjct  42   -----KENREAERRESASAEVVQRAMEGLRRSRSGSSE  74

>H310_09071
Length=112

 Score = 53.9 bits (128),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 55/103 (53%), Gaps = 7/103 (7%)

Query  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG---K  92
            ++RK AFRF   +DV LLKEV    P+ A   +    W  V   ++  +     DG    
Sbjct  13   QRRKTAFRFKGCTDVDLLKEVKHVRPFEAPRGEVRKRWTEVTEHLQRII----GDGITVN  68

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
              R+RF  LM  F  + + +LRASGT E YEEREQLL D  +L
Sbjct  69   VTRKRFDDLMTAFHEDTMAALRASGTEEEYEEREQLLQDIHDL  111

>H310_10581
Length=241

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 45/91 (49%), Gaps = 3/91 (3%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVAS--GMKASLPLCTADGKACRRRFYT  100
            +F    D+ LL ++   + W A H K    W  +A   G  A+  L    G A + RF  
Sbjct  24   KFACHHDIKLLLQITFASRWEADHGKQLQAWSAIADALGQSATFGL-KKTGPAIKTRFDV  82

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTD  131
            LM  F R E  SLR SGT E YEE EQL+ D
Sbjct  83   LMSRFVRGESASLRKSGTAEEYEEGEQLMQD  113

>PHYCA_104165
Length=231

 Score = 55.1 bits (131),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 48/93 (52%), Gaps = 3/93 (3%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEA---TWGRVASGMKASLPLCTADGKACRRRFYT  100
            F  + D++LL+ V    PW A    T      +  VA+  +A       DG A R RF  
Sbjct  28   FTAADDIVLLRSVNLVKPWEAAMGTTNGIMKAFEVVAAKCRAVDGFPKKDGPALRTRFDR  87

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            L+  F+  +  SLR+SG+TE Y+ER++LL D  
Sbjct  88   LVRTFREAQRASLRSSGSTEEYKERDELLQDIV  120

>H257_03945
Length=230

 Score = 54.7 bits (130),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 45/87 (52%), Gaps = 2/87 (2%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKRE  108
            D  LLKEV++  P+  GH K  ATW + A  M    P     G+ C+ R  T++  F R+
Sbjct  16   DEALLKEVVRLGPFEVGHGKVTATWAKAAVAMHEYDP--NLSGRICQARCDTILHDFARD  73

Query  109  ELESLRASGTTEAYEEREQLLTDCFEL  135
               S+RASG  E  ++  +L  D  ++
Sbjct  74   NQASMRASGVYEDDDDMTKLKQDVLDI  100

>H257_15150
Length=145

 Score = 53.1 bits (126),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 2/93 (2%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGKACRRRFYT  100
            RF    D++LL+E+    P+ A   +    W  VA  +++         DGK  + RF  
Sbjct  8    RFTEDEDILLLREINGRLPFMAKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTL  67

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            L+E  + ++ E  RASGT E Y E+ QLL D  
Sbjct  68   LLEGHRHKDEEGKRASGTDEGYGEKFQLLDDLL  100

>H310_12832
Length=258

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 55/99 (56%), Gaps = 1/99 (1%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            +R  AFRF   +DV LLKEV    P+ A + +    W  V+  ++  +        A R+
Sbjct  14   RRNTAFRFKGCTDVELLKEVNHVRPFEAPYGEVRKRWTEVSEHLQ-RIYGTGITVNATRK  72

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            RF  LM  F+ E + +LRASGT E YEEREQLL D  +L
Sbjct  73   RFDDLMTAFQEETMAALRASGTEEEYEEREQLLQDNHDL  111

>H257_15235
Length=178

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query  54   KEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREELESL  113
            +EVI   P+ A H +    W +V   ++  L        A R+RF  LM  F  + + +L
Sbjct  8    EEVIHVRPYEAPHGEVRKRWTKVTEHLQ-RLHGVGITVNATRKRFDDLMTAFHADSMAAL  66

Query  114  RASGTTEAYEEREQLLTDCFEL  135
            R SGT E YEER QLL D  +L
Sbjct  67   RVSGTDEEYEERAQLLQDIHDL  88

>H257_13170
Length=198

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 5/99 (5%)

Query  34   DTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-TADGK  92
            DTK++K  F      D++LL++V    P+ A H    + W  VA  + +        +GK
Sbjct  6    DTKRKKSTF----DEDIVLLRQVSADLPFEASHGTIGSNWESVARTLTSCSTFGRNVNGK  61

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
             C+ RF  L++  K    E+++ASG +E   E+ QLL D
Sbjct  62   KCQNRFNILLDEQKILRQEAMKASGASEDETEKTQLLDD  100

>PHYCA_62751
Length=116

 Score = 51.2 bits (121),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 51/98 (52%), Gaps = 6/98 (6%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTAD---GKA  93
            KRKK   F  + DV LL++V    P+ A      A+W  +A+ +K        D   GK+
Sbjct  5    KRKK---FTKTDDVALLRQVQAELPFKAAKGGVMASWDALANNLKTLKDFSKEDTITGKS  61

Query  94   CRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
             + RF TL+   ++ + +S RASG  + Y E+ QLL D
Sbjct  62   AQARFNTLVASHRKFDKKSERASGIDQRYAEKRQLLDD  99

>H257_14889
Length=157

 Score = 51.2 bits (121),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR  95
            +K +K   +    D  LLKEV++  P+  GH K  ATW + A  M    P     G  C+
Sbjct  3    RKDRKQILWTDEMDEALLKEVVRLGPFEVGHDKVTATWAKAAVAMHEYDP--NLSGCICQ  60

Query  96   RRFYTLMEVFKREELESLRASGTTE  120
             R  T++  F R+   S+RASG  E
Sbjct  61   ARCDTILHDFARDIQASMRASGVYE  85

>H257_09054
Length=151

 Score = 50.8 bits (120),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPL-CTADGKACRRRFYTLM  102
            F  S ++ LL  V    PW A       TW  +AS +KA+       DG+ C+ RF  L 
Sbjct  34   FGCSDNITLLIAVNDAKPWTASSGSLMKTWTDIASDLKANRRFKVDKDGQGCKTRFDKLT  93

Query  103  EVFKREELESLRASGTTEAYEEREQLLTD  131
            + +    L ++R SGT E + E +Q L D
Sbjct  94   KAYMERTLTAMRGSGTDEEFGECKQPLED  122

>H257_02519
Length=268

 Score = 52.0 bits (123),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 46/91 (51%), Gaps = 3/91 (3%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRRRFYT  100
            +F    D++LL++V    PW   +      W  VA+ +       +    G A + RF  
Sbjct  17   KFARCHDIMLLQQVSLSRPWEGEYGTVMTIWAEVATELNRMPGFSMVKKPG-ALKTRFEY  75

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTD  131
            L+   ++ E  SLR SGTTE Y ER+QLLTD
Sbjct  76   LLAKHEKGESASLRKSGTTEEYSERDQLLTD  106

>PHYCA_96385
Length=135

 Score = 50.1 bits (118),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (52%), Gaps = 3/91 (3%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEA---TWGRVASGMKASLPLCTADGKACRRRFYT  100
            F  + D++L + V    PW A    T      +  VA+  +A       DG A R RF  
Sbjct  28   FTAADDIVLQRCVNLVKPWEAAMGTTNGIMKAFEVVAAKCRAVDGFPKKDGPALRTRFDR  87

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTD  131
            L+  F+  +  SLR+SG+TE Y+ER++LL D
Sbjct  88   LVRTFREAQRASLRSSGSTEEYKERDELLQD  118

>H257_16670
Length=136

 Score = 50.1 bits (118),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 43/99 (43%), Gaps = 31/99 (31%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            K+K A RF    DV LLKEV+   P  A + +T A W   A+                  
Sbjct  12   KKKPAHRFTTPQDVDLLKEVMSICPHDAPYGQTSARWAEKAT------------------  53

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
                         L SLRASGT E Y+EREQLL D  ++
Sbjct  54   -------------LASLRASGTDEEYDEREQLLQDLSDM  79

>H257_14013
Length=217

 Score = 51.6 bits (122),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGM--KASLPLCTADGKACRRRFYT  100
            RF    DV+LL+EV    P+ A        W  VA+ +           D K    RF  
Sbjct  8    RFTEEEDVMLLREVNARMPFRARRGAVMDAWAEVAAALLSHEDFDRSVFDAKRAHNRFTL  67

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            L+E  + +  ES+RASG  E Y E+ QLL +  
Sbjct  68   LLEGHRGDNRESMRASGVDEEYSEKMQLLDELL  100

>PHYSO_470381
Length=145

 Score = 50.1 bits (118),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 49/101 (49%), Gaps = 5/101 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
            TK+RK   RF    D  L++E     P+   + K    W  VA+ ++  +     DG+ C
Sbjct  7    TKRRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRC  61

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R R   L++ ++ ++  S + SG  E Y  +++ L +  E+
Sbjct  62   RERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  102

>H310_14154
Length=178

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +CR+RF   +  FK ++L SLRASGT E Y EREQL+ D  +L
Sbjct  13   SCRKRFDDFIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDL  55

>PHYSO_376280
Length=138

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 49/101 (49%), Gaps = 5/101 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
            TK+RK   RF    D  L++E     P+   + K    W  VA+ ++  +     DG+ C
Sbjct  7    TKRRKTMVRFTDERDFQLIQEAQAINPYGEDYGKKTQAWADVAAALEVDV-----DGRRC  61

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R R   L++ ++ ++  S + SG  E Y  +++ L +  E+
Sbjct  62   RERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  102

>H310_15369
Length=209

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)

Query  88   TADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            T    +CR+RF  L+  FK+  L++LRASGT E Y ER+QLL D  ++
Sbjct  8    TITASSCRKRFDDLLSAFKKATLKALRASGTEEEYNERDQLLQDIVDM  55

>H257_06253
Length=237

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 45/85 (53%), Gaps = 3/85 (4%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGK--ACRRRFYTLMEVFK  106
            D+ LLK+V    PW AG+ K  A W  V   +   +P    + K    + RF  L++   
Sbjct  29   DIQLLKQVNLSKPWEAGYGKVMAAWVEVCREV-IRIPGFKINKKPEGLKTRFDLLIKTHC  87

Query  107  REELESLRASGTTEAYEEREQLLTD  131
              E+ S+R SGT+E Y ER+ LLTD
Sbjct  88   EGEMASMRKSGTSEDYTERDLLLTD  112

>PHYKE_6162
Length=201

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)

Query  36  KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVA  77
           +KR+KAFRF  +SD++LL++V+  TPW+  H +T   W  VA
Sbjct  25  EKRRKAFRFQTASDIVLLRQVMARTPWSCPHGETGPAWDAVA  66

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 34/44 (77%), Gaps = 0/44 (0%)

Query  210  LKERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQL  253
            L++R+L +++RRL LEEQR +Q +  T+R L MM++Q  ++++L
Sbjct  147  LRQRELELEDRRLRLEEQRFEQQRQVTERQLEMMAAQTTVLLKL  190

>PYAP_24609
Length=405

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query  39   KKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR---  95
            KK + F   +D+ LLKE++   P+ A H K    +  V   +   L        ACR   
Sbjct  123  KKKYHFTVKADLALLKEMLNIRPFLAEHGKKGEKYETVTENLNEHLET----NLACRTVK  178

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
             RF  L++ F++ E  S R SG  E Y+E EQLLTD
Sbjct  179  ERFNLLVDKFEKAEASSRRKSGAAEDYDEYEQLLTD  214

>SDRG_12398
Length=264

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 45/92 (49%), Gaps = 1/92 (1%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPL-CTADGKACRRRFYTLM  102
            F    DV+L + V    PW A   +    W  +A  +  +       DG AC+ RF  ++
Sbjct  41   FNAWDDVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKIL  100

Query  103  EVFKREELESLRASGTTEAYEEREQLLTDCFE  134
             +    E E LR +GT + Y+ERE+LL + +E
Sbjct  101  RMTIGGEKEMLRKTGTDDEYDERERLLRNMYE  132

>SPRG_09172
Length=265

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 45/92 (49%), Gaps = 1/92 (1%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPL-CTADGKACRRRFYTLM  102
            F    DV+L + V    PW A   +    W  +A  +  +       DG AC+ RF  ++
Sbjct  42   FNAWDDVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKIL  101

Query  103  EVFKREELESLRASGTTEAYEEREQLLTDCFE  134
             +    E E LR +GT + Y+ERE+LL + +E
Sbjct  102  RMTIGGEKEMLRKTGTDDEYDERERLLRNMYE  133

>H310_12714
Length=377

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 14/100 (14%)

Query  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR  95
            +++K AFRF  S+D  LLKEV+   P+ A + +T A    +   M+          K  R
Sbjct  9    RRKKTAFRFSVSADSDLLKEVVMIAPFEAAYGQTGARGEEICEHMR----------KTIR  58

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R  +++ E   +     LR SGT E Y+ER QLL D  ++
Sbjct  59   RFAFSVQESHSK----GLRTSGTEEEYQERNQLLQDISDM  94

 Score = 32.7 bits (73),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 33/68 (49%), Gaps = 9/68 (13%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-----TADGKACRRRFYTLME  103
            D  LLK+V   TP+AA   + +  W     G+  +L  C       DGK  + RF  L++
Sbjct  272  DYTLLKQVAAGTPFAAEKGQLKRAW----QGLADTLMACENFGRVVDGKNLQNRFLALVD  327

Query  104  VFKREELE  111
              +++E E
Sbjct  328  EHRKQEKE  335

>H310_04124
Length=81

 Score = 47.4 bits (111),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 44/102 (43%), Gaps = 41/102 (40%)

Query  34   DTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKA  93
            D+ KRK AFRF  +SDV LLKE                                      
Sbjct  3    DSSKRKVAFRFKSASDVDLLKE--------------------------------------  24

Query  94   CRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
               RF  L+  FK ++L SLRASGT E Y EREQL+ D  +L
Sbjct  25   ---RFDDLIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDL  63

>PHYSO_453976
Length=138

 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/101 (25%), Positives = 50/101 (50%), Gaps = 5/101 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
            TK+R+   RF    D  L++E     P+   + K    W  VA+ ++  +     DG+ C
Sbjct  7    TKRRETIVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRC  61

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R R   L++ ++ +++ S + SG  E Y  +++ + +  E+
Sbjct  62   RERCDQLVDAYEAKQMASEKRSGPCEEYTPKDECVAELLEM  102

>PHYSO_254181
Length=154

 Score = 48.9 bits (115),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 49/101 (49%), Gaps = 5/101 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
            TK+RK   RF    D  L++E     P+   + K    W  VA+ ++  +     DG+ C
Sbjct  18   TKRRKTMVRFTDELDFQLIQEAQARYPYGEDYGKKTQAWADVAAALEVDV-----DGRRC  72

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R R   L++ ++ ++  S + SG  E Y  +++ L +  E+
Sbjct  73   RERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  113

>H257_04948
Length=247

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 49/102 (48%), Gaps = 3/102 (3%)

Query  32   GTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCT-AD  90
            G+D KK  ++F    S D+ LL EV    PW +        W ++A  +     L     
Sbjct  11   GSD-KKPSQSF-VSASDDIALLNEVSFSRPWESRRSAAGLAWEKIAKKLTTDTSLSAFKS  68

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            G A R+R   L++     E  SLR SG+TE Y+ R QLLTD 
Sbjct  69   GPALRKRTEFLLKKHAANEHASLRKSGSTEEYDVRTQLLTDV  110

>H257_04778
Length=147

 Score = 48.5 bits (114),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKRE  108
            D  LL+EV++  P+  GH K  ATW + A  M    P  +A  +AC+    TL+  F ++
Sbjct  16   DEALLREVVRLGPYEVGHGKVTATWTKAALAMHEFDPNISA--RACQTGCDTLLHEFSQD  73

Query  109  ELESLRASGTTEAYEEREQLLTDCFE  134
               S+RASG  E  ++  +L  D  +
Sbjct  74   NQRSVRASGVEEDDDDIVKLKQDILD  99

>PHYSO_380505
Length=138

 Score = 48.5 bits (114),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 49/101 (49%), Gaps = 5/101 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
            TK RK   RF    D  L++E     P+   + K   TW  VA+ ++  +     DG+  
Sbjct  7    TKPRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQTWADVAAALEVDV-----DGRRY  61

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R R+  L++ ++ ++  S + SG  E Y  +++ L +  E+
Sbjct  62   RERYNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  102

>CCI47495
Length=285

 Score = 50.1 bits (118),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 42/100 (42%), Gaps = 29/100 (29%)

Query  61   PWAAGHRKTEATWGRVASGMKAS-------LPLCTA-DGK--------------------  92
            PWAA H      W   A     S       L  C   DG                     
Sbjct  2    PWAAVHGYVREVWASAADAFSLSMREKFTKLDQCFGEDGNKDFASISALSGIGAVFHVNH  61

Query  93   -ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
             AC+RRF TL++  +R +L+SLRASG+ E   EREQLL D
Sbjct  62   IACKRRFDTLLDAHRRRDLDSLRASGSEEECCEREQLLLD  101

>H310_03385
Length=223

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 43/92 (47%), Gaps = 2/92 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTAD--GKACRRRFYTL  101
            F    DV+LL++V    P+ A H      W  VA  + +S      D  GK    RF  L
Sbjct  10   FSKEEDVLLLRQVASEMPFLARHGLIMDKWTAVAHALASSDEFGRPDFDGKKASNRFSAL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            +E  K+++ E  RASG  E   E++ L+ D  
Sbjct  70   IEAHKKKKNEFARASGVAEDMTEKDALMDDLI  101

>PHYCA_132727
Length=261

 Score = 48.9 bits (115),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 52/110 (47%), Gaps = 16/110 (15%)

Query  41   AFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYT  100
             FRF    D  LL+E+I+  P+AA    T   W  VA+ + ++  +   + K  R R   
Sbjct  2    VFRFSNDQDKELLRELIRLKPFAAIRGTTLRVWSDVAASLSSAFSV-EVNVKQIRDRLTL  60

Query  101  LMEVFKREELESLRASGTTEA---------YEEREQL------LTDCFEL  135
            L ++FK  E+ S R SG  E          Y+ERE+L      L D F+L
Sbjct  61   LKQIFKDSEVASARGSGVEEKADAVNIQSHYDEREELVREYVALEDHFKL  110

>H257_18023
Length=128

 Score = 47.4 bits (111),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 41/93 (44%), Gaps = 2/93 (2%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGM--KASLPLCTADGKACRRRFYT  100
            RF    DV+LL+EV    P+          W  VA+ +           D K    RF  
Sbjct  8    RFTEEEDVMLLREVNARMPFRVRRGAVMDAWAEVAAALLSHEDFDRPGFDAKRAHNRFTL  67

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            L+E  + +  ES+RASG  E Y E+ QLL +  
Sbjct  68   LLEGHRGDNRESMRASGVDEEYSEKMQLLDELL  100

>H310_14954
Length=149

 Score = 47.8 bits (112),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 48/101 (48%), Gaps = 6/101 (6%)

Query  33   TDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGK  92
            T TK+R     F    D++LL++V    P+   H +    W  VAS ++ S      D  
Sbjct  3    TQTKRRN----FTEQEDIMLLRQVSLEMPFQTRHGQVMERWAAVASALQGSGEFTRDDID  58

Query  93   ACR--RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            A R   RF  L++  +R   ES RASG +E   E+  LL D
Sbjct  59   AKRACNRFMLLLDGHRRINKESQRASGVSEEVGEKTILLDD  99

>PHYSO_548072
Length=362

 Score = 49.3 bits (116),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 51/97 (53%), Gaps = 5/97 (5%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACR  95
            R +  +F+ + D++LL +V++  PWA  H      W  V   ++  +   L    G AC+
Sbjct  139  RSQRRQFVSADDILLLTQVLETKPWAYPH--VMDGWQEVCDRLRGHSEFHLDKTAG-ACQ  195

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
             R   L++  K   + +LR SGT+E YE + +LLTD 
Sbjct  196  ARVALLLDHLKAGNIAALRKSGTSEEYERKRELLTDV  232

>PHYSO_325763
Length=157

 Score = 47.8 bits (112),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
            TK+RK   RF    D  L++E     P+   + K    W  VA+ ++  +     DG+ C
Sbjct  18   TKRRKTMVRFTDELDFQLIQEAQARNPYGKDYGKKTQAWADVAAALEVDV-----DGRRC  72

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            R R   L++ ++ ++  S + SG  E Y  +++ L +
Sbjct  73   RERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAE  109

>H257_18152
Length=209

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 43/92 (47%), Gaps = 2/92 (2%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA--DGKACRRRFYT  100
            RF    DV++L+EV    P+ A        W  VA  + +         D K  + RF  
Sbjct  8    RFSEYEDVLILREVNARLPFMAKRGLVMVGWAAVAEAVASQEEFSRPGFDAKRAQNRFTL  67

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            L+E  +  + ES+RASG  E Y E+ QLL + 
Sbjct  68   LLEGHRVRDDESMRASGVAEDYNEKSQLLDEL  99

>PHYCA_118350
Length=156

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 46/91 (51%), Gaps = 3/91 (3%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEA---TWGRVASGMKASLPLCTADGKACRRRFYT  100
            F  + D++LL+ V    PW A    T      +  VA+  +A       D  A R RF  
Sbjct  28   FTAADDIVLLRCVNLVKPWEAAMGTTNGIMKAFEVVAAKCRAVDGFPKKDDPALRTRFDR  87

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTD  131
            L+  F+  +  SLR+SG+T+ Y+E ++LL D
Sbjct  88   LVRTFREAQRASLRSSGSTQEYKEHDELLQD  118

>PHYSO_373613
Length=130

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            +RK   RF    D  L++E     P+   + K    W  VA+ +     +   DG+ CR 
Sbjct  1    RRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAAL-----VVDVDGRRCRE  55

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R   L++ ++ +++ S + SG  E Y  +++ L    E+
Sbjct  56   RCNQLVDAYEAKQMASEKPSGPCEEYAPKKECLAKLLEM  94

>H257_03208
Length=105

 Score = 45.8 bits (107),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 1/61 (2%)

Query  72   TWGRVASGMKASLPL-CTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLT  130
            TW  +A G++ +     T DG AC+ RF  L++    + L ++R SGT E + ER+QLL 
Sbjct  3    TWADLAKGLRDNRRFRLTKDGPACKSRFEKLIKAHSGDSLAAMRRSGTGEEFGERDQLLE  62

Query  131  D  131
            D
Sbjct  63   D  63

>H310_11608
Length=221

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 41/99 (41%), Gaps = 36/99 (36%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR  96
            KRK AFRF  +SD+ LLKE  +  P A                                 
Sbjct  6    KRKAAFRFKSASDIDLLKE--RFVPQA---------------------------------  30

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             F    + FKR  + SLRASGT E Y EREQ L D  +L
Sbjct  31   -FRRSTDAFKRNTISSLRASGTEEEYSEREQFLQDIVDL  68

>PYIW_25658
Length=148

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (51%), Gaps = 1/73 (1%)

Query  61   PWAAGHRKTEATWGRVASGMKASLP-LCTADGKACRRRFYTLMEVFKREELESLRASGTT  119
            PW +        W  +AS ++ +   +    G A + RF   M++F  ++L SLR SGT 
Sbjct  4    PWESSRNSIMKNWETIASTLRDNQSFIANKGGLAIKTRFEKTMKLFVSQDLASLRKSGTQ  63

Query  120  EAYEEREQLLTDC  132
            E Y+ RE LL D 
Sbjct  64   EKYQRRELLLKDI  76

>PHYSO_435001
Length=138

 Score = 46.2 bits (108),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 47/101 (47%), Gaps = 5/101 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
            TK+RK   R     D  L++E     P+   + K    W  VA+ ++  +     DG+ C
Sbjct  7    TKRRKMMVRVTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRC  61

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R R   L++ +K ++  S + SG  E Y  +++   +  E+
Sbjct  62   RERCNQLVDAYKAKQKASEKQSGPCEEYTPKDECRAELLEM  102

>H257_19436
Length=199

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 3/82 (4%)

Query  52   LLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGK--ACRRRFYTLMEVFKREE  109
            LLK+V    PW AG+ K  A W  V   +   +P    + K    + RF  L++     E
Sbjct  1    LLKQVNLSKPWEAGYDKVMAAWVEVCREVN-RIPGYKINKKPEGLKTRFDLLIKTHCEGE  59

Query  110  LESLRASGTTEAYEEREQLLTD  131
            + S+R SGT+E Y E++ LLTD
Sbjct  60   VASMRKSGTSEDYTEKDLLLTD  81

>PHYSO_536456
Length=212

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 0/43 (0%)

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            G A R RF TLM  FK ++ +S+R SGT E YEERE LL +  
Sbjct  23   GPAMRTRFTTLMSQFKADQYQSMRKSGTVEEYEEREVLLQNIL  65

>H310_13569
Length=205

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 41/93 (44%), Gaps = 2/93 (2%)

Query  39   KKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKAS--LPLCTADGKACRR  96
            K   RF  + DV+L +EV    P+ A        W  VA  + ++        DGK    
Sbjct  4    KDKLRFTDAEDVLLPREVNAKLPFKAKRGTVIIVWNEVADAVNSNEEFNRVGIDGKRALN  63

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
            RF  LM+        S RASG  E Y+E+ QLL
Sbjct  64   RFTLLMDNNHSSNEASSRASGIEEEYDEKTQLL  96

>H257_05648
Length=172

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGM--KASLPLCTADGKACRRRFYT  100
            RF  + D+++L+EV    P+ A        W  VA  +  K        DGK    RF  
Sbjct  8    RFSDAEDILILREVNARLPFTAKRGSVMLAWNTVADAVSTKHDFARPGFDGKRALNRFTL  67

Query  101  LMEVFKREELESLRASGTTEAYEEREQLL  129
            LME  +     S RASG  E ++E+ QLL
Sbjct  68   LMEGHRANNDVSARASGIDEDHDEKTQLL  96

>H257_13978
Length=172

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 38/72 (53%), Gaps = 1/72 (1%)

Query  61   PWAAGHRKTEATWGRVASGMKASLPL-CTADGKACRRRFYTLMEVFKREELESLRASGTT  119
            PW A   +   TW  +A  ++ +     T DG AC+ RF  L++    + L ++R SGT 
Sbjct  28   PWEAPSGQVMNTWADLAKDLRDNRRFRLTKDGAACKSRFENLIKAHCGDSLAAMRRSGTD  87

Query  120  EAYEEREQLLTD  131
            E + E +QLL D
Sbjct  88   EEFGECDQLLED  99

>PHYKE_4001
Length=496

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTAD--GKACRRRFYT  100
            +F  + D++LL EV+   PWA  H      W +VA  ++  L  C  +    AC+ R   
Sbjct  267  QFSSADDIVLLTEVLSMKPWAFAHEMD--GWQQVALNLR-ELTACRLEKTAGACQSRIML  323

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            L+E  +   + +LR SGT + +  + +LLT+ 
Sbjct  324  LLEHLRAGNIAALRKSGTEDEFSRKHELLTEV  355

>H257_08032
Length=251

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 44/87 (51%), Gaps = 1/87 (1%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCT-ADGKACRRRFYTLM  102
            F    D++L + V +  PWAA   +    W  +A  +  +       DG AC+ RF  ++
Sbjct  30   FCARDDILLCEAVNEVKPWAARSGEIMMYWANIADKLMHTRGFALRKDGPACKTRFEKIV  89

Query  103  EVFKREELESLRASGTTEAYEEREQLL  129
            ++    E + LR SG+ + + ERE+L+
Sbjct  90   KMITGGEQDVLRKSGSEDEFAERERLV  116

>PPTG_02416
Length=125

 Score = 44.7 bits (104),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 48/104 (46%), Gaps = 10/104 (10%)

Query  41   AFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYT  100
             FRF    D  LL+E+I+  P+AA    T   W  VA+ + ++  +   + K  R R   
Sbjct  2    VFRFSNDQDKELLRELIRLKPFAAVRGTTLRVWSDVAASLSSAFGV-EVNVKQIRDRLTL  60

Query  101  LMEVFKREELESLRASGTTEA---------YEEREQLLTDCFEL  135
            L + FK  E  S R SG  E+         Y+ERE L+ +   L
Sbjct  61   LKQSFKDSEATSARGSGIEESVDAVNVQSHYDEREGLVREYVAL  104

>H257_13889
Length=138

 Score = 44.7 bits (104),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKRE  108
            ++ +L+E I+  P+AA H +  A W  VA+ +    P  T   +A R   Y L++ FK +
Sbjct  20   ELAILREAIRVEPFAADHGELLARWTLVAAAVAEQEPRVT--PRAAREHVYMLLKKFKAD  77

Query  109  ELESLRASGTTEAYEEREQLLTDC  132
            +     +SGT E   E+ QLL D 
Sbjct  78   DQAQRLSSGTAEEVTEKVQLLQDI  101

>PHYSO_448112
Length=115

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 1/87 (1%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLM  102
            RF  +SD  LL EV+   P+AA  +     W  VA+ + A+L    +  +ACR R   L+
Sbjct  3    RFNATSDKALLAEVLATPPFAADRKTVTGVWKGVANRLNATLSEAFS-FRACRDRTSLLL  61

Query  103  EVFKREELESLRASGTTEAYEEREQLL  129
              +   +  +  ASGT+E + E + +L
Sbjct  62   RKYAVRKARNEAASGTSEVHTENDDIL  88

>PPTG_14366
Length=283

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 51/105 (49%), Gaps = 3/105 (3%)

Query  30   VAGTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA  89
            V   D   + K  +F  + DV LL++V    P+ A      A+W  +A+ +K        
Sbjct  112  VPPEDIPSKSKRKKFTNADDVALLRQVQADMPFKAAKGGVMASWDSLANNLKTLKNFSKK  171

Query  90   D---GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            D   GK+ + RF TL+  +++ + +S  AS   + Y E+ QLL D
Sbjct  172  DTISGKSAQARFNTLVISYRKFDRKSEGASDIDQRYAEKRQLLDD  216

>PHYSO_492787
Length=130

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 1/87 (1%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLM  102
            RF  +SD  LL EV+   P+AA  +     W  VA+ + A+L    +  +ACR R   L+
Sbjct  3    RFNATSDKALLAEVLATPPFAADRKTVTGVWKGVANRLNATLSEAFS-FRACRDRTSLLL  61

Query  103  EVFKREELESLRASGTTEAYEEREQLL  129
              +   +  +  ASGT+E + E + +L
Sbjct  62   RKYAVRKARNEAASGTSEVHTENDDIL  88

>PHYSO_377140
Length=105

 Score = 43.9 bits (102),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 1/87 (1%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLM  102
            RF  +SD  LL EV+   P+AA  +     W  VA+ + A+L    +  +ACR R   L+
Sbjct  3    RFNATSDKALLSEVLATLPFAADRKTVTGVWKGVANRLNATLSEAFS-FRACRDRTRLLL  61

Query  103  EVFKREELESLRASGTTEAYEEREQLL  129
              +   +  +  ASGT+E + E + +L
Sbjct  62   RKYVVRKARNEAASGTSEVHTENDDIL  88

>PYIW_25568
Length=126

 Score = 44.3 bits (103),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 1/61 (2%)

Query  73   WGRVASGMKASLPLCT-ADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            W  +AS ++ +        G A + RF  +M++F  ++L SLR SGT E Y+ERE LL D
Sbjct  23   WKTIASILRENQSFIADKGGPALKTRFEKIMKLFMSQDLASLRKSGTQEEYQERELLLGD  82

Query  132  C  132
             
Sbjct  83   I  83

>PHYCA_14089
Length=199

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 45/101 (45%), Gaps = 5/101 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
            TKKRK   RF    D  LLKEV+   P+     + E      A    AS      D + C
Sbjct  7    TKKRKTQVRFDEDDDDALLKEVLAANPF-----EVERGGKTAAWAAVASALALDVDARRC  61

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R R   L+  FK +   S  ASG  E + ER+ LL D  EL
Sbjct  62   RERCSLLLTDFKAKMARSEAASGIDEEHTERDDLLADVLEL  102

>PPTG_16083
Length=241

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 46/84 (55%), Gaps = 7/84 (8%)

Query  30   VAGTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA  89
            +A    KKR++ F F   +D+ LLKE++ + P+A GH K  A +  VA  + A L L   
Sbjct  154  IASKADKKRRRKFFFDQKADLALLKEMLANEPFAGGHGKIGARYQLVADNLSAHLKL---  210

Query  90   DGKACRR----RFYTLMEVFKREE  109
            D K  +R    RF  L++ FK+ +
Sbjct  211  DQKLSKRTVQERFALLLDEFKQND  234

>H310_13824
Length=169

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 6/55 (11%)

Query  81   KASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            K  L +C      CRRRF  L+  FK+  L++L +SGT E Y E +QLL D  +L
Sbjct  3    KQLLAIC------CRRRFDDLLAAFKKATLKALHSSGTEEEYNELDQLLQDIVDL  51

>PYIW_26363
Length=144

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 45/101 (45%), Gaps = 3/101 (3%)

Query  34   DTKKRKKAFRFLPSSDVI-LLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTAD  90
            D +  K     LP+     L +EV    P+ AG+      W  VA+ +K    L + +  
Sbjct  4    DERPHKPPSALLPTKTCFSLAREVNAKLPYRAGYNGVMNAWTAVAAALKIIPDLGMASVT  63

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
             K+C  RF  L+E+ +    ES RAS  +E   E   +L D
Sbjct  64   AKSCHSRFKALIELHRCSNRESARASDVSEEITELACVLGD  104

>H257_19019
Length=229

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKRE  108
            +V LL+EV +  P+AA H      W  VASG+ A  P     G   R     +++ FK+E
Sbjct  27   EVELLREVSRIEPFAADHGDLLQRWKLVASGLSAHEPKINYRG--AREHVDAMLKQFKQE  84

Query  109  ELESLRASGTTEAYEEREQLLTDCF  133
            +     +SGT E   E+ QLL D  
Sbjct  85   DKVQQLSSGTDEDVTEKVQLLQDLI  109

>H310_04318
Length=179

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)

Query  94   CRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            CRRRF  L+  FK+  L++LR+SGT E Y +R+QLL    +L
Sbjct  14   CRRRFDDLLAAFKQATLKALRSSGTEEEYNKRDQLLQGIVDL  55

>PITG_12686
Length=223

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 40/90 (44%), Gaps = 10/90 (11%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLME  103
            F  + D+ILL+ V    PW +       T G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICNETAGFVRDKQ----------GPALRTRFDKLIR  86

Query  104  VFKREELESLRASGTTEAYEEREQLLTDCF  133
              +  ++ S R+SGTTE Y ER+ LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDVLLQDIV  116

>H310_04215
Length=257

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCT-ADGKACRRRFYTLM  102
            F    D++L   V +  PW A   +   +W  +A  +  +       DG AC+ RF  ++
Sbjct  24   FCARDDILLCLAVKEIKPWEAPSGEIMMSWAHIAEKLLHTRGFALRKDGPACKTRFEKIL  83

Query  103  EVFKREELESLRASGTTEAYEEREQLL  129
            ++    E + LR SG  E + ERE+L+
Sbjct  84   KMITGGESDVLRKSGNDEEFAERERLV  110

>H257_00956
Length=202

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 40/89 (45%), Gaps = 2/89 (2%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA--DGKACRRRFYT  100
            RF  + D+++L+EV    P+ A        W  VA  +  +        DGK    RF  
Sbjct  8    RFSDTEDILILREVNARLPFNAKRGSVMLAWNAVADAVSTNHDFAWPGFDGKRALNRFTL  67

Query  101  LMEVFKREELESLRASGTTEAYEEREQLL  129
            LME        S RASG  E ++E+ QLL
Sbjct  68   LMEGHCANNDVSARASGIDEDHDEKTQLL  96

>H257_18551
Length=221

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKRE  108
            ++ +L+E I+  P+AA H +  A W  VA+ +    P  T   +A R   + L++ FK +
Sbjct  20   ELAILREAIRVEPFAADHGELLARWTLVAAAVAEQEPRVTP--RAAREHVHMLLKKFKAD  77

Query  109  ELESLRASGTTEAYEEREQLLTDC  132
            +     +SGT E   E+ QLL D 
Sbjct  78   DQAQRLSSGTAEEVTEKVQLLQDI  101

>PITG_19098
Length=295

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 40/90 (44%), Gaps = 10/90 (11%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLME  103
            F  + D+ILL+ V    PW +       T G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAEDICNETAGFVRD----------KQGPALRTRFDKLIR  86

Query  104  VFKREELESLRASGTTEAYEEREQLLTDCF  133
              +  ++ S R+SGTTE Y ER+ LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDVLLQDIV  116

>PYAP_22661
Length=218

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query  61   PWAAGHRKTEATWGRVASGMKASLPLCTA-DGKACRRRFYTLMEVFKREELESLRASGTT  119
            PWA    K    W RVAS + A        D ++CR RF  L++ FK     +LR + T 
Sbjct  28   PWAQA--KIMDAWSRVASALGADDAFNGERDARSCRSRFLLLVKHFKESNHTALRRTATD  85

Query  120  EAYEEREQLL  129
            + +E++ QLL
Sbjct  86   DEFEDKMQLL  95

>H310_12821
Length=179

 Score = 43.1 bits (100),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 46/102 (45%), Gaps = 4/102 (4%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-TADGKA  93
            T+KR+    + P  D+ LL +V    P+AA   + +  W  +A  + A        DGK 
Sbjct  4    TEKRRN---WSPEEDITLLIQVAADRPFAAEKGQLKKAWQALADTLMACDHFGRVVDGKK  60

Query  94   CRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             + RF  L+E  K  + ES R SG      E+  LL D   L
Sbjct  61   VQNRFLALVEEHKIFDAESARLSGVDAEEREKHVLLDDIVNL  102

>H257_07657
Length=212

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 47/104 (45%), Gaps = 6/104 (6%)

Query  32   GTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG  91
             T TK+R     F    DV+LL++V    P+ A        W  VAS ++ +     +D 
Sbjct  2    ATPTKRRN----FTEDDDVMLLRQVSLEMPFQARRGHVMERWADVASALEMADDFRRSDI  57

Query  92   KACR--RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
             A R   RF  L++  ++   +S RASG  E   E+  LL D  
Sbjct  58   DAKRACNRFMLLLDAHRKANNQSQRASGVAEDVSEKTVLLDDLL  101

>PHYRA_75877
Length=406

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 51/99 (52%), Gaps = 6/99 (6%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPL-CTADGKA  93
            +K RK+   F+ + D++LL +V++  PWA  H      W +V+  ++A           A
Sbjct  183  SKGRKQ---FVSADDILLLTQVLQTKPWAFQH--VMDGWQQVSDQLRAHDEFRLEKTAGA  237

Query  94   CRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            C+ R   L++  +     +LR +GT++ YE + +LL + 
Sbjct  238  CQARVVLLLDHLRAGNAAALRKAGTSDEYERKRELLVEV  276

>PPTG_06633
Length=292

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 40/82 (49%), Gaps = 1/82 (1%)

Query  42   FRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTL  101
            FRF   +D  L++E I   P+AA +  +   W  VA  M A++ +   + K  R R   L
Sbjct  3    FRFTNENDKELMREAIAQKPFAAKYGDSARVWATVAERMSAAIQIVVLE-KQVRDRVRLL  61

Query  102  MEVFKREELESLRASGTTEAYE  123
             ++++  EL S   SG  E  E
Sbjct  62   KKIWRAGELRSALGSGIEETLE  83

>H310_14898
Length=140

 Score = 42.4 bits (98),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
             K CR+R   L   F+++ + SLRAS T E Y ER+QLL D
Sbjct  11   AKGCRKRCDDLHSAFQQDSVASLRASRTDEQYAERDQLLQD  51

>H257_17402
Length=149

 Score = 42.4 bits (98),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (48%), Gaps = 9/92 (10%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-----TADGKACRRRFYTLME  103
            D+ LLK+V   TP+AA   +    W     G+  +L  C       DGK  + RF  L++
Sbjct  15   DLTLLKQVTADTPFAAEKGQLRKAW----QGLAETLMSCENFGRVVDGKKVQNRFQALVD  70

Query  104  VFKREELESLRASGTTEAYEEREQLLTDCFEL  135
              ++ +  S R SG+ +  +E+  LL D   L
Sbjct  71   EHRKFDATSARLSGSDQEEKEKHMLLDDIITL  102

>PHYSO_330097
Length=203

 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 44/94 (47%), Gaps = 5/94 (5%)

Query  42   FRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTL  101
             RF    D  L++E     P+   + K    W  VA+ ++  +     DG+ CR R   L
Sbjct  2    VRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRCRERCNQL  56

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            ++ ++ ++  S + SG  E Y  +++ L +  E+
Sbjct  57   VDAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  90

>H257_12325
Length=191

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (48%), Gaps = 2/92 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR--RRFYTL  101
            F    D++LL++V     + A        W  VA+ ++ S     +D  A R   RF  L
Sbjct  10   FSEEDDIMLLRQVSLEMQFQARRGLVMERWNSVAASLRTSEDFSRSDIDAKRLCNRFMLL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            ++ +++ + +S RASG  E + E+  LL D  
Sbjct  70   LDAYRKSDKQSERASGIDEEFTEKSMLLDDLL  101

>PPTG_03797
Length=210

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 42/81 (52%), Gaps = 1/81 (1%)

Query  41   AFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYT  100
             FRF    D  L+ EVIK  P+AA + +T   W +VA+ + AS+ +   D K  + R   
Sbjct  2    VFRFSEDMDKELMCEVIKQRPFAAKYGETGTVWVQVATRVSASIKVVVID-KQVQDRVRL  60

Query  101  LMEVFKREELESLRASGTTEA  121
            L + ++  EL +   SG  EA
Sbjct  61   LKKNWRAGELRATLGSGIEEA  81

>PHYCA_503833
Length=313

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (50%), Gaps = 8/105 (8%)

Query  30   VAGTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLC  87
            VA   T  RK+   F+ + D++LL +V+   PWA  + +    W  V   ++      L 
Sbjct  121  VAPKTTPGRKQ---FVSADDILLLTQVLITKPWA--YPQLMDGWQEVCEQLREHNDFNLE  175

Query  88   TADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
               G AC+ R   L++ F    + +LR SGT+E YE + +LL + 
Sbjct  176  KTAG-ACQARMLLLLDHFHAGNVAALRKSGTSEEYERKRELLIEV  219

>PHYCA_38983
Length=217

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLME  103
            F  + D+ILL+ V    PW +         G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICNEMAGFVRD----------KQGPALRTRFDKLIR  86

Query  104  VFKREELESLRASGTTEAYEEREQLLTDCF  133
              +  ++ S R+SGTTE Y ER++LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDELLQDIV  116

>SPRG_00310
Length=254

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 0/43 (0%)

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             CR+RF  LM  F+++ ++++RASGT E   ER+ LL D  +L
Sbjct  13   GCRKRFDDLMAAFEKDAVKAMRASGTEEEVSERDMLLQDISDL  55

>PPTG_00272
Length=436

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 50/92 (54%), Gaps = 5/92 (5%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRRRFYT  100
            +F+ + D++LL +V++  PWA  + +    W  V   ++  +   L    G AC+ R   
Sbjct  219  QFVSADDILLLSQVLETKPWA--YPQLMDGWQEVCDQLRQHSDFNLDKTAG-ACQARVVL  275

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            L++  +   + +LR SGT++ YE + +LLT+ 
Sbjct  276  LLDHLRAGNVAALRKSGTSQEYERKRELLTEV  307

>H257_13434
Length=236

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (48%), Gaps = 9/92 (10%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-----TADGKACRRRFYTLME  103
            D+ LLK+V   TP+AA   +    W     G+  +L  C       DGK  + RF  L++
Sbjct  15   DLTLLKQVAADTPFAAEKGQLRKAW----QGLAETLMPCENFGRVVDGKKVQNRFLALVD  70

Query  104  VFKREELESLRASGTTEAYEEREQLLTDCFEL  135
              ++ +  S R SG+ +  +E+  LL D   L
Sbjct  71   EHRKFDATSARLSGSDQEEKEKHMLLDDIITL  102

>H310_15319
Length=227

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (45%), Gaps = 2/92 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGKACRRRFYTL  101
            +    D++LL++V    P+ A H      W  VA  + A  +      D K    RF  L
Sbjct  10   YTDEEDLMLLRQVAYEMPFLARHGLIMDKWASVAQALAADENFSRPDFDAKKANNRFAAL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            ++  K+   E+ +ASG +E   E+  LL D  
Sbjct  70   LDAHKKRNKEAEQASGVSEEVTEKVTLLDDLL  101

>PHYCA_4828
Length=295

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLME  103
            F  + D+ILL+ V    PW +         G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICNEMAGFVRD----------KQGPALRTRFDKLIR  86

Query  104  VFKREELESLRASGTTEAYEEREQLLTDCF  133
              +  ++ S R+SGTTE Y ER++LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDELLQDIV  116

>PHYCA_98971
Length=295

 Score = 43.1 bits (100),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLME  103
            F  + D+ILL+ V    PW +         G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICNEMAGFVRD----------KQGPALRTRFDKLIR  86

Query  104  VFKREELESLRASGTTEAYEEREQLLTDCF  133
              +  ++ S R+SGTTE Y ER++LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDELLQDIV  116

>PHYSO_295819
Length=193

 Score = 42.4 bits (98),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query  42   FRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTL  101
            F F   +D+ L KE++   P+AA H   +  + +VA  +   L +   D +  + R   L
Sbjct  87   FFFTQEADLALFKEMLSLEPYAAEHGFKKQRYQQVADNLSEHLKVKLLD-RTVKDRLELL  145

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDC  132
            +  FK ++    + SG +E Y E ++LL D 
Sbjct  146  LAEFKLDDQSYRKKSGGSEQYTEHKRLLQDI  176

>H257_00377
Length=223

 Score = 42.4 bits (98),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (47%), Gaps = 2/92 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR--RRFYTL  101
            F    D++LL++V    P+ A        W  VA+ ++ +     +D  A R   RF  L
Sbjct  10   FSEEDDIMLLRQVSLEMPFQARRGLVMERWNSVAASLRTAEDFSRSDIDAKRSCNRFMLL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            ++  ++ + +S RASG  E   E+  LL D  
Sbjct  70   LDAHRKSDKQSERASGIDEEVTEKSMLLDDLL  101

>PHYCA_125686
Length=290

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 5/99 (5%)

Query  37   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTAD--GKAC  94
            KRKK   F    D++LL++V    P+A+        W  +A+ +K        +  GK+ 
Sbjct  33   KRKK---FSKHDDLVLLRQVNADQPFASVRGSLMDAWTSLANKVKVVEGFSKQEITGKSA  89

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            + RF  L+E  +  + +S  ASG +E Y E +QLL +  
Sbjct  90   QARFNVLVENHREADKKSAAASGVSEDYTESQQLLDEIV  128

>HYAP_00630
Length=432

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 50/101 (50%), Gaps = 5/101 (5%)

Query  32   GTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTA  89
            G  T +     +F+ + D++LL +V    PWA  H      W  V S ++  ++  L   
Sbjct  204  GITTGRTASRKQFVSADDILLLTQVKVTKPWAYPHLMD--GWQAVCSELRKHSNFNLEKT  261

Query  90   DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLT  130
             G AC+ R   L++  +   + +LR SGT E YE++ +LL 
Sbjct  262  AG-ACQARVALLLDHLRAGNVAALRKSGTLEEYEQKRELLV  301

>H257_07755
Length=181

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 5/83 (6%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKRE  108
            +V LL+EV +  P+AA + +    W  VASG    +     + ++ R     +++ FK++
Sbjct  21   EVALLREVTRIKPFAADNSELLQRWKLVASGQVPKI-----NYRSAREHVDVMLKDFKKD  75

Query  109  ELESLRASGTTEAYEEREQLLTD  131
            +    R+SGT E   ER QLL D
Sbjct  76   DDAQKRSSGTEEYVTERVQLLQD  98

>PHYCA_124712
Length=202

 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            G A R RF  L+  FK ++ +S+R SGT E Y ERE LL D 
Sbjct  23   GTAMRTRFTNLVSQFKTDQCQSMRKSGTVEEYAEREVLLQDI  64

>PPTG_04118
Length=274

 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query  61   PWAAGHRKTEATWGRVASGMKASLPLCTADGKACRR----RFYTLMEVFKREELESLRAS  116
            P+A GH K  A +  +A  +   L L   D K  +R    RF  L++ FK+ +    + +
Sbjct  6    PFAGGHGKIGARYQLMADNLSVHLKL---DPKLSKRTVQERFTLLLDEFKQNDQAYRKKT  62

Query  117  GTTEAYEEREQLLTDC  132
            G  E YEE +QLL D 
Sbjct  63   GVAENYEEHKQLLQDL  78

>PITG_05131
Length=200

 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 28/45 (62%), Gaps = 0/45 (0%)

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            G A R RF  L+  +K ++ +S+R SGTTE Y ERE LL +   L
Sbjct  23   GTAMRTRFTNLVNQYKADQCQSMRKSGTTEEYAEREVLLQNIVTL  67

>PPTG_06289
Length=240

 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 8/55 (15%)

Query  87   CTAD--------GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            C AD        G A R RF TL+  FKR++ +S+R S T E + ER++LL D  
Sbjct  11   CGADPEFGVNKRGAALRTRFATLLREFKRDQCQSMRMSETVEQFRERDRLLLDII  65

>PHYSO_378731
Length=138

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/101 (24%), Positives = 45/101 (45%), Gaps = 5/101 (5%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKAC  94
            TK+RK   RF       L++E     P+   + K    W  VA+  +  +     DG+  
Sbjct  7    TKRRKTMVRFTDELHFQLIQEAQARNPYGEDYGKKSQAWADVAAAFEVDV-----DGRRY  61

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            R R   L++ ++ ++    + SG  E Y  +++ L +  E+
Sbjct  62   RERCNQLLDAYEAKQKAGEKRSGPCEEYTPKDECLAELLEM  102

>PYVX_23885
Length=326

 Score = 40.8 bits (94),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 67/156 (43%), Gaps = 13/156 (8%)

Query  31   AGTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCT  88
            AG +T + ++  RF    D +L  +V    P+ A H      W  VA  +   +   + T
Sbjct  48   AGQNTTRLRQ--RFGDEEDYLLAVQVNADLPFTAKHGSLGKAWDEVAKKLNECSKFMMRT  105

Query  89   ADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELadktekekrdaer  148
              G   + RF TL+E  +  E+ S   SGT E   E   L+T+   L D     K+    
Sbjct  106  IKGTTAKARFETLIENHRAWEMTSKAKSGTQEEESEYIVLMTELVNLVDDHSDAKKSQVE  165

Query  149  -------reatSADIVRSAMQG--MRNKRALSTDTE  175
                    +  S ++VRSA      RNKR  STD++
Sbjct  166  ENNDDERAKTASGEVVRSAAVSRLKRNKRRASTDSD  201

>H257_18543
Length=323

 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  90   DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            DG+ C  RF  L + +K   L S+R SGT E ++E EQLL D
Sbjct  68   DGQGCTTRFDKLAKAYKERSLVSIRRSGTDEEFKECEQLLED  109

>H257_14759
Length=198

 Score = 39.7 bits (91),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGM--KASLPLCTADGKACRRRFYTL  101
            +    D++LL++V    P+ A   +    WG VA  +           D K  + RF  +
Sbjct  10   YTEQEDIMLLRQVNAERPFEAKKGEFMKVWGLVAKALADHEGFARPQFDAKKAQNRFSAV  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            M+       ES  ASG  E Y+ER  LL +  
Sbjct  70   MDNHVHYNRESAMASGVAETYDERIALLDELL  101

>H310_15068
Length=108

 Score = 38.5 bits (88),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 38/91 (42%), Gaps = 2/91 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTAD--GKACRRRFYTL  101
            F    D++LL++V    P+ A        W + A  +         D   K    RF  L
Sbjct  10   FTDEEDLLLLRQVSADMPFLARRGFVMDKWAQTAQALAGCEEFGRPDFDAKKANNRFNAL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDC  132
            +E  ++   ES RASG +E   E+  LL  C
Sbjct  70   IEAHRKSNQESSRASGISEEVTEKVMLLNCC  100

>PITG_05827
Length=364

 Score = 40.4 bits (93),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 51/97 (53%), Gaps = 5/97 (5%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACR  95
            R +  +F+ + D++LL +V++  PWA  + +    W  V   ++  ++  L    G AC+
Sbjct  142  RSQRTQFVSADDILLLSQVLETKPWA--YPQIMDGWQEVCRQLRQHSNFNLDKTAG-ACQ  198

Query  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
             R   L++  +     +LR SGT++ YE + +LL + 
Sbjct  199  ARVVLLLDHLRAGNSIALRKSGTSQEYERKRELLAEV  235

>SDRG_17294
Length=68

 Score = 37.4 bits (85),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 0/44 (0%)

Query  39  KKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA  82
           KKAFRF  +SDV LLKEV+  +P+   + +    W  VA  M+ 
Sbjct  10  KKAFRFTVASDVDLLKEVMFVSPYDCQYGQVAKRWEEVAEHMRV  53

>H310_13843
Length=118

 Score = 38.5 bits (88),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            G+ CR        V  R  + SLRASGT E Y E EQLL D  +L
Sbjct  2    GRGCRE------HVHDRNTISSLRASGTEEEYSEHEQLLQDIVDL  40

>H257_07871
Length=201

 Score = 39.7 bits (91),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 7/93 (8%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRRRFYT  100
            +F    D+ LLK+V    PW   + K    W  +A+ +       +    G + + RF  
Sbjct  17   KFACCHDITLLKQVSLSRPWEGEYGKVMTIWAEIAAELNRMPGFSMVKKPG-SLKTRFEY  75

Query  101  LMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            L+   ++ E  SLR SGTTE +    QL  D F
Sbjct  76   LLAKHEKGESASLRKSGTTEEH----QLRVDDF  104

>PHYRA_75884
Length=432

 Score = 40.0 bits (92),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGKACRRRFYTL  101
            F+ S D++LL  V+   PW A +      W  V   M+A  S  L    G AC+ R + L
Sbjct  219  FVASDDILLLTHVLAAKPWEAPYAMD--GWLHVVEQMRADASFRLEKTAG-ACQARLHLL  275

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDC  132
            +   K   L +LR +GT + +E +  LL + 
Sbjct  276  LGHLKAANLTALRKAGTEDEFERKCALLREV  306

>H257_16845
Length=209

 Score = 39.7 bits (91),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 32/63 (51%), Gaps = 2/63 (3%)

Query  73   WGRVASGMKA--SLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLT  130
            W  VA  +++         DGK  + RF  L+E  + ++ E  RASGT E Y E+ QLL 
Sbjct  11   WSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEGHRHKDEEGKRASGTDEGYGEKFQLLD  70

Query  131  DCF  133
            D  
Sbjct  71   DLL  73

>PITG_08385
Length=204

 Score = 39.3 bits (90),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQ  127
            G A R RF  L+  +K ++ +S+R SGTTE Y EREQ
Sbjct  23   GTAMRTRFTNLVNQYKADQCQSMRKSGTTEEYAEREQ  59

>H257_07182
Length=209

 Score = 39.3 bits (90),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 32/63 (51%), Gaps = 2/63 (3%)

Query  73   WGRVASGMKA--SLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLT  130
            W  VA  +++         DGK  + RF  L+E  + ++ E  RASGT E Y E+ QLL 
Sbjct  11   WSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEGHRHKDEEGKRASGTDEGYGEKFQLLD  70

Query  131  DCF  133
            D  
Sbjct  71   DLL  73

>SPRG_18045
Length=215

 Score = 39.3 bits (90),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 25/43 (58%), Gaps = 0/43 (0%)

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
             CR+RF  LM  FK + +  LRASGT E   ER  LL +  +L
Sbjct  13   GCRKRFDDLMAAFKTDNVNGLRASGTEEEMRERYVLLEEMSDL  55

>PHYRA_86856
Length=391

 Score = 40.0 bits (92),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGKACRRRFYTL  101
            F+ S D++LL  V+   PW A +      W  V   M+A  S  L    G AC+ R + L
Sbjct  219  FVASDDILLLTHVLAAKPWEAPYAMD--GWLHVVEQMRADASFRLEKTAG-ACQARLHLL  275

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDC  132
            +   K   L +LR +GT + +E +  LL + 
Sbjct  276  LSHLKAANLTALRKAGTEDEFERKCALLREV  306

>PYAR_24700
Length=154

 Score = 38.5 bits (88),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 5/88 (6%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRRRFYTL  101
            F  + D+ LL+E   H PWA         W  +A  ++  AS P    DGKA   RF  L
Sbjct  9    FTCADDINLLREASFHRPWAQPW--LMRAWETLAQRLRTYASFPQ-DKDGKALSTRFNLL  65

Query  102  MEVFKREELESLRASGTTEAYEEREQLL  129
            ++ ++   + S+R SG  E + EREQLL
Sbjct  66   VKKYRENAVHSMRKSGREEEFFEREQLL  93

>PHYRA_75881
Length=391

 Score = 39.7 bits (91),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGKACRRRFYTL  101
            F+ S D++LL  V+   PW A +      W  V   M+A  S  L    G AC+ R + L
Sbjct  219  FVASDDILLLTHVLAAKPWEAPYAMD--GWLHVVEQMRADASFRLEKTAG-ACQARLHLL  275

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDC  132
            +   K   L +LR +GT + +E +  LL + 
Sbjct  276  LSHLKAANLTALRKAGTEDEFERKCALLREV  306

>PPTG_11283
Length=260

 Score = 39.3 bits (90),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 39/80 (49%), Gaps = 1/80 (1%)

Query  42   FRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTL  101
            FRF    D+ +L+E+I+  P+AA    T   W  VA+ + ++L       K  R R   L
Sbjct  3    FRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALK-KEIKVKQIRDRLNLL  61

Query  102  MEVFKREELESLRASGTTEA  121
               FK +E  S  ASG  E+
Sbjct  62   KTRFKEKEQLSALASGVEES  81

>PPTG_04601
Length=260

 Score = 39.3 bits (90),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 39/80 (49%), Gaps = 1/80 (1%)

Query  42   FRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTL  101
            FRF    D+ +L+E+I+  P+AA    T   W  VA+ + ++L       K  R R   L
Sbjct  3    FRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALK-KEIKVKQIRDRLNLL  61

Query  102  MEVFKREELESLRASGTTEA  121
               FK +E  S  ASG  E+
Sbjct  62   KTRFKEKEQLSALASGVEES  81

>PYIW_15637
Length=272

 Score = 39.3 bits (90),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGKACRRRFYTLMEVFK  106
            D++LL +V    P+++       +W  V +      +  L   DGK  + RF+ LME  +
Sbjct  37   DIMLLCQVSADMPFSSRRGSAIDSWEEVVAKFSTLDAFALPQFDGKKAQNRFFALMEEHR  96

Query  107  REELESLRASGTTEAYEEREQLLTD  131
            +    S   SG +  Y E+ ++L D
Sbjct  97   KYNTASATKSGVSGFYNEKHEVLDD  121

>PHYSO_340790
Length=270

 Score = 39.3 bits (90),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLM  102
            RF  +SD  LL EV+   P+AA  +     W  VA+ + A+L    +  + CR R   L+
Sbjct  65   RFNATSDKALLAEVLATPPFAADRKTVTGVWKGVANRLNATLSEAFS-FRECRDRTSLLL  123

Query  103  EVFKREELESLRASGTTEAYEEREQLL  129
              +   +  +  ASGT E + E + +L
Sbjct  124  RKYAVRKARNEAASGTCELHTESDDIL  150

>H257_10707
Length=213

 Score = 38.9 bits (89),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 24/42 (57%), Gaps = 0/42 (0%)

Query  90   DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            DG+ C+ RF  L +  K     ++R SGT E + E EQLL D
Sbjct  158  DGQGCKTRFNKLAKANKERSFSAMRRSGTDEEFNECEQLLGD  199

>PYAR_20449
Length=231

 Score = 38.9 bits (89),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 42/88 (48%), Gaps = 5/88 (6%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVAS--GMKASLPLCTADGKACRRRFYTL  101
            F    DV+LL+     TPW A   +    W  +A   G     P    D +A R RF+ L
Sbjct  7    FSCGDDVLLLRAASAATPWQAA--RVMDAWDALAQRLGGYPCFPR-DKDARAVRTRFHLL  63

Query  102  MEVFKREELESLRASGTTEAYEEREQLL  129
            ++  +  +L S+R +G ++    RE+LL
Sbjct  64   LKKHRANKLASMRTTGDSDELLHRERLL  91

>PHYCA_129230
Length=141

 Score = 38.1 bits (87),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 0/43 (0%)

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            G A R RF  L+   +  ++ S R+SGTTE Y ER++LL D  
Sbjct  27   GPALRTRFDKLIRQHRDAQVVSRRSSGTTEEYNERDELLQDIV  69

>PPTG_06723
Length=149

 Score = 37.7 bits (86),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (56%), Gaps = 1/70 (1%)

Query  52   LLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREELE  111
            L++EVIK  P+AA + +T   W +VA+ + AS+ +   D K  + R   L + ++  EL 
Sbjct  5    LMREVIKQRPFAAKYGETGTVWVQVATCVSASIKVVEID-KQVQDRVRLLKKNWRAGELR  63

Query  112  SLRASGTTEA  121
            +   SG  EA
Sbjct  64   ATLGSGIEEA  73

>PYU1_G008728
Length=234

 Score = 38.5 bits (88),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 38/85 (45%), Gaps = 7/85 (8%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG------KACRRR  97
            F   +DVILL  V +H P  AGH      W  +A    + L L +AD       K  R R
Sbjct  16   FRTENDVILLDLVRRHAPHTAGHGNVAGAWQSIAREYNSRLGL-SADAETAVAWKVLRNR  74

Query  98   FYTLMEVFKREELESLRASGTTEAY  122
               L++ F +  + S+R  G  + Y
Sbjct  75   TGLLLDKFAKGAMHSVRKLGRADMY  99

>H257_17235
Length=186

 Score = 38.1 bits (87),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 39/85 (46%), Gaps = 2/85 (2%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKRE  108
            +V LL+EV +  P+AA H      W  V SG+    P     G   R     +++ FK+E
Sbjct  20   EVELLREVSRIEPFAADHGDLLQRWKLVESGLSDHEPKLNYRG--AREHVDAMLKEFKQE  77

Query  109  ELESLRASGTTEAYEEREQLLTDCF  133
            +      SGT E   E+ QLL D  
Sbjct  78   DKVQQLLSGTDEDVTEKVQLLQDLV  102

>SDRG_04653
Length=243

 Score = 38.5 bits (88),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 34/70 (49%), Gaps = 11/70 (16%)

Query  39   KKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGK-----A  93
            KK F+F    D+ LL+ V+KH P+ A H      W ++ +       LC   GK     A
Sbjct  13   KKRFKFNYEEDMELLRLVLKHEPYNAVHGSVAEKWEQIRTT------LCAYVGKQFSARA  66

Query  94   CRRRFYTLME  103
            C+ R+  LM+
Sbjct  67   CKDRYGILMQ  76

>PHYSO_259775
Length=213

 Score = 38.1 bits (87),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 75/171 (44%), Gaps = 16/171 (9%)

Query  60   TPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTT  119
             P+   + K    W  VA+ ++  +     DG+ CR R   L++ ++ ++  S + SG  
Sbjct  30   NPYGEDYGKKTPAWADVAADLEVDV-----DGRRCRERCNQLVDAYEAKQKASEKRSGPC  84

Query  120  EAYEEREQLLTDCFELadktekekrdaerreatSADIVRSAMQGMRNKRALSTDTELAtp  179
            E Y  +++ L +  EL +     K D ++ +         A   MR       D  L   
Sbjct  85   EEYTPKDECLVELLELREIEALLKNDKKQPKDQQQQEDEQA-SAMR-------DAALEGM  136

Query  180  pstkkkkrsstDALLGFLEDRASSRNNRHSLKERQLHIDERRLALEEQRLQ  230
                 K  S    L+ +LE R        +L+ R++  +E+RLALEE+RL+
Sbjct  137  SRGGGKGGSQQQQLVAYLERRDQV---AQALEGRKVANEEKRLALEERRLE  184

>PPTG_05843
Length=169

 Score = 37.7 bits (86),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (46%), Gaps = 10/90 (11%)

Query  55   EVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLR  114
            E+I+  P++A    T   W  VA G+ +++ +   + K  R R   L   FK +EL S R
Sbjct  3    ELIRLKPFSAKRGTTGHVWEEVAKGVSSAIQV-QLNVKQVRDRLNLLKAKFKADELSSAR  61

Query  115  ASGTTE---------AYEEREQLLTDCFEL  135
            ASG  E          Y +   L+ D  EL
Sbjct  62   ASGVEEDLHAVNIQSHYNDLNGLVRDYIEL  91

>H310_15161
Length=236

 Score = 38.1 bits (87),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (46%), Gaps = 9/92 (10%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-----TADGKACRRRFYTLME  103
            D+ LL +V    P+AA   + +  W     G+  +L  C       DGK  + RF  L E
Sbjct  19   DIALLIQVAADRPFAAEKGQLKKAW----QGLAETLVACEHFGRVVDGKKVQNRFLFLAE  74

Query  104  VFKREELESLRASGTTEAYEEREQLLTDCFEL  135
              ++ + +S + SG  E  +E+  LL D   +
Sbjct  75   EHRKFDAQSAKLSGVAEEEKEKHVLLDDILNV  106

>PPTG_08500
Length=285

 Score = 38.5 bits (88),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (49%), Gaps = 1/80 (1%)

Query  42   FRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTL  101
            FRF    D  L++E IK  P+ A + +  A W +VA  + A++ +   D K  + R   L
Sbjct  3    FRFSEDIDKELMREAIKQKPYTAKYGEAAAVWVQVAKCVSAAVKVSLVD-KQVQDRVRLL  61

Query  102  MEVFKREELESLRASGTTEA  121
             + +   EL +   SG  EA
Sbjct  62   KKNWSAGELRAALGSGIEEA  81

>PPTG_22223
Length=37

 Score = 35.0 bits (79),  Expect = 0.025, Method: Composition-based stats.
 Identities = 15/18 (83%), Positives = 18/18 (100%), Gaps = 0/18 (0%)

Query  37  KRKKAFRFLPSSDVILLK  54
           KRKKAFRF+PSSD++LLK
Sbjct  20  KRKKAFRFVPSSDIMLLK  37

>PHYSO_474101
Length=166

 Score = 37.7 bits (86),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 0/43 (0%)

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
            G A R R  TL+   KR++  S+R SGT E Y+ER++LL D  
Sbjct  23   GLALRTRSSTLVMNCKRDQCRSMRKSGTVEQYQERDRLLLDIL  65

>H257_08839
Length=158

 Score = 37.4 bits (85),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLT  130
            A + RF  L+   ++ E  SLR SGTTE Y ER+QLLT
Sbjct  7    ALKARFEYLLAKHEKGESASLRKSGTTEEYSERDQLLT  44

>PYAP_17700
Length=284

 Score = 38.1 bits (87),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 4/95 (4%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG---KAC  94
            R +  +F    DV+LL+ +  H P+ A H      W ++A+ +  +L L   +      C
Sbjct  53   RGRYAKFTAGMDVLLLEAMRTHNPFTAKHGTRLQMWQQIAATVGEAL-LKNPEAFSWHTC  111

Query  95   RRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
            R R  TLM++F   + + L   GT E    +E +L
Sbjct  112  RDRVTTLMKLFADGKHDKLFKHGTVEENTRKEAIL  146

>H257_14499
Length=170

 Score = 37.0 bits (84),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 46/103 (45%), Gaps = 8/103 (8%)

Query  32   GTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTAD-  90
             T TK+R     F    D++LL++V     + A   +    W  VASG+  +      D 
Sbjct  2    ATPTKRRN----FTEGEDIMLLRQVTLEMLFEARRDQVMERWAEVASGLNTADEFRRTDI  57

Query  91   --GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
               KAC   F  L++  ++   +S +ASG  E   E+  LL D
Sbjct  58   DAKKAC-NHFILLLDAHRKANNQSQQASGVAEDVGEKVVLLDD  99

>H310_04226
Length=236

 Score = 37.7 bits (86),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 36/90 (40%), Gaps = 2/90 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRRRFYTL  101
            F    DV+LL +V    P+ A   K    W  VA  +           DGK  + RF  L
Sbjct  10   FTEREDVLLLTQVSVEMPFLAHRGKIMDVWESVARNLATIGEFDRPNFDGKKAQARFLIL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTD  131
            +   +     S RASG  E   E+  LL D
Sbjct  70   LRDHRDSNNASQRASGAAEHVTEKTVLLDD  99

>H310_04474
Length=210

 Score = 37.4 bits (85),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 37/90 (41%), Gaps = 0/90 (0%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLME  103
            F    DV+LL +     P+ A   +    W  VA  +         DG+  + RF  L+ 
Sbjct  10   FSEREDVLLLTQFSAEMPFLARRGQIMDVWDSVARNLATLFDRPQFDGEKAQGRFLILLR  69

Query  104  VFKREELESLRASGTTEAYEEREQLLTDCF  133
              +  +  S RASG  E   E+  LL D +
Sbjct  70   DNRDNKNASRRASGAPENVTEKTILLDDLY  99

>PYIW_15058
Length=131

 Score = 36.6 bits (83),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 0/36 (0%)

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            RF  ++++F  ++L SLR SGT E Y+ERE LL + 
Sbjct  2    RFEKIVKLFVSQDLASLRKSGTQEEYQERELLLENI  37

>H310_10257
Length=309

 Score = 37.7 bits (86),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)

Query  112  SLRASGTTEAYEEREQLLTDCFEL  135
            SLRASGT E YEEREQLL D  ++
Sbjct  3    SLRASGTDEEYEEREQLLQDIHDM  26

 Score = 33.1 bits (74),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  87   CTADG---KACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
               DG    A R+RF  LM  F    + +LRASGT E YEEREQLL D  +L
Sbjct  141  IVGDGITVNATRKRFDDLMTAFHEITMAALRASGTEEEYEEREQLLQDIHDL  192

>H257_08837
Length=225

 Score = 37.0 bits (84),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 2/92 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTAD--GKACRRRFYTL  101
            F    D++LL++V    P+ A        W  +A  + A+      D   K    RF  L
Sbjct  10   FTEEEDIMLLRQVSADMPFLARRGLIMDNWTAIAETLAANEDFGRPDFDAKKANNRFIAL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDCF  133
             E  ++    S RASG +E   E+  LL D  
Sbjct  70   AEAHRKIHRVSARASGISEDVGEKVALLDDIL  101

>PYAR_16323
Length=803

 Score = 37.7 bits (86),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 42/81 (52%), Gaps = 10/81 (12%)

Query  40   KAFRFLPSSDVILL--KEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRR  97
            KAF+  P  DV+LL   E  +    A G R    +W   ++G KA  P+ +  GK+ RR+
Sbjct  654  KAFQDFPDKDVLLLALPEGCQRPVVATGFR----SW--TSTGKKAPAPVTSVAGKSSRRQ  707

Query  98   FYTLMEVFKREELESLRASGT  118
               ++  F R+EL  L  SG+
Sbjct  708  L--VLYAFHRDELPFLSFSGS  726

>SDRG_17266
Length=278

 Score = 37.4 bits (85),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-TADGKACRRRFYTLMEVFKR  107
            DV+LL+++    P+A  H +    W +VA+ + +        D K  + RF  L+E  K 
Sbjct  37   DVMLLRQISADRPFAQHHGRLRMAWAKVANTLMSCEEFTREVDAKKIQNRFSALLEAHKA  96

Query  108  EELESLRASGTTEAYEEREQLLTD  131
                S   SG  E   E+  LL D
Sbjct  97   FNKGSAAKSGVDEDETEKIMLLDD  120

>H257_01994
Length=222

 Score = 37.0 bits (84),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (51%), Gaps = 2/87 (2%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFK-R  107
            D+ LL+EV++  P+   +      W  +AS + +    CT   ++ R  F  ++E FK  
Sbjct  16   DLALLREVLRVEPYDGEYGTLTVRWKTIASKLSSCFE-CTIPYRSARDHFEVMLEGFKVT  74

Query  108  EELESLRASGTTEAYEEREQLLTDCFE  134
            ++ + +  +G+ E   E+ Q+L D  +
Sbjct  75   DKAQRMFGTGSEEEVTEQVQILQDIVD  101

>H310_14075
Length=217

 Score = 37.0 bits (84),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 2/90 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR--RRFYTL  101
            F    D++LL++V    P+ A   +    W  VAS +  S      D  A R   RF  L
Sbjct  10   FTEQEDIMLLRQVSLEMPFQARRGQVMERWADVASALLGSGEFTRDDIDAKRACNRFMLL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTD  131
            ++   R   ES  ASG ++   E+   L D
Sbjct  70   LDGHHRINKESQCASGVSDEVGEKTNFLDD  99

>SDRG_15499
Length=278

 Score = 37.0 bits (84),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-TADGKACRRRFYTLMEVFKR  107
            DV+LL+++    P+A  H +    W +VA+ + +        D K  + RF  L+E  K 
Sbjct  37   DVMLLRQISADRPFAQHHGRLRMAWAKVANTLMSCEEFTREVDAKKIQNRFSALLEAHKA  96

Query  108  EELESLRASGTTEAYEEREQLLTD  131
                S   SG  E   E+  LL D
Sbjct  97   FNKGSAAKSGVDEDETEKIMLLDD  120

>H257_18654
Length=162

 Score = 36.2 bits (82),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            A   RF  L+   +  E  SLR SGTTE Y E +QLLTD 
Sbjct  7    ALNTRFEYLLAKHETGESASLRKSGTTEEYSEHDQLLTDI  46

>H257_01792
Length=162

 Score = 36.2 bits (82),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            A   RF  L+   +  E  SLR SGTTE Y E +QLLTD 
Sbjct  7    ALNTRFEYLLAKHETGESASLRKSGTTEEYSEHDQLLTDI  46

>H310_11875
Length=172

 Score = 36.2 bits (82),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 0/46 (0%)

Query  90   DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            DGK  + RF  L+   K   LES RASG +E   E+ +LL D   L
Sbjct  17   DGKRAQNRFLLLVRQHKASNLESARASGVSEDETEKSKLLDDLVPL  62

>PPTG_16964
Length=104

 Score = 35.0 bits (79),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query  41   AFRFLPSSDVILLKEVIKHTPWAAGHR-KTEATWGRVASGMKASLPLCTADGKACRRRFY  99
             FRF    D+ +L E+I+  P+AA  R  T   W  V + + ++L     + K  R RF 
Sbjct  2    VFRFTTMEDLEMLWELIRQKPFAAKKRGSTLEMWDSVVAALGSALK-KEINVKQIRDRFN  60

Query  100  TLMEVFKREELESLRASGTTE  120
             L   FK +E  S  ASG  E
Sbjct  61   LLKARFKEKEQLSALASGVEE  81

>H310_15160
Length=200

 Score = 36.2 bits (82),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 42/100 (42%), Gaps = 4/100 (4%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGK  92
            T  +++AF      D++LL +V    P  A   +    W  VA  +           DGK
Sbjct  3    TPSKRRAFN--EREDILLLTQVSVERPHIARRGRIMDVWDSVARNLNTLDEFNRRHFDGK  60

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
              + RF  L+   K   + S R SG+ E  +ER  LL D 
Sbjct  61   RAQARFNLLLRDHKERNVASNRPSGSDEVVDERVVLLDDL  100

>PYU1_G010696
Length=297

 Score = 36.6 bits (83),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 24/94 (26%), Positives = 44/94 (47%), Gaps = 9/94 (10%)

Query  42   FRFLPSSDVILLKEVIK----HTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRR  97
            F F P +DV++L+E +       P    H+  +    RV + + AS+       ++   R
Sbjct  37   FYFTPGADVVVLREALVLELFAAPRGQKHKLIDEFGERVCAALNASI-----IARSAYER  91

Query  98   FYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            F  L+  F++ +    + SGT   Y E ++LL +
Sbjct  92   FLLLVRTFEKNDKVHKKNSGTYSQYLETQKLLNE  125

>PITG_05825
Length=410

 Score = 36.6 bits (83),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRRRFYTL  101
            F+ S D++LL  V+   PW   +      W +V   ++   S  L    G AC+ R   L
Sbjct  198  FVSSDDILLLTHVLAIKPWTFPY--VMDGWQQVTQNLRREESFRLDKTAG-ACQARLSLL  254

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDC  132
            +  FK +   +LR SGT + ++ +  LL + 
Sbjct  255  LSHFKADNTMALRKSGTDDEFDTKCALLAEV  285

>H310_03463
Length=52

 Score = 33.5 bits (75),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 35/92 (38%), Gaps = 41/92 (45%)

Query  33   TDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGK  92
             D+ KRK AFRF  +S+V +LKE                                     
Sbjct  2    NDSSKRKVAFRFKTASNVDVLKE-------------------------------------  24

Query  93   ACRRRFYTLMEVFKREELESLRASGTTEAYEE  124
                RF  L+  FK ++L SLRAS T E Y E
Sbjct  25   ----RFDDLIVAFKEDKLNSLRASSTEEEYNE  52

>PYIW_27159
Length=106

 Score = 34.7 bits (78),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 44/87 (51%), Gaps = 5/87 (6%)

Query  51   ILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREEL  110
            +LL++V   TP+++  R +    G++++    + P    DGK  + RF  LME +++   
Sbjct  1    MLLRQVSADTPFSS-RRDSGEVAGKLSTLDAFTRPQF--DGKKSQNRFLALMEKYRKYNA  57

Query  111  ESL--RASGTTEAYEEREQLLTDCFEL  135
             S     SG +E Y E+  +L D   +
Sbjct  58   ASATKSKSGASEFYSEKHGVLDDLLAI  84

>PYAP_20169
Length=233

 Score = 35.8 bits (81),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGM--KASLPLCTADGKACRRRFYTL  101
            F    DV+LL+E ++  PW++   +    W RVA  +    S P    DG++ R RF TL
Sbjct  38   FSYGDDVLLLREALRIEPWSSD--RVMDAWDRVAKTLSENPSFP-SGKDGRSMRSRFTTL  94

Query  102  M  102
            +
Sbjct  95   I  95

>H257_13212
Length=153

 Score = 35.0 bits (79),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 37/84 (44%), Gaps = 2/84 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKAS--LPLCTADGKACRRRFYTL  101
            +    DV+LL++V    P+ A        W  VA  + AS        D K    RF  L
Sbjct  10   YTDKEDVMLLRQVSLELPFLARRGIIMEKWTAVARALVASDEFTRTDLDAKKANNRFNLL  69

Query  102  MEVFKREELESLRASGTTEAYEER  125
            ++  ++   +S RASG +E   E+
Sbjct  70   IDSHRKHNKDSERASGVSEEVSEK  93

>PPTG_15787
Length=126

 Score = 34.7 bits (78),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 45/104 (43%), Gaps = 10/104 (10%)

Query  41   AFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYT  100
             FRF    D  LL+E+I   P+AA    T   W  +A+ + ++  +     + C  R   
Sbjct  2    VFRFTNDWDKELLRELIHLKPFAAVRGTTLRVWSDIAASLSSAFGVEVNVKQVC-DRLTL  60

Query  101  LMEVFKREELESLRASGTTEA---------YEEREQLLTDCFEL  135
            L ++ K  E  +   SG  E+         Y+ERE L+ +   L
Sbjct  61   LKQMLKDSEAAAALGSGIEESVDAVNVQSHYDEREGLVREFVAL  104

>PPTG_00270
Length=249

 Score = 35.4 bits (80),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 40/84 (48%), Gaps = 5/84 (6%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGKACRRRFYTL  101
            F+ S D++LL +V+   PW   +      W +V   ++A  S  L    G AC+ R   L
Sbjct  36   FVSSDDILLLTQVLVIKPWTFPY--VMDGWQQVTEKLRAEESFRLDKTAG-ACQARLNLL  92

Query  102  MEVFKREELESLRASGTTEAYEER  125
            +   K     +LR SGT E ++ +
Sbjct  93   LGHLKAGNTTALRKSGTEEEFDRK  116

>H257_05356
Length=224

 Score = 35.0 bits (79),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 2/92 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTAD--GKACRRRFYTL  101
            F    ++ LL++V    P+ A        W  +A  + A+    + D   K    RF  L
Sbjct  10   FTEEEEITLLRQVSADMPFLARRGLIMDKWVAIAETLAANEDFGSPDFDAKKANNRFIAL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDCF  133
             E  ++    S RASG +E   E   LL D  
Sbjct  70   AEAHRKSNRVSARASGISEDVGENVALLDDIL  101

>PPTG_07951
Length=285

 Score = 35.0 bits (79),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query  43   RFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLM  102
            RF  ++D  LL EV+   P+    +   A W  V+  +  SL     + ++CR R   L+
Sbjct  64   RFNATADKALLVEVLATPPFTVERKMVTAMWKGVSKRLNQSLS-TNFNFRSCRDRTGLLL  122

Query  103  EVFKREELESLRASGTTEAYEEREQLL  129
              +   +  +  ASGT+E Y + + +L
Sbjct  123  RQYAVRKGCNEAASGTSEVYTDNDDVL  149

>PYIW_24031
Length=281

 Score = 35.0 bits (79),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 39/94 (41%), Gaps = 4/94 (4%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEA---TWGRVASGMKASL-PLCTADGKACRRRFY  99
            F  S D  LL+ V    PW      +     ++G  A   +A+  P+      A R RF 
Sbjct  19   FSISDDFTLLRIVNLIKPWEPAFDTSNGVMKSFGVAAERCRAAPGPIQDKQAPALRTRFG  78

Query  100  TLMEVFKREELESLRASGTTEAYEEREQLLTDCF  133
             L+      +   +RASG TE YEE + L  D  
Sbjct  79   ELVRQHCDRQRSPMRASGATEGYEEHDALHQDII  112

>PHYSO_389268
Length=107

 Score = 33.5 bits (75),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (51%), Gaps = 1/61 (2%)

Query  61   PWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTE  120
            P+AA    T + W  VA G+ +++ +   + K  R R   L   FK +EL S RAS   E
Sbjct  2    PFAAKRGSTGSVWEEVAKGVSSAIKV-QLNAKQVRDRLNLLEAKFKADELCSSRASDVEE  60

Query  121  A  121
            A
Sbjct  61   A  61

>H257_12998
Length=141

 Score = 33.9 bits (76),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 40/96 (42%), Gaps = 2/96 (2%)

Query  39   KKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRR  96
            +K  +F    D++ L ++    P+ A   K    W  VA  +           DGK  + 
Sbjct  5    QKRRQFTERQDILFLTQIRVEMPFLARRGKIMDVWDSVARNLATVGGFDRPQFDGKKAQA  64

Query  97   RFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            RF  L+   + +   S+RAS  +E   E+  +L D 
Sbjct  65   RFAILLRDHREDNRASMRASCVSEDVTEKAIMLDDI  100

>H257_00165
Length=434

 Score = 35.0 bits (79),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 33/78 (42%), Gaps = 2/78 (3%)

Query  38   RKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASL--PLCTADGKACR  95
            R K  +F  + DV LL+ +  H P AA H    A W RVA    A +         + CR
Sbjct  15   RVKYIKFTSAMDVALLELIQVHNPIAAKHGTRLAMWERVARDFGAQIFDNRTACKWQICR  74

Query  96   RRFYTLMEVFKREELESL  113
             R   LM  F  E  + L
Sbjct  75   DRGNLLMRWFDEERFDKL  92

>H257_15302
Length=344

 Score = 35.0 bits (79),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 2/54 (4%)

Query  76   VASGMKASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
            VAS  + S P    D K  + RF  L+E  +  + ES+RASG  E Y E+ QLL
Sbjct  180  VASQEEFSRP--GFDAKRTQSRFTLLLEGHRVRDDESMRASGVAEDYSEKSQLL  231

>H310_11868
Length=117

 Score = 33.5 bits (75),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 34/88 (39%), Gaps = 2/88 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRRRFYTL  101
            F    DV+LL +V    P+ A   K    W  VA  +           DGK  + RF  L
Sbjct  10   FTEREDVLLLTQVSAEMPFLARRGKIMDVWDSVARNLATIGEFDRPQFDGKKAQARFLIL  69

Query  102  MEVFKREELESLRASGTTEAYEEREQLL  129
            +   +     S  ASG  E   E+  LL
Sbjct  70   LRDHRDNSNASRHASGAAENVTEKTILL  97

>H257_11942
Length=232

 Score = 34.7 bits (78),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 2/84 (2%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKAS--LPLCTADGKACRRRFYTL  101
            +    D++LL++V    P+ A        W  VA  + AS        D K    RF  L
Sbjct  10   YTDEEDLMLLRQVSLELPFLARRGLIMDKWTAVARALVASDEFTRTDLDAKKANNRFNAL  69

Query  102  MEVFKREELESLRASGTTEAYEER  125
            ++  ++   +S RASG +E   E+
Sbjct  70   IDSHRKHNKDSERASGVSEEVSEK  93

>PPTG_15281
Length=148

 Score = 33.9 bits (76),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 44/104 (42%), Gaps = 5/104 (5%)

Query  32   GTDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG  91
            G   K+R    RF    D  L++E     P+  G    E T  R       ++     DG
Sbjct  19   GLPAKRRNPMVRFTDELDFQLIEEAQARNPF--GEDYGEKTQARADVAAAVAV---VVDG  73

Query  92   KACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
              CR R   L++ ++ ++  S R SG  E Y  +++ L +  E+
Sbjct  74   CLCRERCNHLLDAYQAKKKASERRSGPCEDYTPKDECLAEVLEM  117

>H310_14301
Length=247

 Score = 34.3 bits (77),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 43/94 (46%), Gaps = 3/94 (3%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGKACRRRFYTL  101
            +L   DV+LL ++    P+       +A W  +A+ +++  S    T DG+  + RF  L
Sbjct  26   WLEDDDVMLLTQINNDRPFMQRKDAMKA-WEALAATLRSHPSFSRRTLDGRKAQNRFLLL  84

Query  102  MEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            +   K     S R SG +E    + +LL D   L
Sbjct  85   IRQHKSSSNASARLSGVSEDESAKTRLLDDIMPL  118

>H257_12323
Length=178

 Score = 33.9 bits (76),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 20/78 (26%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-TADGKACRRRFYTLM  102
            + P  DV+LL +V    P+AA   +   +W  +A  + A        DG+  + RF  L+
Sbjct  10   WTPEEDVVLLIQVAADLPFAADKCQVTKSWQSLADKLVACEHFDRVVDGRKVQNRFTALV  69

Query  103  EVFKREELESLRASGTTE  120
            +  ++ +  S + SG  +
Sbjct  70   DEHRKFDTASAKLSGVDQ  87

>CCI48126
Length=364

 Score = 34.3 bits (77),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 11/87 (13%)

Query  36   KKRKKAFRFLPSSDVILLKEVI------KHTPWAAGHRKTEATWGRVASGMKASLPLCTA  89
            K+RK  F F    D+ILLKEVI      + +P  A H KT+ TW  +A  +         
Sbjct  9    KERKTRFCFAEIHDIILLKEVIGENGLFQQSP--AFHTKTQ-TWQLIAENINKY--GVHV  63

Query  90   DGKACRRRFYTLMEVFKREELESLRAS  116
            D    + R + L+++ ++EE + ++ S
Sbjct  64   DSHRAKLRLHRLVQLHEQEENDQIKRS  90

 Score = 32.7 bits (73),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 41/86 (48%), Gaps = 7/86 (8%)

Query  35   TKKRKKAFRFLPSSDVILLKEVIKHTPW---AAGHRKTEATWGRVASGMKASLPLCTADG  91
            +K RK+ F F    D+I+L+EV++H+        HR  +  W  +A  +          G
Sbjct  155  SKARKQRFCFSEEHDLIILREVLQHSELFQPNGVHR--QQIWQNIAENVIKQ--GVNVSG  210

Query  92   KACRRRFYTLMEVFKREELESLRASG  117
               R R   L+E++++E  ++L   G
Sbjct  211  YRVRLRLQRLVELYEQEINQTLSIDG  236

>PPTG_11144
Length=251

 Score = 34.3 bits (77),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 36/82 (44%), Gaps = 1/82 (1%)

Query  42   FRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTL  101
            FRF    D  L+KE I   P+AA + +    W  VA  + +++     + K  R R   L
Sbjct  3    FRFTDDYDKELMKEAIAQKPFAAKYGEAARVWASVAEHVSSTIKERVLE-KQVRDRVGLL  61

Query  102  MEVFKREELESLRASGTTEAYE  123
             + +   EL S   SG  E  E
Sbjct  62   KKNWHAGELRSSLGSGIEETLE  83

>H257_19488
Length=56

 Score = 31.6 bits (70),  Expect = 0.64, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  37  KRKKAFRFLPSSDVILLKEVIKHTPWAAGH  66
           KRK AFRF   + V LLKEVI   P+ A H
Sbjct  9   KRKTAFRFQGCTVVELLKEVIHVRPFEAPH  38

>H310_04868
Length=238

 Score = 33.9 bits (76),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 4/86 (5%)

Query  49   DVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTADGKACRRRFYTLMEVFK  106
            D+ILL +V    P+    R+    W  +A  ++          DGK  + RF  LM   K
Sbjct  22   DIILLTQVNNDRPFTK--RQATKAWEALAVALRDIEDFTRPGIDGKKAQNRFLLLMRQHK  79

Query  107  REELESLRASGTTEAYEEREQLLTDC  132
                ++ R SG +E+  E+ +LL D 
Sbjct  80   ARNDKAERLSGVSESETEKSRLLDDL  105

>H257_13222
Length=189

 Score = 33.5 bits (75),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLC-TADGKACRRRFYTLM  102
            + P  DV+LL +V  + P+AA   +   +W  +A  + A        DG+  + RF  L+
Sbjct  10   WTPEEDVVLLIQVAANLPFAADKGQVTKSWQSLADKLVACDHFDRVVDGRKVQNRFTALV  69

Query  103  EVFKREELESLRASGTTE  120
            +   + ++   + SG  +
Sbjct  70   DEHSKFDMAFAKLSGVDQ  87

>PPTG_00266
Length=437

 Score = 34.3 bits (77),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 40/84 (48%), Gaps = 5/84 (6%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKA--SLPLCTADGKACRRRFYTL  101
            F+ S D++LL +V+   PW   +      W +V   ++A  S  L    G AC+ R   L
Sbjct  224  FVSSDDILLLTQVLVIKPWTFPY--VMDGWQQVTEKLRAEESFRLDKTAG-ACQARLNLL  280

Query  102  MEVFKREELESLRASGTTEAYEER  125
            +   K     +LR SGT E ++ +
Sbjct  281  LGHLKAGNTTALRKSGTEEEFDRK  304

>H310_06262
Length=226

 Score = 33.5 bits (75),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 40/101 (40%), Gaps = 5/101 (5%)

Query  33   TDTKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMK--ASLPLCTAD  90
            T  KKR+    F    DV+LL +V     + A   K    W  VA  +           D
Sbjct  3    TPVKKRRV---FTEREDVLLLTQVSVEMLFLARRGKIMDVWDSVARNLATIGEFDRPQFD  59

Query  91   GKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTD  131
            GK  + RF  L+   +     S RASG  E   E+  LL D
Sbjct  60   GKKAQARFIILLRDHRDNNNASRRASGAAENVTEKTILLDD  100

>H257_14546
Length=187

 Score = 33.1 bits (74),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 27/59 (46%), Gaps = 2/59 (3%)

Query  73   WGRVASGMKASLPLCTA--DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLL  129
            W  VA  +  +        DGK    RF  LME  +     S RASG  E ++E+ QLL
Sbjct  4    WNAVADAVSTNHDFARPGFDGKRALNRFTLLMEGHRANNDVSARASGIEEDHDEKTQLL  62

>SDRG_08699
Length=168

 Score = 33.1 bits (74),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 22/35 (63%), Gaps = 0/35 (0%)

Query  39  KKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATW  73
           +KAFRF  +SDV LLKEV+  +P+   + +    W
Sbjct  23  RKAFRFTVASDVDLLKEVMFVSPYDCQYGQIAKRW  57

>H310_04308
Length=145

 Score = 32.7 bits (73),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 23/43 (53%), Gaps = 0/43 (0%)

Query  90   DGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDC  132
            DGK  + RF  L+   K   + S RASG+ E  +ER  LL D 
Sbjct  23   DGKKAQARFNLLLRDHKERNVASHRASGSDEVVDERVVLLDDL  65

>PHYSO_389597
Length=188

 Score = 33.1 bits (74),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 44/98 (45%), Gaps = 6/98 (6%)

Query  44   FLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTA------DGKACRRR  97
            F    D+ LL++ + + P+     KT A W  +A+ + +      +       GK  + R
Sbjct  6    FSAEEDLALLRQALSNRPFLKERGKTMAAWDALAAQLVSDANFSRSASRGKLSGKTAQAR  65

Query  98   FYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFEL  135
            F  L+   +++   +L ASG  E   E++ LL +   L
Sbjct  66   FDKLVTQKRQQNAAALAASGVDEEETEKDVLLDELIAL  103

Lambda      K        H        a         alpha
   0.317    0.129    0.360    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 14024301048

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40