Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_1294851475425125112516e-176
PPTG_171251475428323011332e-157
PHYRA_811021475425125110511e-145
PHYRA_725046951625125110511e-145
PITG_184531475425223010486e-145
PHYRA_7182580282542548125e-109
PHYRA_81103712622522347526e-100
PPTG_0889380282512307222e-95
PITG_0971680282502307204e-95
PPTG_16851236932492307179e-95
PHYSO_26126580282472537117e-94
PHYKE_6286599492502317092e-93
PHYCA_12149480282482307074e-93
PHYCA_10034368662742307034e-92
PHYSO_254108170262462306795e-89
PHYCA_118548170262462546735e-88
PPTG_07664170262452306701e-87
PITG_22053170262452306665e-87
PPTG_17049237772552346651e-86
PITG_04208205112452306631e-86
PITG_19936157132492316511e-84
PHYRA_74356698952442306465e-84
PHYCA_9298368522482316432e-83
PITG_19938353892452286413e-83
PHYSO_526832353892492336372e-82
PHYRA_74306205112452306344e-82
PHYCA_118674205112812346375e-82
PHYRA_52440170262432516274e-81
PHYCA_132252157132492316275e-81
PHYSO_526623599492492316251e-80
PPTG_0767136902462306222e-80
PITG_0424836902452306214e-80
PHYSO_526774157132492366172e-79
PHYCA_11855136902452306143e-79
PHYRA_74343698872492316067e-78
PPTG_19331246513682306115e-77
PITG_0426737012792316036e-77
PHYRA_72386459152452306006e-77
PHYRA_72344817002452306006e-77
PHYRA_74307422182492316006e-77
PHYSO_52607137012492316007e-77
PITG_0420036612472315981e-76
PHYRA_76249246513262346033e-76
PHYSO_249692459152482305928e-76
PHYCA_129784817002462305911e-75
PHYRA_74310599492492315911e-75
PHYCA_107869246513422345973e-75
PHYSO_507736135312362495865e-75
PHYKE_2376459153222345936e-75
PHYCA_123779173642772345881e-74
PHYCA_122048693172362305831e-74
PPTG_15230817002522305832e-74
PHYRA_71477693172382305805e-74
PHYRA_4287689222132325732e-73
PHYSO_329843510942392305752e-73
PHYCA_108039563202152325723e-73
PHYRA_71404563202452305744e-73
PHYKE_4438758943392345825e-73
PPTG_15224963762462305745e-73
PPTG_17409743732352305726e-73
PHYRA_72433694822452305736e-73
PHYCA_11951135312342275683e-72
PPTG_15233231122352285674e-72
PHYRA_72438135312362495665e-72
PHYSO_259736247322312305631e-71
PPTG_08017207076162345921e-71
PHYRA_71308231122362495631e-71
PPTG_17245238632572375633e-71
PYVX_22467135312362495604e-71
PPTG_06973368661651665528e-71
PHYCA_9358368552522405591e-70
PPTG_18464243182472315591e-70
PHYRA_72345517562402515553e-70
PHYSO_406265173642322345543e-70
PHYKE_5753763302382295528e-70
PPTG_19330563203162345581e-69
PHYKE_7564459204732305701e-69
PHALS_06162173644882325692e-69
PHYSO_527352600202452545492e-69
PHYRA_71931510942392285483e-69
PHYSO_414520550602132325453e-69
PHYRA_5242336901932015426e-69
PYU1_G011231459142382325467e-69
PYU1_G011237817002352325457e-69
PPTG_0766037012162195402e-68
PHYSO_468315563202552305433e-68
PITG_22668173645192345624e-68
PHYSO_25411236902242285378e-68
PPTG_08005173647592345731e-67
PHYCA_18373353892462115381e-67
PHYSO_249751459202382505362e-67
PHYKE_494670892632305382e-67
PHYSO_51088870892552305363e-67
PHYRA_74617699543372305425e-67
PHYSO_334487517562582515347e-67
PHYSO_397673703072242305318e-67
PPTG_12847511263312305408e-67
PHYRA_71618578972432355321e-66
PHYCA_10840970892822305351e-66
PPTG_1285370893422305401e-66
PHYCA_11835636612522315321e-66
PPTG_12852223223312345391e-66
PHYRA_71588693332422335311e-66
PYU1_G011233694602392285302e-66
PPTG_07089202542552305312e-66
PPTG_13736226162362515292e-66
PPTG_13769592663492345383e-66
PHYCA_69480391942132285254e-66
PYIR_13251817002362535265e-66
PHYCA_119748423082612345278e-66
PYU1_G011235963762382325241e-65
PPTG_07661600202232255213e-65
HYAP_0924370892662295243e-65
PYIR_13252817012362535213e-65
PHYRA_74630202543432305287e-65
PHYRA_72475695022432355181e-64
PITG_22916720282482305181e-64
PPTG_19506247322232255161e-64
PITG_0852270893822305282e-64
PHYSO_334498517572292175152e-64
PHYCA_69477391922132285132e-64
PHYRA_72165599392402345153e-64
PYU1_G011230817012382325128e-64
PHYKE_5655578972432355129e-64
PHYRA_46230550602122275091e-63
PPTG_07277203402982345161e-63
PITG_22734422181681535032e-63
PHYRA_5432770892192285072e-63
PHYKE_7566459142602285112e-63
PYIW_25259817002462415084e-63
PHYRA_49009690712162335055e-63
PHYKE_4541759501471474979e-63
PPTG_2217436987712315372e-62
PPTG_15231135312582285052e-62
PHYSO_329114510052362184997e-62
PYU1_G011236135312372284981e-61
PHYCA_69479391932132284933e-61
PHYRA_83592763302372304927e-61
HYAP_08306563202862324969e-61
PHYRA_52960691982232284901e-60
PHYRA_52955691972232284901e-60
PYIR_13275135312372324911e-60
PHALS_0608470892602304904e-60
PHYSO_330015511262412324866e-60
PHYRA_72390592662372304851e-59
PHYRA_72477695042382324832e-59
PHYCA_683589222102154812e-59
PHYCA_132529435382322354823e-59
HYAP_06628642572452314823e-59
PITG_16866135312382294814e-59
PHYCA_12462369161771614746e-59
PHYCA_123797207012412334806e-59
PHYRA_86968733682392334797e-59
PHYRA_45457517571991964767e-59
PHYSO_496064578972542464809e-59
PHYRA_43347688002202054761e-58
PHYRA_84273720242372324781e-58
PHYKE_7568608783722494882e-58
PHYRA_41766511262092274733e-58
PHYSO_490000575402412324753e-58
PHYCA_123205425681771614693e-58
PHYCA_69457511262132324724e-58
PHYSO_254099368522352334745e-58
PPTG_07991207012762334766e-58
PHYSO_526541599392392324736e-58
PHYSO_336498177692382324711e-57
PPTG_17295238912382534711e-57
PHYRA_44405688542322304692e-57
PPTG_04799194622452394693e-57
PHYSO_255972205112152304663e-57
PHYSO_52785036611951764636e-57
PHYRA_72385694602372494667e-57
PHYRA_39489686262372314668e-57
PPTG_17453177692542684661e-56
PPTG_004608462592274661e-56
PPTG_11469451342532474633e-56
HYAP_07436646842672284635e-56
HYAP_07925649412672284627e-56
PHYRA_71310459142372494581e-55
PHYRA_71307608782372494572e-55
PHYRA_84277720282402334562e-55
PITG_23228177692542474564e-55
PHALS_13513157132402364544e-55
PYVX_22469517584742514707e-55
PPTG_15234608782352284527e-55
PHALS_14425357673022304552e-54
PHYKE_208743731871814452e-54
PHYRA_75425176762372284484e-54
PHYRA_52426600201521604395e-54
PHYSO_365942537682332234466e-54
PHYCA_553546452582802714507e-54
PHYSO_423056554102332224467e-54
HYAP_14846685472212364449e-54
PPTG_14652229162572334479e-54
PHYSO_254223422182272344441e-53
PHYSO_560790608782372514442e-53
PHYCA_129892608782342284432e-53
PHYSO_504553689972572484443e-53
PITG_009578462982294455e-53
PHYRA_76657703212392334406e-53
PHYCA_544885451342562714417e-53
PPTG_08703209012542474418e-53
PHYCA_576423176762342284381e-52
PITG_23211177602452294381e-52
PHYRA_72531695292362334362e-52
PHYCA_124462426702802754393e-52
PITG_23051176512802434384e-52
PHYRA_72430461762382314345e-52
PHYRA_72306694282382314345e-52
PHYSO_334500517582352494345e-52
PITG_22981175962592284356e-52
PHYSO_482931571392542474356e-52
PPTG_18463452582542704356e-52
PHYCA_109174413332772734368e-52
PHYRA_47241690031761604261e-51
PHYSO_365377537622202274301e-51
PPTG_00471720282392274311e-51
PHYRA_5242737011241324202e-51
PHYRA_52260691692342504292e-51
PPTG_13026694282382314283e-51
PHYSO_480321570042542474279e-51
PHALS_12600147542672344271e-50
PITG_23076176682762704281e-50
PPTG_16647236412542474261e-50
PHYCA_69122177692492464251e-50
PHYCA_109192413382782794272e-50
PHYRA_72403694692392334232e-50
PHYSO_516261592662272304213e-50
PHYCA_114913419272242274204e-50
PHYSO_253029461762522324224e-50
PHYKE_8391147537781444494e-50
PPTG_03796191822552694224e-50
PHYCA_109089173962772744245e-50
PHYSO_521124595742542444225e-50
PHALS_1442380283792354315e-50
PITG_23094176762372324206e-50
PHYCA_124383426672802704236e-50
PHYCA_109163413312472414216e-50
PPTG_15220176762362364197e-50
PHYCA_109162413302572514218e-50
PHYRA_83851719182392354191e-49
PHYCA_10570176672782744211e-49
PHYRA_76603703072392334154e-49
PHYCA_109095413122772704176e-49
PHALS_13512353892432284121e-48
PITG_22709173962812664132e-48
PHYRA_72541695342392334102e-48
PPTG_10591215032542474112e-48
PPTG_13004176512552494103e-48
PHYRA_52296691712372324075e-48
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_129485

Length=251
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_129485                                                          486        6e-176
PPTG_17125                                                            441        2e-157
PHYRA_81102                                                           409        1e-145
PHYRA_72504                                                           409        1e-145
PITG_18453                                                            408        6e-145
PHYRA_71825                                                           317        5e-109
PHYRA_81103                                                           294        6e-100
PPTG_08893                                                            282        2e-95 
PITG_09716                                                            281        4e-95 
PPTG_16851                                                            280        9e-95 
PHYSO_261265                                                          278        7e-94 
PHYKE_6286                                                            277        2e-93 
PHYCA_121494                                                          276        4e-93 
PHYCA_10034                                                           275        4e-92 
PHYSO_254108                                                          266        5e-89 
PHYCA_118548                                                          263        5e-88 
PPTG_07664                                                            262        1e-87 
PITG_22053                                                            261        5e-87 
PPTG_17049                                                            260        1e-86 
PITG_04208                                                            259        1e-86 
PITG_19936                                                            255        1e-84 
PHYRA_74356                                                           253        5e-84 
PHYCA_9298                                                            252        2e-83 
PITG_19938                                                            251        3e-83 
PHYSO_526832                                                          249        2e-82 
PHYRA_74306                                                           248        4e-82 
PHYCA_118674                                                          249        5e-82 
PHYRA_52440                                                           246        4e-81 
PHYCA_132252                                                          246        5e-81 
PHYSO_526623                                                          245        1e-80 
PPTG_07671                                                            244        2e-80 
PITG_04248                                                            243        4e-80 
PHYSO_526774                                                          242        2e-79 
PHYCA_118551                                                          241        3e-79 
PHYRA_74343                                                           238        7e-78 
PPTG_19331                                                            239        5e-77 
PITG_04267                                                            236        6e-77 
PHYRA_72386                                                           235        6e-77 
PHYRA_72344                                                           235        6e-77 
PHYRA_74307                                                           235        6e-77 
PHYSO_526071                                                          235        7e-77 
PITG_04200                                                            234        1e-76 
PHYRA_76249                                                           236        3e-76 
PHYSO_249692                                                          232        8e-76 
PHYCA_129784                                                          232        1e-75 
PHYRA_74310                                                           232        1e-75 
PHYCA_107869                                                          234        3e-75 
PHYSO_507736                                                          230        5e-75 
PHYKE_2376                                                            233        6e-75 
PHYCA_123779                                                          231        1e-74 
PHYCA_122048                                                          229        1e-74 
PPTG_15230                                                            229        2e-74 
PHYRA_71477                                                           228        5e-74 
PHYRA_42876                                                           225        2e-73 
PHYSO_329843                                                          226        2e-73 
PHYCA_108039                                                          224        3e-73 
PHYRA_71404                                                           225        4e-73 
PHYKE_4438                                                            228        5e-73 
PPTG_15224                                                            225        5e-73 
PPTG_17409                                                            224        6e-73 
PHYRA_72433                                                           225        6e-73 
PHYCA_11951                                                           223        3e-72 
PPTG_15233                                                            223        4e-72 
PHYRA_72438                                                           222        5e-72 
PHYSO_259736                                                          221        1e-71 
PPTG_08017                                                            232        1e-71 
PHYRA_71308                                                           221        1e-71 
PPTG_17245                                                            221        3e-71 
PYVX_22467                                                            220        4e-71 
PPTG_06973                                                            217        8e-71 
PHYCA_9358                                                            219        1e-70 
PPTG_18464                                                            219        1e-70 
PHYRA_72345                                                           218        3e-70 
PHYSO_406265                                                          218        3e-70 
PHYKE_5753                                                            217        8e-70 
PPTG_19330                                                            219        1e-69 
PHYKE_7564                                                            224        1e-69 
PHALS_06162                                                           223        2e-69 
PHYSO_527352                                                          216        2e-69 
PHYRA_71931                                                           215        3e-69 
PHYSO_414520                                                          214        3e-69 
PHYRA_52423                                                           213        6e-69 
PYU1_G011231                                                          214        7e-69 
PYU1_G011237                                                          214        7e-69 
PPTG_07660                                                            212        2e-68 
PHYSO_468315                                                          213        3e-68 
PITG_22668                                                            221        4e-68 
PHYSO_254112                                                          211        8e-68 
PPTG_08005                                                            225        1e-67 
PHYCA_18373                                                           211        1e-67 
PHYSO_249751                                                          211        2e-67 
PHYKE_4946                                                            211        2e-67 
PHYSO_510888                                                          211        3e-67 
PHYRA_74617                                                           213        5e-67 
PHYSO_334487                                                          210        7e-67 
PHYSO_397673                                                          209        8e-67 
PPTG_12847                                                            212        8e-67 
PHYRA_71618                                                           209        1e-66 
PHYCA_108409                                                          210        1e-66 
PPTG_12853                                                            212        1e-66 
PHYCA_118356                                                          209        1e-66 
PPTG_12852                                                            212        1e-66 
PHYRA_71588                                                           209        1e-66 
PYU1_G011233                                                          208        2e-66 
PPTG_07089                                                            209        2e-66 
PPTG_13736                                                            208        2e-66 
PPTG_13769                                                            211        3e-66 
PHYCA_69480                                                           206        4e-66 
PYIR_13251                                                            207        5e-66 
PHYCA_119748                                                          207        8e-66 
PYU1_G011235                                                          206        1e-65 
PPTG_07661                                                            205        3e-65 
HYAP_09243                                                            206        3e-65 
PYIR_13252                                                            205        3e-65 
PHYRA_74630                                                           207        7e-65 
PHYRA_72475                                                           204        1e-64 
PITG_22916                                                            204        1e-64 
PPTG_19506                                                            203        1e-64 
PITG_08522                                                            207        2e-64 
PHYSO_334498                                                          202        2e-64 
PHYCA_69477                                                           202        2e-64 
PHYRA_72165                                                           202        3e-64 
PYU1_G011230                                                          201        8e-64 
PHYKE_5655                                                            201        9e-64 
PHYRA_46230                                                           200        1e-63 
PPTG_07277                                                            203        1e-63 
PITG_22734                                                            198        2e-63 
PHYRA_54327                                                           199        2e-63 
PHYKE_7566                                                            201        2e-63 
PYIW_25259                                                            200        4e-63 
PHYRA_49009                                                           199        5e-63 
PHYKE_4541                                                            196        9e-63 
PPTG_22174                                                            211        2e-62 
PPTG_15231                                                            199        2e-62 
PHYSO_329114                                                          196        7e-62 
PYU1_G011236                                                          196        1e-61 
PHYCA_69479                                                           194        3e-61 
PHYRA_83592                                                           194        7e-61 
HYAP_08306                                                            195        9e-61 
PHYRA_52960                                                           193        1e-60 
PHYRA_52955                                                           193        1e-60 
PYIR_13275                                                            193        1e-60 
PHALS_06084                                                           193        4e-60 
PHYSO_330015                                                          191        6e-60 
PHYRA_72390                                                           191        1e-59 
PHYRA_72477                                                           190        2e-59 
PHYCA_6835                                                            189        2e-59 
PHYCA_132529                                                          190        3e-59 
HYAP_06628                                                            190        3e-59 
PITG_16866                                                            189        4e-59 
PHYCA_12462                                                           187        6e-59 
PHYCA_123797                                                          189        6e-59 
PHYRA_86968                                                           189        7e-59 
PHYRA_45457                                                           187        7e-59 
PHYSO_496064                                                          189        9e-59 
PHYRA_43347                                                           187        1e-58 
PHYRA_84273                                                           188        1e-58 
PHYKE_7568                                                            192        2e-58 
PHYRA_41766                                                           186        3e-58 
PHYSO_490000                                                          187        3e-58 
PHYCA_123205                                                          185        3e-58 
PHYCA_69457                                                           186        4e-58 
PHYSO_254099                                                          187        5e-58 
PPTG_07991                                                            187        6e-58 
PHYSO_526541                                                          186        6e-58 
PHYSO_336498                                                          186        1e-57 
PPTG_17295                                                            186        1e-57 
PHYRA_44405                                                           185        2e-57 
PPTG_04799                                                            185        3e-57 
PHYSO_255972                                                          184        3e-57 
PHYSO_527850                                                          182        6e-57 
PHYRA_72385                                                           184        7e-57 
PHYRA_39489                                                           184        8e-57 
PPTG_17453                                                            184        1e-56 
PPTG_00460                                                            184        1e-56 
PPTG_11469                                                            182        3e-56 
HYAP_07436                                                            182        5e-56 
HYAP_07925                                                            182        7e-56 
PHYRA_71310                                                           181        1e-55 
PHYRA_71307                                                           180        2e-55 
PHYRA_84277                                                           180        2e-55 
PITG_23228                                                            180        4e-55 
PHALS_13513                                                           179        4e-55 
PYVX_22469                                                            185        7e-55 
PPTG_15234                                                            178        7e-55 
PHALS_14425                                                           179        2e-54 
PHYKE_208                                                             176        2e-54 
PHYRA_75425                                                           177        4e-54 
PHYRA_52426                                                           173        5e-54 
PHYSO_365942                                                          176        6e-54 
PHYCA_553546                                                          177        7e-54 
PHYSO_423056                                                          176        7e-54 
HYAP_14846                                                            175        9e-54 
PPTG_14652                                                            176        9e-54 
PHYSO_254223                                                          175        1e-53 
PHYSO_560790                                                          175        2e-53 
PHYCA_129892                                                          175        2e-53 
PHYSO_504553                                                          175        3e-53 
PITG_00957                                                            176        5e-53 
PHYRA_76657                                                           174        6e-53 
PHYCA_544885                                                          174        7e-53 
PPTG_08703                                                            174        8e-53 
PHYCA_576423                                                          173        1e-52 
PITG_23211                                                            173        1e-52 
PHYRA_72531                                                           172        2e-52 
PHYCA_124462                                                          173        3e-52 
PITG_23051                                                            173        4e-52 
PHYRA_72430                                                           171        5e-52 
PHYRA_72306                                                           171        5e-52 
PHYSO_334500                                                          171        5e-52 
PITG_22981                                                            172        6e-52 
PHYSO_482931                                                          172        6e-52 
PPTG_18463                                                            172        6e-52 
PHYCA_109174                                                          172        8e-52 
PHYRA_47241                                                           168        1e-51 
PHYSO_365377                                                          170        1e-51 
PPTG_00471                                                            170        1e-51 
PHYRA_52427                                                           166        2e-51 
PHYRA_52260                                                           169        2e-51 
PPTG_13026                                                            169        3e-51 
PHYSO_480321                                                          169        9e-51 
PHALS_12600                                                           169        1e-50 
PITG_23076                                                            169        1e-50 
PPTG_16647                                                            168        1e-50 
PHYCA_69122                                                           168        1e-50 
PHYCA_109192                                                          169        2e-50 
PHYRA_72403                                                           167        2e-50 
PHYSO_516261                                                          166        3e-50 
PHYCA_114913                                                          166        4e-50 
PHYSO_253029                                                          167        4e-50 
PHYKE_8391                                                            177        4e-50 
PPTG_03796                                                            167        4e-50 
PHYCA_109089                                                          167        5e-50 
PHYSO_521124                                                          167        5e-50 
PHALS_14423                                                           170        5e-50 
PITG_23094                                                            166        6e-50 
PHYCA_124383                                                          167        6e-50 
PHYCA_109163                                                          166        6e-50 
PPTG_15220                                                            166        7e-50 
PHYCA_109162                                                          166        8e-50 
PHYRA_83851                                                           166        1e-49 
PHYCA_10570                                                           166        1e-49 
PHYRA_76603                                                           164        4e-49 
PHYCA_109095                                                          165        6e-49 
PHALS_13512                                                           163        1e-48 
PITG_22709                                                            163        2e-48 
PHYRA_72541                                                           162        2e-48 
PPTG_10591                                                            162        2e-48 
PPTG_13004                                                            162        3e-48 
PHYRA_52296                                                           161        5e-48 
PHYSO_328418                                                          160        5e-48 
PHYSO_514298                                                          162        6e-48 
PHYRA_47103                                                           160        6e-48 
PPTG_11475                                                            161        8e-48 
PHYSO_249691                                                          160        1e-47 
PPTG_15262                                                            160        1e-47 
PPTG_00542                                                            160        2e-47 
HYAP_04977                                                            160        2e-47 
HYAP_05559                                                            160        2e-47 
PHYSO_246397                                                          160        2e-47 
PHYCA_108964                                                          160        3e-47 
PHYRA_72357                                                           159        3e-47 
PPTG_06202                                                            159        6e-47 
PHYKE_5284                                                            158        6e-47 
HYAP_05558                                                            159        8e-47 
PHALS_03592                                                           159        8e-47 
PHYCA_123587                                                          159        1e-46 
PHYCA_544875                                                          158        1e-46 
PPTG_05581                                                            159        1e-46 
PPTG_15218                                                            157        2e-46 
PPTG_04504                                                            157        3e-46 
PHYCA_133546                                                          156        1e-45 
PPTG_15219                                                            154        1e-45 
PHYSO_480350                                                          155        2e-45 
PHALS_08447                                                           154        2e-45 
PYAP_24304                                                            152        8e-45 
PHYSO_449487                                                          149        1e-44 
PHYCA_132177                                                          152        2e-44 
HYAP_14784                                                            153        2e-44 
PHALS_02474                                                           151        3e-44 
PITG_23075                                                            152        5e-44 
PHYSO_251206                                                          150        7e-44 
PHYRA_45462                                                           148        8e-44 
PHYCA_10715                                                           149        1e-43 
PPTG_05868                                                            150        1e-43 
PHALS_08947                                                           149        3e-43 
PHALS_08945                                                           148        6e-43 
PHYKE_7565                                                            145        2e-42 
PHALS_05391                                                           147        2e-42 
PHYCA_118700                                                          144        7e-42 
PHYCA_133455                                                          143        7e-42 
PHALS_08480                                                           145        1e-41 
PHALS_08445                                                           144        3e-41 
PPTG_07667                                                            140        5e-41 
PYAP_24757                                                            140        6e-40 
PHYSO_481543                                                          140        8e-40 
PHYCA_59113                                                           137        9e-40 
PPTG_07668                                                            136        1e-39 
PHYSO_263794                                                          139        1e-39 
PITG_23055                                                            138        2e-39 
PPTG_15860                                                            137        2e-39 
PITG_23062                                                            140        2e-39 
HYAP_08846                                                            137        3e-38 
PHALS_01213                                                           135        6e-38 
PYAP_24339                                                            134        7e-38 
PPTG_11648                                                            136        1e-37 
PHYCA_109151                                                          130        7e-37 
PHYCA_5621                                                            130        2e-36 
PHYSO_246660                                                          129        1e-35 
HYAP_07033                                                            127        2e-35 
PHYSO_260049                                                          127        2e-35 
PHYSO_342831                                                          124        2e-34 
PHYSO_526791                                                          123        3e-34 
PHYSO_327912                                                          124        6e-34 
PYAR_24955                                                            124        7e-34 
PHYSO_338051                                                          122        4e-33 
PHYSO_508915                                                          121        4e-33 
PHYSO_327908                                                          129        9e-33 
PITG_10839                                                            118        1e-32 
PHYCA_109441                                                          120        2e-32 
PHYSO_251461                                                          119        7e-32 
PHYSO_257244                                                          120        1e-31 
PPTG_11479                                                            119        1e-31 
PHYSO_245789                                                          116        1e-31 
PHYCA_11676                                                           117        3e-31 
PYIW_24350                                                            115        5e-31 
PHYSO_477165                                                          112        3e-30 
PHYSO_327911                                                          114        4e-30 
PHYRA_39486                                                           111        1e-29 
PHYRA_39485                                                           110        3e-29 
PHYSO_444351                                                          107        3e-29 
PHYSO_264058                                                          110        7e-29 
PHYKE_1224                                                            108        9e-29 
PPTG_07690                                                            106        2e-28 
PHYCA_73404                                                           105        3e-28 
PHYCA_59410                                                           105        6e-28 
PHALS_05247                                                           107        3e-27 
PHYSO_333132                                                          103        8e-27 
PHYCA_507156                                                          101        4e-26 
PHYRA_52174                                                           103        6e-26 
PYAR_25201                                                            101        1e-25 
PHYRA_44618                                                           100        1e-25 
PHYSO_509491                                                          98.2       2e-25 
PPTG_23721                                                            104        1e-24 
PPTG_11420                                                            98.6       3e-24 
HYAP_05562                                                            99.0       3e-24 
HYAP_07922                                                            96.7       4e-24 
PHYCA_73400                                                           94.0       9e-24 
PHYSO_335497                                                          98.2       1e-23 
PHYCA_119285                                                          92.4       5e-23 
PHALS_13274                                                           96.3       6e-23 
PHYSO_341539                                                          95.9       8e-23 
PYAR_21977                                                            94.0       4e-22 
PHYSO_261711                                                          91.3       3e-21 
PHYSO_526695                                                          88.2       4e-21 
PHYCA_18619                                                           88.6       4e-21 
PHYCA_73406                                                           86.3       7e-21 
PHYCA_73407                                                           86.3       7e-21 
HYAP_07496                                                            83.2       2e-19 
PYU1_G011232                                                          82.0       3e-19 
PYAR_26314                                                            81.3       2e-18 
PHALS_14424                                                           81.3       3e-18 
PHYKE_6288                                                            79.7       4e-18 
HYAP_07372                                                            81.3       6e-18 
PHYKE_7051                                                            78.6       3e-17 
PHYSO_377094                                                          76.6       4e-17 
PHYSO_264049                                                          77.0       7e-17 
PITG_22876                                                            77.0       8e-17 
PHYKE_4231                                                            75.9       2e-16 
PHYSO_245887                                                          75.5       4e-16 
PHYSO_445618                                                          72.4       2e-15 
PPTG_11472                                                            75.9       1e-14 
PITG_23039                                                            68.9       2e-13 
PPTG_05373                                                            69.3       2e-13 
HYAP_08078                                                            66.2       1e-12 
PPTG_19242                                                            61.6       3e-11 
PHYCA_108999                                                          61.2       5e-11 
PPTG_23679                                                            61.6       9e-11 
PPTG_08713                                                            60.8       1e-10 
PHYSO_515401                                                          57.8       8e-10 
PYAR_26415                                                            57.0       9e-10 
PHYSO_260072                                                          58.5       1e-09 
HYAP_11184                                                            54.7       8e-09 
PYIW_25932                                                            54.3       8e-09 
PHYSO_336673                                                          55.1       1e-08 
PPTG_17455                                                            53.1       4e-08 
PPTG_19622                                                            51.2       5e-08 
PHYRA_85280                                                           52.8       5e-07 
PYIR_26577                                                            48.5       8e-07 
PPTG_20067                                                            48.9       1e-06 
HYAP_08850                                                            48.1       7e-06 
PPTG_04456                                                            45.4       8e-06 
PYVX_16508                                                            48.9       8e-06 
HYAP_03446                                                            45.4       1e-05 
HYAP_12828                                                            44.3       2e-05 
PHYSO_335499                                                          47.8       2e-05 
PPTG_20194                                                            45.8       3e-05 
PHYKE_6287                                                            43.5       3e-05 
PYVX_21088                                                            43.9       3e-04 
CCI50250                                                              37.0       0.059 
PHYSO_333483                                                          36.2       0.066 
CCA26306                                                              33.9       0.67  
PHALS_01011                                                           33.1       1.8   
PHYCA_98739                                                           30.4       4.0   
PHYCA_120366                                                          31.6       5.2   
PYAP_24306                                                            29.6       5.8   
HYAP_08851                                                            29.3       6.1   
PYIW_20226                                                            30.8       8.6   
PPTG_23150                                                            27.7       9.0   
H310_08807                                                            30.8       9.2   

>PHYCA_129485
Length=251

 Score = 486 bits (1251),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%), Gaps = 0/251 (0%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MNFRIVLLVLVASLAGAQAQVIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP
Sbjct  1    MNFRIVLLVLVASLAGAQAQVIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP
Sbjct  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
            LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY
Sbjct  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
            YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV
Sbjct  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240

Query  241  FQELLDKAWPF  251
            FQELLDKAWPF
Sbjct  241  FQELLDKAWPF  251

>PPTG_17125
Length=283

 Score = 441 bits (1133),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 207/230 (90%), Positives = 219/230 (95%), Gaps = 0/230 (0%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGH+QVRPFP+P+PVT S KAAVK+KPQLKI DGCHPYPAVQKDGSI+GGLKWSGPQDGE
Sbjct  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGSKLGSQIYARS WVNDVWAIMYAWYFPKGRGAVP+PLI RLFGHRHNWEY IVWIDN
Sbjct  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P+ +NSTILGVSMSA+VGYASQTPPE  YVDGDSVKL+YYYNHLLGSTSLQLTE TGEFQ
Sbjct  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITWDELSKLARYSLNHTDWDETLF+LAGLKMPLKDGVF ELL+KAWPF
Sbjct  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283

>PHYRA_81102
Length=251

 Score = 409 bits (1051),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 201/251 (80%), Positives = 220/251 (88%), Gaps = 0/251 (0%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MNFR V +  +ASLA AQAQVIGHDQVRPFPQP PVTVS K AVKFKPQLKI  GCHPYP
Sbjct  1    MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AVQKDGS++GGLKWSGPQDGECTGS+LGSQIYARSAWVNDVWAIMYAWYFPKGR A   P
Sbjct  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
               R FGHRHNWEYV+VWIDNP  +N+T+LGVSMSA++GY+ Q P +  YVDG SVK+ Y
Sbjct  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
            YYNHLLG+T+LQLTEDTGEFQDLI WD+LS LARYSLNHTDWD+TLF LAGLKMPLKDGV
Sbjct  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240

Query  241  FQELLDKAWPF  251
            F+ELLDK WPF
Sbjct  241  FEELLDKTWPF  251

>PHYRA_72504
Length=251

 Score = 409 bits (1051),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 201/251 (80%), Positives = 220/251 (88%), Gaps = 0/251 (0%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MNFR V +  +ASLA AQAQVIGHDQVRPFPQP PVTVS K AVKFKPQLKI  GCHPYP
Sbjct  1    MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AVQKDGS++GGLKWSGPQDGECTGS+LGSQIYARSAWVNDVWAIMYAWYFPKGR A   P
Sbjct  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
               R FGHRHNWEYV+VWIDNP  +N+T+LGVSMSA++GY+ Q P +  YVDG SVK+ Y
Sbjct  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
            YYNHLLG+T+LQLTEDTGEFQDLI WD+LS LARYSLNHTDWD+TLF LAGLKMPLKDGV
Sbjct  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240

Query  241  FQELLDKAWPF  251
            F+ELLDK WPF
Sbjct  241  FEELLDKTWPF  251

>PITG_18453
Length=252

 Score = 408 bits (1048),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 216/230 (94%), Gaps = 0/230 (0%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGH+QVRPF +P+PVT S KAAVK+KPQLKI DGCHPYPAVQKDGSI+GGLKWSGPQDGE
Sbjct  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGSKLGSQIYARS WVNDVWAIMYAWYFPKGRGAVP PLI RLFGHRHNWEY IVWIDN
Sbjct  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P+ +NSTILGVS+SA++ YAS+TPPEA +VDG+SVKLEYYYNHL GSTSLQLTEDTGEFQ
Sbjct  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DL+TWD+L+KLARYSLN+TDWDETLF+LAGLKMPLKDG F ELL+KAWPF
Sbjct  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252

>PHYRA_71825
Length=254

 Score = 317 bits (812),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 194/254 (76%), Gaps = 3/254 (1%)

Query  1    MNFR---IvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCH  57
            MNFR   I ++  +A++   +  +I HD V PF QP+P T ++KAAVK+KP+L + DGCH
Sbjct  1    MNFRAVLIAVVASLAAVHAERTIIIPHDTVEPFAQPRPKTDAEKAAVKYKPRLLVEDGCH  60

Query  58   PYPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAV  117
            PY AVQ DG+I+GGL+WSGPQDGEC GS LGSQ+YAR   V DVWAIMYAWYFPKGR  +
Sbjct  61   PYAAVQADGAISGGLEWSGPQDGECRGSPLGSQVYARWMKVKDVWAIMYAWYFPKGRAPL  120

Query  118  PLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVK  177
            P+PL  R FGHR+ WEY +VW+DN  +KNST+L  S+SAAVG++ + PP+  Y DG S+ 
Sbjct  121  PVPLSLRFFGHRNGWEYAVVWLDNLNAKNSTVLATSLSAAVGWSKEAPPKEKYFDGTSLM  180

Query  178  LEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLK  237
            + YYYNH+ G+T+++ TED GEFQ LITWD+L  LAR +LN+TDWD T  ++A +KMP+K
Sbjct  181  VSYYYNHIFGNTAVKYTEDAGEFQPLITWDQLPDLARKALNNTDWDATPSNVARVKMPMK  240

Query  238  DGVFQELLDKAWPF  251
            DGVF E L+ A+PF
Sbjct  241  DGVFLEKLEGAYPF  254

>PHYRA_81103
Length=252

 Score = 294 bits (752),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 176/234 (75%), Gaps = 12/234 (5%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGP-QDG  80
            I HDQV+PF QP  +TVS KAAVKFKPQLK  DGC+PYPAVQ DGS +GGL+W+   Q G
Sbjct  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR---GAVPLPLITRLFGHRHNWEYVIV  137
            +CT   LGSQIYARS W  DVWAIMY WYFPKG    G + L       GHRHNWE+V+V
Sbjct  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-------GHRHNWEFVVV  139

Query  138  WIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDT  197
            WIDNP   NSTILGVSMSA++GY+ + PP++ Y+DG SVK+ Y+Y+ + G+T+L+LTED 
Sbjct  140  WIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDA  199

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            GE QDLI WD+L  +AR +LN TDWD TL++L   +MPLKD VF + L K+WPF
Sbjct  200  GETQDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252

>PPTG_08893
Length=251

 Score = 282 bits (722),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 172/230 (75%), Gaps = 3/230 (1%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I +D V+PFPQP P T + KA +K+KPQLK+ +GC PYPAVQ+DG+I+ GL+WSGP+D  
Sbjct  25   IPYDTVQPFPQPVPTTEAQKAILKYKPQLKVEEGCRPYPAVQQDGAISSGLRWSGPEDIG  84

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIYARS    D WA+MY WYFPKGR  +P P   R  GHRH WEY +VW+D 
Sbjct  85   CKGSLRGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPGP---RSSGHRHGWEYAVVWLDK  141

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
              + NSTILG S+SAAVG+A ++P    Y+DG+S+K+ YY+N    +T+++ T+  G FQ
Sbjct  142  LTADNSTILGTSLSAAVGWAKESPTPKEYLDGNSLKVAYYFNDDFKNTAVKYTQAGGAFQ  201

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+LS +AR SL++TDWDET F++A +KMP+KDGVF+E L  A+PF
Sbjct  202  DLIIWDQLSDVARASLSNTDWDETPFNVARVKMPMKDGVFEEKLSGAYPF  251

>PITG_09716
Length=250

 Score = 281 bits (720),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 171/230 (74%), Gaps = 3/230 (1%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I +D ++PFPQP P T + KA +K+KPQLK+ +GCHPYPAVQ++G I+ GL+WSGP+D  
Sbjct  24   IPYDTLQPFPQPIPTTDAQKAILKYKPQLKVEEGCHPYPAVQRNGDISSGLRWSGPEDIG  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQIYARS    D WA+MY WYFPKGR  +P     R  GHRH WEY +VW+D 
Sbjct  84   CKGSSLGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPG---LRSSGHRHGWEYAVVWLDR  140

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
              + +STILG S+SAAVG+A ++P    Y+DG S+K+ YY+N    +T+++ T+D G FQ
Sbjct  141  LDANSSTILGTSLSAAVGWAKESPTPKEYLDGHSLKVAYYFNDDFSNTAVKYTQDGGAFQ  200

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+LS  AR SL +TDWDETLF++A +KMP+KDGVF+E L  A+PF
Sbjct  201  DLIQWDQLSDPARASLINTDWDETLFNVARVKMPMKDGVFEEKLSGAYPF  250

>PPTG_16851
Length=249

 Score = 280 bits (717),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 173/230 (75%), Gaps = 4/230 (2%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I +D V+PF Q  P T + KA +K+KPQLKI +GCHPYPAVQKDGSI+ GLKWSGP +  
Sbjct  24   IPYDSVQPFSQQVPNTDAQKAILKYKPQLKIEEGCHPYPAVQKDGSISSGLKWSGPDNIG  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+YAR+ W+   WA+MYAWYFPKGR  +P P   R +GHRH WEY +VW+D 
Sbjct  84   CKGSPLGSQVYARATWLKGKWAVMYAWYFPKGRAPIPAP---RSYGHRHGWEYAVVWLDK  140

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
              S NST+LG SMSAA+G+A ++P    Y+DG+S+K+ YY+N    +T+++ T+D GEFQ
Sbjct  141  -ASANSTLLGTSMSAAIGWAKESPTPKEYLDGNSLKVAYYFNDDSINTAVKYTQDAGEFQ  199

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+L  +AR +L +TDWDET  ++A +KMP+KDGVF E L+ A+PF
Sbjct  200  DLIIWDQLPDVARNALVNTDWDETPLNVARVKMPMKDGVFMEKLNGAYPF  249

>PHYSO_261265
Length=247

 Score = 278 bits (711),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 184/253 (73%), Gaps = 8/253 (3%)

Query  1    MNFR-IvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPY  59
            MNFR +++ V+ +  A     VI +D+V PF QP PVT   K  +K+KP LKI +GCHPY
Sbjct  1    MNFRAVLIAVVASFAAAQAGNVIPYDEVHPFAQPAPVTDLHKTMLKYKPHLKIKEGCHPY  60

Query  60   PAVQKDGSITGGLKWSGPQD-GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVP  118
            PAVQK+G I+GGL+WS P D  EC GS LGSQ+YARS+WV   +AIMYAWYFP GR    
Sbjct  61   PAVQKNGDISGGLEWSSPTDNAECKGSPLGSQVYARSSWVKGKFAIMYAWYFPMGRA---  117

Query  119  LPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKL  178
             PL+   FGHR+ WEY IVW+D+  S NSTILG S+SAAVG+A + P    Y+DG+++K+
Sbjct  118  -PLLP--FGHRNGWEYAIVWLDSVSSTNSTILGTSLSAAVGWAKEVPRNRKYLDGNNLKV  174

Query  179  EYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKD  238
             YY+N  +  T+++ TE+ GEFQD+ITWD+L    R SL++TDWD T F++A LKMP+KD
Sbjct  175  AYYFNRDVRCTAVEYTEEIGEFQDVITWDQLPAPTRDSLSNTDWDHTPFNVALLKMPMKD  234

Query  239  GVFQELLDKAWPF  251
            GVFQE L+ A+PF
Sbjct  235  GVFQEKLNSAYPF  247

>PHYKE_6286
Length=250

 Score = 277 bits (709),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 172/231 (74%), Gaps = 5/231 (2%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+PV+ ++KAAVKFKPQL +  GC PYPAV  +GSI+ GLKW+G  DG+
Sbjct  24   ISHDQVQPFAQPEPVSDAEKAAVKFKPQLAVTYGCDPYPAVDSNGSISAGLKWAGKPDGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQ+Y+R+ W  D WAIMYAWYFPK R      L    +GHRH W++ +VWID+
Sbjct  84   CTGSPLGSQVYSRADWYEDKWAIMYAWYFPKARQR----LSKYFYGHRHMWQWAVVWIDD  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLL-GSTSLQLTEDTGEF  200
            P S NST+ GVSMSA+VGY  ++PP++ YVD  SVKL+ Y +    G  SL+LTEDTGE 
Sbjct  140  PASDNSTVQGVSMSASVGYQKRSPPKSKYVDDSSVKLDSYVDFWWSGKASLRLTEDTGET  199

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLI WD+L+  AR SL+  D+DE+L++   +KMPLKDGVF + L +++PF
Sbjct  200  QDLIQWDQLTDAARESLSSFDFDESLWNTKKIKMPLKDGVFTKNLKRSYPF  250

>PHYCA_121494
Length=248

 Score = 276 bits (707),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 170/230 (74%), Gaps = 4/230 (2%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I +D V P P     T + KAAVK+ PQL I DGCHPY AVQ DG+I+ GLKWSGPQDG 
Sbjct  23   IPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPQDGA  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+YARS WV   WAIMYAWYFP G+  VP P+     GHR+ WEY ++W+D 
Sbjct  83   CKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAPVP-PV---GLGHRNGWEYAVIWLDR  138

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P + NST+LGVS+SAAVG++ + P +  ++DG+S+K+ YYYN++  +T+++ TE+ GEFQ
Sbjct  139  PTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFRNTAVKYTEEKGEFQ  198

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             LITWD+L   AR +L +TDWDET F++A +KMP+KDGVF E L  A+PF
Sbjct  199  TLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  248

>PHYCA_10034
Length=274

 Score = 275 bits (703),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 169/230 (73%), Gaps = 4/230 (2%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I +D V P P     T + KAAVK+ PQL I DGCHPY AVQ DG+I+ GLKWSGP DG 
Sbjct  49   IPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPHDGA  108

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+YARS WV   WAIMYAWYFP G+  VP P+     GHR+ WEY ++W+D 
Sbjct  109  CKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAPVP-PV---GLGHRNGWEYAVIWLDR  164

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P + NST+LGVS+SAAVG++ + P +  ++DG+S+K+ YYYN++  +T+++ TE+ GEFQ
Sbjct  165  PTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFHNTAVKYTEEKGEFQ  224

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             LITWD+L   AR +L +TDWDET F++A +KMP+KDGVF E L  A+PF
Sbjct  225  TLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  274

>PHYSO_254108
Length=246

 Score = 266 bits (679),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 164/230 (71%), Gaps = 9/230 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+P  QP PVT + K AVK+KPQL+++ GCHPYPAVQ +GS++GGL+WSGP DG+
Sbjct  26   INHDQVQPMAQPTPVTDAQKLAVKYKPQLRVSYGCHPYPAVQANGSVSGGLEWSGPADGD  85

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+YARS W  D WA MY WYFPKGR  V        +GHRH WEY I+W D+
Sbjct  86   CEGSSLGSQVYARSDWFKDKWATMYTWYFPKGRQDV--------WGHRHFWEYAIIWTDS  137

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   NST LG+SMSA VG+  QTP    Y++G+SVKLE +Y+ L    +LQLT+D+G+FQ
Sbjct  138  PSPDNSTFLGISMSAGVGHGKQTPVLLKYMNGNSVKLESHYSVLGNKAALQLTKDSGDFQ  197

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITW +L   AR +LN   +D T F     +MPLKD VF  +L+KA+P+
Sbjct  198  DLITWGQLPVPARDALNGDAFDVTYF-FNKFEMPLKDRVFMSVLNKAYPW  246

>PHYCA_118548
Length=246

 Score = 263 bits (673),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 174/254 (69%), Gaps = 11/254 (4%)

Query  1    MNFR---IvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCH  57
            MNFR   +  +  +A++   +   + HDQV+PF QP+P+T S K+AVK+KPQL I+ GCH
Sbjct  1    MNFRAFLLAAIAGIATINATEVNRVNHDQVQPFAQPEPITDSQKSAVKYKPQLHISYGCH  60

Query  58   PYPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAV  117
            PY AVQ DGS +GGL+WSG  DG+CTGS+LGSQ+Y+RS W +D WAIMYAWYFPKGR   
Sbjct  61   PYAAVQADGSASGGLEWSGRVDGDCTGSQLGSQVYSRSDWYHDKWAIMYAWYFPKGR---  117

Query  118  PLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVK  177
                   L GHRH WEY IVW D+P S NS+I GVSMSA VGY   TPP   Y+DG+S+K
Sbjct  118  -----YHLGGHRHYWEYAIVWTDSPTSSNSSIQGVSMSAGVGYGKATPPMLKYIDGNSIK  172

Query  178  LEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLK  237
             + +++ L    +LQLT++ GE QDLITWD+L+  AR +LN    D   +     ++P K
Sbjct  173  FDSHFSLLGNKAALQLTKEAGERQDLITWDQLTVAARDTLNGDALDGKAWFTDKDEVPFK  232

Query  238  DGVFQELLDKAWPF  251
            D +F + L KA+PF
Sbjct  233  DDIFVKRLQKAFPF  246

>PPTG_07664
Length=245

 Score = 262 bits (670),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 163/230 (71%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PF Q +P+T S K+AVK+KPQL I+ GCHPYPAVQ +GS +GGL+WSGP DG+
Sbjct  24   VNHDKVQPFAQLQPITDSQKSAVKYKPQLHISYGCHPYPAVQANGSASGGLEWSGPVDGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQ+Y+RSAW  + WAIMYAWYFPKGR  +         GHRH WEY IVW D+
Sbjct  84   CTGSPLGSQVYSRSAWYKEKWAIMYAWYFPKGRYGIT--------GHRHYWEYAIVWTDS  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
              S NS+I GVSMSA VG+A  TPP   YVDG S+KL+ Y++ +    +LQLT++ GE Q
Sbjct  136  ATSTNSSIQGVSMSAGVGHAKATPPMLKYVDGSSIKLDSYFSFMGNKAALQLTKEHGETQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITWD+L+  AR +LN    D  ++     ++P KD +F + L  A+PF
Sbjct  196  DLITWDQLTVAARDTLNSDALDGNVWLTNKDEVPFKDDIFMQRLKNAFPF  245

>PITG_22053
Length=245

 Score = 261 bits (666),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 162/230 (70%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PF QP P+T S K+AVK+KPQL I+ GCHPYPAV+ +   +GGL+W GP DG+
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEYV+VW D 
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWTDT  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P S NS+I GVSMSA VG+A  TPP   Y+ G S+KL+ Y++ L    +LQLT++TGE Q
Sbjct  136  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITWD+++  ARY+LN    D  ++     ++P KD +F + L+ A+PF
Sbjct  196  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLENAFPF  245

>PPTG_17049
Length=255

 Score = 260 bits (665),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 165/234 (71%), Gaps = 9/234 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            +GHD+V+PFPQP+P+T S KAAVKFKPQL IA GCHPYPAVQ DG+++GGLK+SG  DG+
Sbjct  25   VGHDRVKPFPQPEPITTSQKAAVKFKPQLSIAFGCHPYPAVQADGAVSGGLKYSGKPDGD  84

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  DVWAI YAWY PKG        ++ + GHRH W YV VWI+N
Sbjct  85   CKGSALGSQVYSRSTWYRDVWAITYAWYLPKGYER--FSGLSMVEGHRHFWGYVTVWINN  142

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLL----GSTSLQLTEDT  197
            P  +N+ ILGVSMS  +G+ +Q P +   VDG ++KLE +  H++    G   L+  E  
Sbjct  143  PAVENAYILGVSMSGQLGHDTQAPVDKKCVDGSTLKLE-FDGHVMDGAKGKQGLRCVEAV  201

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDLITWD+L++ AR SLN  ++D    D+    +PLKDGVF  LL+  WPF
Sbjct  202  GKFQDLITWDQLTEAARDSLNTYNFDSIGRDMG--TVPLKDGVFTNLLNSTWPF  253

>PITG_04208
Length=245

 Score = 259 bits (663),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 161/230 (70%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PF QP P+T S K+AVK+KPQL I+ GCHPYPAV+ +   +GGL+W GP DG+
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEYV+VW D 
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWTDT  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P S NS+I GVSMSA VG+A  TPP   Y+ G S+KL+ Y++ L    +LQLT++TGE Q
Sbjct  136  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITWD+++  ARY+LN    D  ++     ++P KD +F + L  A+PF
Sbjct  196  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLANAFPF  245

>PITG_19936
Length=249

 Score = 255 bits (651),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 162/231 (70%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PF QP+P   S K+AVK+KPQL I+ GCHPYPAVQ+DGSI+ GLKW+G  +G+
Sbjct  24   IDHDAVQPFAQPEPTMESQKSAVKYKPQLHISYGCHPYPAVQEDGSISAGLKWAGWPNGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W    WAIMYAWYFPK R  V        FGHRH W Y IVW +N
Sbjct  84   CKGSALGSQVYSRSDWYKGKWAIMYAWYFPKSRQYVD----KYRFGHRHYWSYAIVWTNN  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            P   NSTILGVSMS+ VGY  ++PP++ Y VDG +VKL++Y++       LQLTE +GE 
Sbjct  140  PNPDNSTILGVSMSSGVGYMKRSPPKSKYVVDGTTVKLDWYWSFWGSKQGLQLTEKSGET  199

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITW++LS+ AR +L+  D+D + +      MPLKD +F   L KA+PF
Sbjct  200  QDLITWEQLSEEARNALSEADFDVS-WAFTKAVMPLKDDIFTSRLKKAYPF  249

>PHYRA_74356
Length=244

 Score = 253 bits (646),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 158/230 (69%), Gaps = 9/230 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF +P+P T S+KAAVKFKPQL ++ GC+PYPAVQ DGS++ GLK SGP DGE
Sbjct  24   IDHDQVQPFAEPEPTTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLKGSGPADGE  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQ+Y+RS W  D WAIMYAWY PKG            +  RH WE  +VWID+
Sbjct  84   CTGSSLGSQVYSRSDWYEDKWAIMYAWYLPKG---------NYKYQRRHYWETAVVWIDD  134

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   NSTILGVSM+       +TP +A ++DG SVKL+ Y  +      LQ T++ GEFQ
Sbjct  135  PALSNSTILGVSMNYGRRSEFETPVQARFLDGSSVKLDSYRGYGYPKPRLQFTQEEGEFQ  194

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITW++L++ AR +L+  D+D  LF     KMPLKDG+F+  L  AWPF
Sbjct  195  DLITWEQLTEEARDALSTADFDGPLFKKKKRKMPLKDGIFEFRLKDAWPF  244

>PHYCA_9298
Length=248

 Score = 252 bits (643),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 159/231 (69%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+K+AVK+KPQL I+DGCHPYPAVQ DG+++ GLKW+G   G+
Sbjct  23   IDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHPYPAVQADGAVSAGLKWAGTASGQ  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  + WAIMYAWYFPKGR  +        FGHRH W Y IVW+D+
Sbjct  83   CKGSGLGSQVYSRSDWYKNKWAIMYAWYFPKGRQYIS----KYRFGHRHFWSYAIVWMDS  138

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
                NSTILGVSMSA VGY+ +TPP++ Y VDG +VK + Y++      ++ LT   GE 
Sbjct  139  DVPDNSTILGVSMSAGVGYSKETPPKSKYVVDGTTVKFKSYHSFWGSKLAVGLTTKEGES  198

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLI W++L+  AR  L   D+D   +    + MP+ DGVF E L K +PF
Sbjct  199  QDLIAWEQLTDEARSGLTDADFD-VDWSFRKVVMPMTDGVFTEKLKKNYPF  248

>PITG_19938
Length=245

 Score = 251 bits (641),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 163/228 (71%), Gaps = 8/228 (4%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HD+V+PF QP P+T S K+AVK+KPQL I+ GCHPYPAV+ +GS +GGL+WSGP DG+CT
Sbjct  26   HDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGDCT  85

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEYV+VW D+  
Sbjct  86   GSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWADSST  137

Query  144  SKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDL  203
            S +S+I GVSMSA VG+A  TPP   Y+ G SVKL+ Y++ L    +LQLT++TGE QDL
Sbjct  138  STSSSIQGVSMSAGVGHAKATPPMLKYIHGSSVKLDSYFSFLGSKAALQLTKETGETQDL  197

Query  204  ITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            ITWD+++  AR +LN    D  ++     ++P KD +F + L+ A+PF
Sbjct  198  ITWDQMTVAARDTLNSDTLDGNVWLTNKDEVPFKDTIFLKRLEDAFPF  245

>PHYSO_526832
Length=249

 Score = 249 bits (637),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 162/233 (70%), Gaps = 10/233 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF Q +PV  SDKAA+KFKP+L+I+ GCHPYPAVQ DG+++ GLKW+G  DG+
Sbjct  24   INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWAGKADGK  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKG---RGAVPLPLITRLFGHRHNWEYVIVW  138
            C GS LGSQ+Y+RSAW    +AIMYAWYFPKG   RG +        + HRH W Y+++W
Sbjct  84   CKGSGLGSQVYSRSAWFEGKFAIMYAWYFPKGFEQRGKIN-------YSHRHLWLYLVLW  136

Query  139  IDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            IDNP+++N  ILGV +  A G   +TPP+A ++DG S+K++YY +   G T +QLTE+ G
Sbjct  137  IDNPENENPAILGVWLRTAGGNERRTPPDAKFLDGSSLKVDYYKSSWHGKTGIQLTENPG  196

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            EFQDLITW+++++ AR +L   D+D    +   L +P  DG F   L KAW F
Sbjct  197  EFQDLITWEQMTEEARIALTEADFDGHWQERKDLDVPFIDGEFTVNLKKAWVF  249

>PHYRA_74306
Length=245

 Score = 248 bits (634),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 157/230 (68%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF +P+P+T S+KAAVKFKPQL ++ GC+PYPAVQ DGS++ GL+ SGP DGE
Sbjct  24   IDHDKVQPFAEPEPMTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLRGSGPADGE  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR        TR    RH WE  +VWID+
Sbjct  84   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRS-------TR-HQRRHFWETAVVWIDD  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   NSTILGVSM+       QTP +  Y+DG SVKLE Y  +      LQ T++ G+FQ
Sbjct  136  PALANSTILGVSMNYGWRSKEQTPVKVKYLDGSSVKLESYRAYGFPKPRLQFTQEDGQFQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITW++L++ AR +L+  D+D  L +    +MPLKD +F+  L  AWPF
Sbjct  196  DLITWEQLTEEARDALSTADFDTYLIEQKKREMPLKDDIFEYRLKDAWPF  245

>PHYCA_118674
Length=281

 Score = 249 bits (637),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 165/234 (71%), Gaps = 13/234 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+K+AVK+KPQL I+DGCHPYPAVQ +GS++GGLKW+G  DG+
Sbjct  57   INHDQVQPFTQPEPTTDSEKSAVKYKPQLHISDGCHPYPAVQANGSVSGGLKWAGRSDGD  116

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLF--GHRHNWEYVIVWI  139
            C  S LGSQIY+RS W ND WAIMYAWYFPKG            F  GHRH W Y IVW 
Sbjct  117  CKRSALGSQIYSRSDWHNDKWAIMYAWYFPKGNE------FQANFDSGHRHYWSYAIVWT  170

Query  140  DNPKSKNSTILGVSMSAAVGYASQTPPEAMYV-DGDSVKLEYYYNHLLGSTSLQLTEDTG  198
             +P  +NST+LGVSMS++ GY  + PP++ YV DG +VK + Y +      +++LT+  G
Sbjct  171  GSPNPENSTVLGVSMSSS-GYGKKAPPKSKYVIDGTTVKFDSYVSFWASKQAIRLTKKEG  229

Query  199  EFQDLITWDELSKLARYSLNHTDWD-ETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            E QDLITW++L++ AR +L+  D+  E+ F  + + MPLKD VF  +L KA+PF
Sbjct  230  EAQDLITWEQLTQEARTALSEADFKAESTF--SKVVMPLKDDVFSSILKKAYPF  281

>PHYRA_52440
Length=243

 Score = 246 bits (627),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 167/251 (67%), Gaps = 10/251 (4%)

Query  1    MNFR--IvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHP  58
            MNFR  ++  +   +   A+   + HD V+PF QP PVT S K+AVK+KPQL I+ GCHP
Sbjct  1    MNFRAFLLAAIASVAAVNAEVVKVNHDLVQPFAQPTPVTDSQKSAVKYKPQLYISYGCHP  60

Query  59   YPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVP  118
            YPAV+ +G  +GGL+WSGP DG+C GS LGSQ+Y+RS W ++ WAIMYAWYFPKGR  V 
Sbjct  61   YPAVEANGYASGGLEWSGPNDGDCKGSSLGSQVYSRSDWYHEKWAIMYAWYFPKGRYGVT  120

Query  119  LPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKL  178
                    GHR+ WEY IVW D+    NST+LGVSMSA VG+   TPP   Y++G SVKL
Sbjct  121  --------GHRNYWEYAIVWTDSTSPDNSTLLGVSMSAGVGHDKTTPPMLKYMNGSSVKL  172

Query  179  EYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKD  238
              +++ L    +L+LT+  GEFQDLITWD+L+  AR +LN    D  ++     ++P KD
Sbjct  173  NSHFSLLGSKAALELTKKEGEFQDLITWDQLTVAARETLNSDALDGNVWLSNKDEVPFKD  232

Query  239  GVFQELLDKAW  249
             +F + L+ A+
Sbjct  233  DIFVDRLEDAY  243

>PHYCA_132252
Length=249

 Score = 246 bits (627),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 157/231 (68%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+K+AVK+KPQL I+DGCH YPAVQ DG+++ GLKW+G   G+
Sbjct  24   IDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHSYPAVQADGAVSAGLKWAGSVSGQ  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR  +        FGHRH W Y IVW+D+
Sbjct  84   CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYIS----KYRFGHRHFWSYAIVWMDS  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
                NSTILGVSMSA VGY  +TPP++ Y VDG +VK + Y +   G  ++ LT   GE 
Sbjct  140  DVPDNSTILGVSMSAGVGYNKKTPPKSKYVVDGTTVKFDSYQSFWGGKLAVGLTTKEGET  199

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITW++L+   R  L   D+D   + +  + MP+ D VF + L K +PF
Sbjct  200  QDLITWEQLTDEGRTGLTDADFD-VDWSIRKVVMPMADDVFVKKLKKNYPF  249

>PHYSO_526623
Length=249

 Score = 245 bits (625),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 155/231 (67%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PF QP+P T S+K AVKFKPQL I+ GCHPYPAV+ +GS++ GLKW+G  DG+
Sbjct  24   INHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVEANGSVSAGLKWTGWADGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W Y IVW D+
Sbjct  84   CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYAS----QYRSGHRHFWSYAIVWTDS  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
             K  NSTI GVSMSA VGY   TPP++ Y VDG +VK + Y++       ++ T  TGE 
Sbjct  140  DKPDNSTIQGVSMSAGVGYGKATPPKSKYVVDGVTVKFDSYFSFWGSKVGIRTTTKTGET  199

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITW++L+  AR +L   D+D   +    + MPL D VF E L+KA+PF
Sbjct  200  QDLITWEQLTDEARTALTDADFD-VDWSYKKVVMPLLDDVFTEKLEKAYPF  249

>PPTG_07671
Length=246

 Score = 244 bits (622),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 153/230 (67%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V PF QPKP T S+KAAVK+KPQ  ++ GCHPYPAVQ DGS++ GLK SGP DGE
Sbjct  24   INHDEVEPFAQPKPTTDSEKAAVKYKPQFHVSYGCHPYPAVQADGSVSAGLKGSGPMDGE  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D+WAIMYAWY PKGR        +  +  RH WE  +VWID+
Sbjct  84   CEGSPLGSQVYSRSGWYEDMWAIMYAWYLPKGR--------STKYQRRHYWEVAVVWIDD  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   NSTILGVS++    + SQ P E  Y+ G  VKLE +    +    L+ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRHNSQVPVEEQYLHGSRVKLESFKGFGVPRPRLRFTDLEGETQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITW++L++ AR +L++  +   L       MPLKDGVF++ L+ A+PF
Sbjct  196  DLITWEQLTEEARDALSNAKFQRGLIKRLRGDMPLKDGVFEKRLEDAYPF  245

>PITG_04248
Length=245

 Score = 243 bits (621),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 154/230 (67%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QPKP T S+ AAVK+KPQL ++ GC PYPAVQ DGS++ GLK SGP DGE
Sbjct  24   INHDEVKPFAQPKPTTDSEVAAVKYKPQLYVSYGCRPYPAVQADGSVSAGLKGSGPMDGE  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWY PKGR           +  RH WE  +VWID+
Sbjct  84   CEGSPLGSQVYSRSTWYEDKWAIMYAWYLPKGRNTK--------YQRRHFWEAAVVWIDD  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   NSTILGVS++    + S+ P E  Y++G +VKLE Y  +      L+ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRHKSKAPLERRYLEGSNVKLESYKGYGKPRPRLRFTQLKGETQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             LITW++L+K AR +L++  ++  LF     +MPLKDGVF++ L  A+PF
Sbjct  196  HLITWEQLTKEARDALSNAKFNTGLFKRTKREMPLKDGVFEKRLKDAYPF  245

>PHYSO_526774
Length=249

 Score = 242 bits (617),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 158/236 (67%), Gaps = 16/236 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+P  QP+P T S+K AVK+KPQL I+ GCHPYPAVQ DGS++ GLKWSG  +G+
Sbjct  24   INHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWANGK  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRL-----FGHRHNWEYVI  136
            C GS LGSQ+Y+RS W    WAIMYAWYFPKGR         R+      GH H W Y I
Sbjct  84   CKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGR---------RMGDGYNSGHHHYWSYAI  134

Query  137  VWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTE  195
            VWIDNP   NSTILGVSMSA VGY   +PP++ Y VDG +VK + Y +       ++LT 
Sbjct  135  VWIDNPNPDNSTILGVSMSAGVGYRKASPPKSKYVVDGVTVKFDSYRSFWGSKQGVRLTT  194

Query  196  DTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             +G+ QDLITW++L+  AR +L+  D+D   + L  + MPLKD   +E L+KA+PF
Sbjct  195  KSGDQQDLITWEQLTDEARTALSDADFDVN-WSLKNVVMPLKDDALRERLEKAYPF  249

>PHYCA_118551
Length=245

 Score = 241 bits (614),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 152/230 (66%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PFPQPKP T S+KAAVK+KPQL ++ GCHPYPAVQ DGS++ GLK +GP  GE
Sbjct  24   IDHDTVKPFPQPKPKTDSEKAAVKYKPQLLVSYGCHPYPAVQADGSVSAGLKGTGPAAGE  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY+WY PKGR A         +  RH WE  +VWID+
Sbjct  84   CGGSALGSQVYSRSDWYKDKWAIMYSWYLPKGRPAK--------YQRRHLWETAVVWIDD  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   NSTILGVS++    + +  P E+ ++D   VKLE Y         L+ T   GE Q
Sbjct  136  PSLANSTILGVSLNYGWRHKTMAPIESEFLDDSRVKLESYRGFSYPRPKLRFTTHVGETQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITW++L+  AR +L++ ++D  L      +MPLKDGVF++ L  AWPF
Sbjct  196  DLITWEQLTVEAREALSNAEFDSGLIKTTRREMPLKDGVFEKRLKDAWPF  245

>PHYRA_74343
Length=249

 Score = 238 bits (606),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 152/231 (66%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PF QP+P T S+K AVKFKPQL I+ GCHPYPAV  +GS+  GLKW+G  DG+
Sbjct  24   IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWDDGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W Y IVW D+
Sbjct  84   CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTS----AYRTGHRHYWSYGIVWTDS  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
                NSTILGVSMSA VG+   TPP++ Y VDG +VK + + +       ++LT   GE 
Sbjct  140  SSPDNSTILGVSMSAGVGFGKATPPKSKYVVDGTTVKFDSFRSFWGSKMGVKLTTKEGEM  199

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITW+++++ AR +L   D+D   + +  + MP+ D VF   L KA+PF
Sbjct  200  QDLITWEQMTEEARTALTDADFD-VDWSVRKVVMPMSDDVFMTKLKKAYPF  249

>PPTG_19331
Length=368

 Score = 239 bits (611),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 153/230 (67%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PFPQP+PVT+S+KAAVKFKPQ+ I +GCHPYPAV + G  +GGLK  G    +
Sbjct  152  IDHDQVKPFPQPEPVTISEKAAVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAK  211

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS WV  +WAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  212  CKGSGWGSQVYGRSTWVQGIWAIMYSWYFPKDSPSSGL-------GHRHDWEHVIVWIDN  264

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P  +N  IL V+ SA  GY+ Q PP A  VDG SVK++ Y +H   + +L+ T + G+FQ
Sbjct  265  PDVENPKILAVTPSAHDGYSKQVPPNADCVDGTSVKVK-YESHWPINHALESTSEGGDFQ  323

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+LS+ AR ++N   W +          P  DG F+  L+KAWPF
Sbjct  324  DLIMWDQLSEDARRAMNGVGWGKA-------NTPFNDGNFKPKLEKAWPF  366

>PITG_04267
Length=279

 Score = 236 bits (603),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 158/231 (68%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF Q KP T S+K+A+K+KPQL I+DGCHPYPAVQ +GSI+GGLKWSG  +G+
Sbjct  54   INHDQVQPFEQIKPATDSEKSAIKYKPQLHISDGCHPYPAVQSNGSISGGLKWSGKANGD  113

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C    LGSQ+Y+RSAW    WAIMYAWYFPKG    P  ++    GHRH W Y I+W D+
Sbjct  114  CKEPGLGSQVYSRSAWFKGKWAIMYAWYFPKG----PQFVLRFDTGHRHFWSYAILWTDD  169

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            P   NSTILGVSMS + GY  ++ P+A Y V G +VKL+ Y +  +G  +LQLT+  GE 
Sbjct  170  PNHDNSTILGVSMSGSRGYVKESSPKAKYIVKGTTVKLDSYASFWMGVQALQLTKKLGET  229

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITW++L+  A  +L   D+ E+    A + MPL D  F  +L  ++PF
Sbjct  230  QDLITWEQLTDEACDALTEFDF-ESDPSRAMVVMPLGDDNFTPILKDSYPF  279

>PHYRA_72386
Length=245

 Score = 235 bits (600),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 149/230 (65%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQVRPF QP+PVT+S++AA+KFKPQL + DGCHPYPAV   G + GGLK +G     
Sbjct  31   ISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTAG  90

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIY RS W  D+WAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  91   CKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWIDN  143

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   N  IL VS SA  GY+   PP A  +DG S K+ Y  ++ + + +L  T D GEFQ
Sbjct  144  PDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEFQ  202

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W+++S LAR +LN  ++ +         +P+ DG F   LDKAWPF
Sbjct  203  DLIMWEQMSDLARQALNTMNFGDA-------NVPMNDGNFVGKLDKAWPF  245

>PHYRA_72344
Length=245

 Score = 235 bits (600),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 149/230 (65%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQVRPF QP+PVT+S++AA+KFKPQL + DGCHPYPAV   G + GGLK +G     
Sbjct  31   ISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTAG  90

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIY RS W  D+WAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  91   CKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWIDN  143

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   N  IL VS SA  GY+   PP A  +DG S K+ Y  ++ + + +L  T D GEFQ
Sbjct  144  PDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEFQ  202

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W+++S LAR +LN  ++ +         +P+ DG F   LDKAWPF
Sbjct  203  DLIMWEQMSDLARQALNTMNFGDA-------NVPMNDGNFVGKLDKAWPF  245

>PHYRA_74307
Length=249

 Score = 235 bits (600),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 156/231 (68%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PF QP+P T S+K AVKFKPQL I+ GCHPYPAV  +GS+  GLKW+G  DG+
Sbjct  24   IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWADGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS    D WAIMYAWYFPKGR  +         GHRH W Y IVW D+
Sbjct  84   CKGSGLGSQVYSRSDSYKDKWAIMYAWYFPKGRQYIH----KYHSGHRHYWSYGIVWTDS  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYV-DGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
                NSTILGVSMSA VGY   +PP++ +V DG +VK + Y +       ++LT+ TG+ 
Sbjct  140  SSPDNSTILGVSMSAGVGYRKVSPPKSKFVIDGTTVKFDSYKSFWGSKQGVRLTKKTGDT  199

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITW+++++ AR +L  TD+D   + L  + MPL D  F E L+K++PF
Sbjct  200  QDLITWEQMTEEARTALVDTDFD-VEWSLKKVVMPLSDDAFTERLEKSYPF  249

>PHYSO_526071
Length=249

 Score = 235 bits (600),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 152/231 (66%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+P  QP+P T S+K AVK+KPQL I+ GCHPYPAVQ DGS++ GLKWSG  +G+
Sbjct  24   INHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWANGK  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W    WAIMYAWYFPKGR  V         GHRH W Y IVW D+
Sbjct  84   CKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGRQYVS----KYRKGHRHFWSYAIVWTDS  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYV-DGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
             K  NSTI GVSMSA VG+   TPP++ YV DG +VK + Y++       ++ T  TGE 
Sbjct  140  DKPDNSTIQGVSMSAGVGFRKATPPKSKYVIDGVTVKFDSYFSFWGSKVGIRTTTKTGES  199

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITW++L+  AR  L + D+D   +    + MPL D  F + L KA+PF
Sbjct  200  QDLITWEQLTDEARTGLTNADFD-VDWSYRKVVMPLSDEDFTDKLKKAYPF  249

>PITG_04200
Length=247

 Score = 234 bits (598),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 152/231 (66%), Gaps = 9/231 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP P T S+KAAVK+KP+L ++ GCHPYPAVQ +G ++ GLK SGP DGE
Sbjct  24   INHDEVKPFAQPTPTTDSEKAAVKYKPKLYVSYGCHPYPAVQANGFVSAGLKGSGPIDGE  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMYAWY PKGR +         +  RH WE  +VWID+
Sbjct  84   CEGSSLGSQVYSRSMWYEDKWAIMYAWYLPKGRSSK--------YQRRHFWEAAVVWIDD  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   NSTILGVS++      S+ P E  ++DG +VKLE Y         LQ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRQKSEVPLELQFLDGSNVKLESYRGFGRPRPRLQFTQLEGETQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETL-FDLAGLKMPLKDGVFQELLDKAWPF  251
            DLITW++L+  AR  L+  +++  L F     +MPLKDGVF++ L  A+PF
Sbjct  196  DLITWEQLTDEARDGLSDAEFNTGLFFKRTRREMPLKDGVFEKRLIDAYPF  246

>PHYRA_76249
Length=326

 Score = 236 bits (603),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 147/234 (63%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+P+T+S+KA VKFKPQ+ + +GCHPYPAV + G   GGLK  G     
Sbjct  112  IDHDQVKPFAQPEPITISEKAGVKFKPQIHVTNGCHPYPAVNEAGETGGGLKTKGAPSAG  171

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  172  CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWIDN  224

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P  +N  IL V+ SA  GY+ Q PP A  VDG SVK+EY      NH L STS       
Sbjct  225  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSVKVEYKSKWPINHALESTS-----QG  279

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDLI WD+LS+ AR +LN   W +          P+ DG FQ  L KAWPF
Sbjct  280  GDFQDLIMWDQLSENARRALNSVPWGDA-------NTPMNDGNFQNKLGKAWPF  326

>PHYSO_249692
Length=248

 Score = 232 bits (592),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 149/230 (65%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQVRPF QP+PVT+S++AAVKFKPQL + +GCHPYPAV   G  +GGLK SG     
Sbjct  34   ISHDQVRPFAQPEPVTISERAAVKFKPQLHVTNGCHPYPAVNDAGETSGGLKTSGAPSAG  93

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +  L       GHRH+WE+VIVWI+N
Sbjct  94   CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWINN  146

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   +  IL V+ SA  GY+  +PP A  +DG S+K+ Y  N+ +   +  +T + G+FQ
Sbjct  147  PDVPDPIILAVTPSAHSGYSKYSPPNADTLDGTSIKVNYESNYPMNHAT-DVTTEGGDFQ  205

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD++S LAR +LN   + +         +P+ DG F   LD+AWPF
Sbjct  206  DLIMWDQMSDLARRALNEVSFGDA-------NVPMNDGNFVGKLDRAWPF  248

>PHYCA_129784
Length=246

 Score = 232 bits (591),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 146/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PFPQP+PVT+S++AA+KFKPQL + DGCHPYPAV   G   GGLK +G     
Sbjct  32   IDHDQVKPFPQPQPVTISERAAMKFKPQLHVVDGCHPYPAVNDAGETGGGLKTTGSPTAG  91

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +  L       GHRH+WE+VIVWI N
Sbjct  92   CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWISN  144

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   N TIL V+ SA  GY+   PP A  VDG S+K+ Y   + +   +  +T + GEFQ
Sbjct  145  PDVPNPTILAVTPSAHSGYSKYAPPSADTVDGTSIKVRYESTYPMNHAT-DVTTEAGEFQ  203

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+++  AR +LN   + +         +P+ DG F   LDKAWPF
Sbjct  204  DLIMWDQMTDAARNALNTVSFGDA-------NVPMNDGNFVPKLDKAWPF  246

>PHYRA_74310
Length=249

 Score = 232 bits (591),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 151/231 (65%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PF QP+P T S+K AVKFKPQL I+ GCHPYPAV  +GS+  GLKW+G  DG+
Sbjct  24   IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVDANGSVNAGLKWAGWADGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS +GSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W Y IVW D+
Sbjct  84   CKGSAMGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTS----KYRAGHRHYWSYGIVWTDS  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYV-DGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
                NSTILGVSMSA VG+   TPP++ YV DG +VK + +++       ++LT   G  
Sbjct  140  SSPDNSTILGVSMSAGVGFGKATPPKSKYVIDGTTVKFDSFWSFWGSKLGVKLTTKEGAT  199

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            Q LITW+++++ AR +L   D+D   +    + MP+ D VF + L KA+PF
Sbjct  200  QALITWEQMTEEARTALTDADFD-VDWSFRKVVMPMSDDVFTKKLKKAYPF  249

>PHYCA_107869
Length=342

 Score = 234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 150/234 (64%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+KAAVK+KPQ+ I +GCHPYPAV + G  +GGLK  G     
Sbjct  128  IDHDQVKPFAQPEPVTISEKAAVKYKPQIHIVNGCHPYPAVNEAGETSGGLKTKGAPSAG  187

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS WV  VWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  188  CKGSGWGSQVYGRSTWVRGVWAIMYSWYFPKDSPSSGL-------GHRHDWEHVIVWIDN  240

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P  +N  IL V+ SA  GY+ Q PP+A  VDG SVK++Y      NH L STS     + 
Sbjct  241  PDIENPKILAVTPSAHSGYSKQVPPKADCVDGTSVKVKYESKWPVNHALDSTS-----EG  295

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDLI WD+LS+ AR ++N   W +          P  DG F   LDKAWPF
Sbjct  296  GDFQDLIMWDQLSENARRAMNGVGWGKA-------NTPFNDGNFLPKLDKAWPF  342

>PHYSO_507736
Length=236

 Score = 230 bits (586),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 157/249 (63%), Gaps = 15/249 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R +++  VA L  + A VI HDQV PF QP P + S  AAVKFKPQL I +GCHPYP
Sbjct  1    MNLRRLVVAAVAFLTASHASVIDHDQVVPFAQPTPTSTSQTAAVKFKPQLHITNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV  DG+ +GGL  +G     C GS  GSQIY RS W N VWAIMY+WYFPK   A    
Sbjct  61   AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA----  116

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                 FGHRH+WE+++VW++NP   +  +L VS SA  GY +  PP + Y+DG+S K++ 
Sbjct  117  ---SGFGHRHDWEHIVVWLNNPAVTSPELLAVSTSAHSGYTTYYPPSSSYLDGNSAKID-  172

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
            YYN LL + + ++T D+GE QDLI WD+L+  AR +L +TD+ +         +P KD  
Sbjct  173  YYNVLLINHAFRMTSDSGETQDLIMWDQLTDAARTALENTDFGDA-------NVPFKDAN  225

Query  241  FQELLDKAW  249
            F+  L  AW
Sbjct  226  FETKLANAW  234

>PHYKE_2376
Length=322

 Score = 233 bits (593),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 148/234 (63%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+KA VKFKPQ+ I +GCHPYPAV + G  +GGLK  G     
Sbjct  108  IDHDQVKPFGQPEPVTISEKAGVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAG  167

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W NDVWAIMY+WYFPK   +  L       GHRH+WE+VI+WIDN
Sbjct  168  CKGSGWGSQVYGRSGWKNDVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIIWIDN  220

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P  +N  IL V+ SA  GY++  PP A  +DG S K+ Y      NH L STS     + 
Sbjct  221  PDVENPRILAVTPSAHSGYSTYRPPNADTLDGTSAKVNYESHWPVNHALDSTS-----EG  275

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDLI WD+++  AR +LN   W +         +P+ DG F   LDKAWPF
Sbjct  276  GDFQDLIMWDQMTDNARRALNEVSWGDA-------NVPMNDGNFGPKLDKAWPF  322

>PHYCA_123779
Length=277

 Score = 231 bits (588),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 148/234 (63%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V PF QP+PVT+SDKAA+KFKPQL I +GCHPYPAV   G  +GGLK SG     
Sbjct  59   IDHDAVVPFKQPEPVTISDKAAIKFKPQLHITNGCHPYPAVNAIGQTSGGLKTSGAPSAG  118

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  119  CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWIDN  171

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P+     ILGV+ SA  GY+SQ PP+A  VDG SVK++Y      NH L ST      + 
Sbjct  172  PEVPEPKILGVTPSAHSGYSSQVPPDADKVDGSSVKVKYLSKWPINHALESTG-----EG  226

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDLI W +++  AR  L+ T W +         +P+ DG F+  L KAWPF
Sbjct  227  GDFQDLIMWTQMTDAAREGLSKTGWGKA-------NVPMVDGNFEAKLGKAWPF  273

>PHYCA_122048
Length=236

 Score = 229 bits (583),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 146/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H+QV PF QP+  T+S KAA+KFKPQ+ I +GCHPYPAV + G  +GGLK SG     
Sbjct  22   IDHNQVVPFAQPEATTISQKAAIKFKPQIHITNGCHPYPAVNEAGETSGGLKTSGAPSSS  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N  WAIMY+WYFPK   +  L       GHRH+WE+V+VWIDN
Sbjct  82   CKGSGWGSQVYGRSTWYNGKWAIMYSWYFPKDSPSTGL-------GHRHDWEHVVVWIDN  134

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   N TIL  S SA  GY+   PP +  VDG SVK+ Y  N  + + +L +T  +GE Q
Sbjct  135  PDVANPTILATSPSAHSGYSFYAPPSSDSVDGTSVKVNYESNWPI-NHALDMTSKSGETQ  193

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+LS+ ARY+LN TD+ +         +P+ DG F   L KAWPF
Sbjct  194  DLIMWDQLSEAARYALNTTDFGKA-------NVPMNDGNFVAKLGKAWPF  236

>PPTG_15230
Length=252

 Score = 229 bits (583),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 146/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHDQV+PF QP+PVT+S++AA+KFKPQ+ I DGCHPYPAV   G   GGLK +G     
Sbjct  38   IGHDQVKPFAQPQPVTISERAAIKFKPQIHIGDGCHPYPAVNDIGETGGGLKTTGSPTAG  97

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +  L       GHRH+WE+VIVWI+N
Sbjct  98   CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWINN  150

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   +  IL V+ SA  GY+   PP A  +DG SVK+ Y   + +   +  +T D GEFQ
Sbjct  151  PDVPDPIILAVTPSAHSGYSKYAPPNADTLDGTSVKVNYESTYPMNHAT-DVTTDPGEFQ  209

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+++  AR +LN   + +         +P+ DG F   LDKAWPF
Sbjct  210  DLIMWDQMTDAARLALNTVSFGDA-------NVPMNDGNFIPKLDKAWPF  252

>PHYRA_71477
Length=238

 Score = 228 bits (580),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 151/230 (66%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V PFPQP+PVT+S+KAAV+FKP++ I +GCHPYPAV + G  +GGL+ +G    +
Sbjct  24   IGHDEVVPFPQPEPVTISEKAAVRFKPEIHITNGCHPYPAVSEAGMTSGGLQATGGPSSK  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W + VWAIMY WYFPK   +      TRL GHRH+WE+V+VWIDN
Sbjct  84   CKGSGWGSQMYGRSTWYSGVWAIMYTWYFPKDSPS------TRL-GHRHDWEHVVVWIDN  136

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   N  +L VS SA  GY+   PP A  VDG SVK+  Y +H   + +L  T  +GEFQ
Sbjct  137  PDVSNPILLAVSPSAHSGYSKYVPPSADSVDGTSVKIN-YESHWPVNHALDTTSKSGEFQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W ++S  AR +LN TD+ + +       MP+ DG F   L  AWP+
Sbjct  196  DLIMWHQMSDAARLALNTTDFGKAI-------MPMNDGSFLGKLAGAWPW  238

>PHYRA_42876
Length=213

 Score = 225 bits (573),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 144/232 (62%), Gaps = 23/232 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+P+T+S+K+ VKFKPQ+ + +GCHPYPAV   G   GGLK  G     
Sbjct  1    IDHDQVQPFAQPEPITISEKSGVKFKPQIHVTNGCHPYPAVNYKGETGGGLKTKGAPSAG  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y R+AW  DVWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  61   CKGSGWGSQVYGRAAWHRDVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWIDN  113

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P  +N  IL V+ SA  GY+ Q PP A  VDG S K+EY      NH L STS       
Sbjct  114  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSAKVEYKSKWPINHALESTS-----QG  168

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            G+FQDLI WD+LS+ AR +LN   W +          P+ DG F   LDKAW
Sbjct  169  GDFQDLIMWDQLSENARRALNSVPWGDA-------NTPMNDGNFLPKLDKAW  213

>PHYSO_329843
Length=239

 Score = 226 bits (575),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 144/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF QP+ VT+S KAAVKFKPQ+ I +GCHPYPA  + G  +GGLK +G     
Sbjct  25   IDHDQVVPFAQPEAVTISQKAAVKFKPQIHITNGCHPYPAANEAGQTSGGLKPTGAPSSS  84

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W +  WAIMY+WYFPK   +  L       GHRH+WE+V+VWIDN
Sbjct  85   CKGSGWGSQVYGRSTWYSGRWAIMYSWYFPKDSPSTGL-------GHRHDWEHVVVWIDN  137

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P  +N TIL  S SA  GY+   PP A  +DG SVK+  Y +H   + +L +T ++GEFQ
Sbjct  138  PDVENPTILSTSPSAHSGYSYYVPPSADSIDGTSVKVN-YESHWPINHALDMTSESGEFQ  196

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+LS  AR +LN T             +P+ DG F   L KAWPF
Sbjct  197  DLIMWDQLSDAARLALNTT-------SFGSANVPMNDGNFLTKLGKAWPF  239

>PHYCA_108039
Length=215

 Score = 224 bits (572),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 145/232 (63%), Gaps = 23/232 (10%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HDQV+PF QP PVTVS+KAAVKFKPQ+ I +GCHPYPAV   G  +GGLK  G     C 
Sbjct  3    HDQVQPFKQPDPVTVSEKAAVKFKPQIHITNGCHPYPAVTWWGETSGGLKTKGAPSAGCK  62

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS  GSQ+Y RS WV  VWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDNP 
Sbjct  63   GSGWGSQVYGRSTWVKGVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWIDNPD  115

Query  144  SKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDTGE  199
             +N  IL V+ SA  GY+ Q PP A  VDG SVK++Y      NH L ST+     + GE
Sbjct  116  IENPKILAVTPSAHSGYSKQVPPSADCVDGTSVKVKYESKWPINHALESTT-----EGGE  170

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             QDLI W++LS+ A  ++N   W +          P  DG FQ  LDKAWPF
Sbjct  171  TQDLIMWNQLSENALRAMNSVTWGDA-------NCPFCDGNFQAKLDKAWPF  215

>PHYRA_71404
Length=245

 Score = 225 bits (574),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 143/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PFPQP PVT+S+KA VKFKPQL I +GCH YPAV   G  +GGLK +G     
Sbjct  31   IDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSAG  90

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +  +       GHRH+WE+VIVWIDN
Sbjct  91   CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPSTGI-------GHRHDWEHVIVWIDN  143

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P  +N  IL V+ SA  GY    PP A  +DG + K+  Y +H     +L  + + G+FQ
Sbjct  144  PDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDFQ  202

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+LS+ AR +LN         +     +P+ DG FQ  L +AWPF
Sbjct  203  DLIMWDQLSENARRALNSV-------NFGNANVPMNDGNFQAKLGRAWPF  245

>PHYKE_4438
Length=339

 Score = 228 bits (582),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 149/234 (64%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H +V+PFPQP+P+T+S++AAVKFKPQL I++GCH YPAV   G  +GGLK +G   G+
Sbjct  124  ISHSEVQPFPQPEPITISERAAVKFKPQLHISNGCHAYPAVNGAGETSGGLKTTGAPSGK  183

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +  L       GHRH+WE+VI+WI+N
Sbjct  184  CKGSGYGSQVYGRSGWHKDVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIIWINN  236

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P+  +  IL V+ SA  GY++  PP A  +DG + K+ Y      NH LG     +T   
Sbjct  237  PEVADPKILAVTPSAHSGYSTYAPPPADSMDGVAAKVNYESFWPVNHALG-----MTTKG  291

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDLI WD+L+  AR +LN  +W           +P+ DG F   LDKAWPF
Sbjct  292  GDFQDLIMWDQLTDNARRALNEVNW-------GAANVPMNDGNFGGKLDKAWPF  338

>PPTG_15224
Length=246

 Score = 225 bits (574),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 149/230 (65%), Gaps = 8/230 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF + KP T S+KAAVK+KP++ ++ GCHPYPAVQ DGS++ GLK +GP DGE
Sbjct  24   INHDQVQPFDELKPTTDSEKAAVKYKPKVYVSYGCHPYPAVQADGSVSAGLKGTGPIDGE  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS+W    WAIMYAWY PKG  A   P        RH WE  +VWID+
Sbjct  84   CGGSDLGSQVYSRSSWYKGKWAIMYAWYLPKG-WAYRSP-------RRHFWETAVVWIDD  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   NS+ILGV++++ +      P E  YVDG SV+LE           L+ T  +GE Q
Sbjct  136  PSPTNSSILGVTLNSGLRRKKYVPVERQYVDGSSVQLESCKGRGRPRPMLRFTTISGESQ  195

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W++L+  ARY+L + ++D   F      MPLKD  F++ L+ AWPF
Sbjct  196  DLIMWEQLTDKARYALANAEFDTGFFKKKRRNMPLKDDRFEKGLEDAWPF  245

>PPTG_17409
Length=235

 Score = 224 bits (572),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 146/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+KAAVKFKPQL I +GCHPYPAV   G   GGLK +G   G 
Sbjct  21   IDHDQVQPFAQPEPVTISEKAAVKFKPQLHITNGCHPYPAVNAAGDTGGGLKPTGAPSGS  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +  L       GHRH+WE V++WI+N
Sbjct  81   CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSSSL-------GHRHDWENVVIWINN  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   N  IL +  SA  GY+   PP+A  +DG S K+  Y +H   + +   T + G+FQ
Sbjct  134  PDVPNPVILAICPSAHGGYSRYAPPDADTIDGTSAKVN-YESHWPINHATDTTSEGGDFQ  192

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+L+  AR +L  TD+ +         +P+K+G F   L+KAWPF
Sbjct  193  DLIMWDQLTDAARTALQDTDFGDA-------NVPMKEGSFLSNLEKAWPF  235

>PHYRA_72433
Length=245

 Score = 225 bits (573),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 143/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PFPQP PVT+S+KA VKFKPQL I +GCH YPAV   G  +GGLK +G     
Sbjct  31   IDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSAG  90

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +  +       GHRH+WE+VIVWIDN
Sbjct  91   CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPSTGI-------GHRHDWEHVIVWIDN  143

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P  +N  IL V+ SA  GY    PP A  +DG + K+  Y +H     +L  + + G+FQ
Sbjct  144  PDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDFQ  202

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+LS+ AR +LN         +     +P+ DG FQ  L +AWPF
Sbjct  203  DLIMWDQLSENARRALNSV-------NFGNANVPMNDGNFQAKLGRAWPF  245

>PHYCA_11951
Length=234

 Score = 223 bits (568),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 143/227 (63%), Gaps = 15/227 (7%)

Query  23   GHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGEC  82
            GHDQV PF QP P ++S   AV FKPQL I +GCHPYPAV  DG+ +GGL  +G     C
Sbjct  21   GHDQVVPFAQPTPTSISQTTAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPAGSSSAGC  80

Query  83   TGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNP  142
             GS  GSQIY RSAW N VWAIMY+WYFPK          +  FGHRH+WE+++VW+DNP
Sbjct  81   KGSGYGSQIYGRSAWYNGVWAIMYSWYFPKDS-------PSSGFGHRHDWEHIVVWLDNP  133

Query  143  KSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQD  202
               +  IL VS SA  GY    PP + Y++G S K++ YY+ LL + + ++T D GE Q+
Sbjct  134  AVASPKILAVSTSAHSGYTVYYPPNSNYLNGKSAKID-YYSILLINHAFRMTSDAGETQN  192

Query  203  LITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            LI WD+++  AR +L +TD+ +         +P KDG F+  L  AW
Sbjct  193  LIMWDQMTDAARTALQNTDFGDA-------NVPFKDGNFESKLANAW  232

>PPTG_15233
Length=235

 Score = 223 bits (567),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 142/228 (62%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF QP P +VS  AA  FKPQL I +GCHPYPAV  DG+ +GGL  +G     
Sbjct  21   IDHDQVVPFAQPTPTSVSQIAAFNFKPQLHITNGCHPYPAVDTDGNTSGGLNPTGSSSAG  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIY RS W N VWAIMY+WYFPK   A         FGHRH+WE+++VW++N
Sbjct  81   CKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA-------SGFGHRHDWEHIVVWLNN  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   +  IL VS SA  GY    PP + Y+DG+S K++ YY+ LL + S ++T D+GE Q
Sbjct  134  PAVTSPEILAVSTSAHSGYTVYYPPSSDYLDGNSAKID-YYSVLLINHSFRMTSDSGETQ  192

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  AR +L  TD+ +         +P KD  F+  L  AW
Sbjct  193  DLIMWDQLTDAARTALEDTDFGDA-------NVPFKDANFETKLANAW  233

>PHYRA_72438
Length=236

 Score = 222 bits (566),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 151/249 (61%), Gaps = 15/249 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R +L+     L      VI HD V PF QP P +VS  AAV FKPQL I +GCHPYP
Sbjct  1    MNLRGLLVSAAVGLTAIYGAVIDHDTVVPFAQPTPTSVSQVAAVNFKPQLHITNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV  DG+ +GGL  +G     C GS  GSQIY RS W N VWAIMY+WYFPK   A    
Sbjct  61   AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA----  116

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                 FGHRH+WE+++VW++NP   +  IL VS SA  GY    PP++ Y+DG+S K++ 
Sbjct  117  ---SGFGHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPPDSDYLDGNSAKID-  172

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
            YY+ LL + + ++T DTGE QDLI WD+L+  AR +L  TD+ +         +P KD  
Sbjct  173  YYSVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDTN  225

Query  241  FQELLDKAW  249
            F+  L  AW
Sbjct  226  FETKLANAW  234

>PHYSO_259736
Length=231

 Score = 221 bits (563),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 147/230 (64%), Gaps = 22/230 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF Q +PV  SDKAA+KFKP+L+I+ GCHPYPAVQ DG+++ GLKW G  DG+
Sbjct  24   INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W    WAI+                      HRH W Y+++WIDN
Sbjct  84   CKGSGLGSQVYSRSDWYQGKWAII----------------------HRHLWLYLVLWIDN  121

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P++ N  ILGV +  A G   + PP+A ++DG S+K+EYY +   G T +QLTE+ GEFQ
Sbjct  122  PEAANPAILGVWLRTAGGNEQRVPPDAKFIDGSSLKVEYYKSSWHGKTGIQLTENPGEFQ  181

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DL+TW+++++ AR +L   ++D    +   L +P  DG F   L+KAW F
Sbjct  182  DLVTWEQMTEEARIALTEANFDGHWQERKDLDVPFIDGEFTVNLEKAWIF  231

>PPTG_08017
Length=616

 Score = 232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 152/234 (65%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V PF QP+PVT+++KAA+KFKPQL I +GCH YPAV   G  +GGLK +G     
Sbjct  400  IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHITNGCHAYPAVNVGGQTSGGLKTTGAPSAG  459

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  460  CKGSGWGSQVYGRSTWHNGVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWIDN  512

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P+     IL V+ SA  GY++Q PP+A  VDG+SVK++Y      NH L ST      + 
Sbjct  513  PEIAEPKILAVTPSAHSGYSAQVPPDANKVDGNSVKVKYLSKWPINHALESTG-----EA  567

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G++QDLI W++L+  AR +L +T + +         +P+KDG F   LDKAWPF
Sbjct  568  GDYQDLIMWEQLTDAARLALQNTGFGKA-------NVPMKDGNFVSKLDKAWPF  614

>PHYRA_71308
Length=236

 Score = 221 bits (563),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 150/249 (60%), Gaps = 15/249 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R +L+     L      VI HD V PF QP P +VS  AAV FKPQL I +GCHPYP
Sbjct  1    MNLRGLLVSAAVGLTAIYGAVIDHDTVVPFAQPTPTSVSQIAAVNFKPQLHITNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV  DG+ +GGL  +G     C GS  GSQIY RS W N VWAIMY+WYFPK   A    
Sbjct  61   AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA----  116

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                 FGHRH+WE+++VW++NP   +  IL VS SA  GY    PP+  Y+DG+S K++ 
Sbjct  117  ---SGFGHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPPDLDYLDGNSAKID-  172

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
            YY+ LL + + ++T DTGE QDLI WD+L+  AR +L  TD+ +         +P KD  
Sbjct  173  YYSVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDTN  225

Query  241  FQELLDKAW  249
            F+  L  AW
Sbjct  226  FETKLANAW  234

>PPTG_17245
Length=257

 Score = 221 bits (563),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 156/237 (66%), Gaps = 11/237 (5%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF + +P T S+K+A+K+KPQL I+ GC+PYPAVQ +G+I+GGLKWSG  + +
Sbjct  24   INHDQVQPFEEMEPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C     GSQIY+RS W    WAIMYAWYFPK  GA       R  GHRH W   IVW DN
Sbjct  84   CEKPVQGSQIYSRSDWYKGKWAIMYAWYFPK--GAFRASKYNR--GHRHFWSSAIVWTDN  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVD-GDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
                NSTILGVSMS + GY  +  P+  Y++ G ++KL+ Y    L + +L+LT+ +G  
Sbjct  140  TNPDNSTILGVSMSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGT  199

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDL------AGLKMPLKDGVFQELLDKAWPF  251
            QDL+TW++L+  AR +L+  D+D    D       A + MPL+DGVF  +L++++PF
Sbjct  200  QDLVTWEQLTDEARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  256

>PYVX_22467
Length=236

 Score = 220 bits (560),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 155/249 (62%), Gaps = 15/249 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R +L   VA LAGA A VI HDQV PF QP   + S KAAVKFKPQL I+DGCHPYP
Sbjct  1    MNLRYLLAAAVALLAGACASVIDHDQVVPFAQPTATSTSHKAAVKFKPQLHISDGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV   G+ +GGLK SG     C GS  GSQIY RS W N VWAIMY+WYFPK   +  L 
Sbjct  61   AVDSSGNTSGGLKPSGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPSTGL-  119

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH+WE+V+VWI NP   + T+  VS SA  GY+   PP + Y+DG+S K++ 
Sbjct  120  ------GHRHDWEHVVVWISNPAVDSPTVYAVSTSAHSGYSIYYPPSSSYMDGNSAKID-  172

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
            Y+  ++ + + ++T   GE QDLI WD+++  AR +L +TD+ +         +P KDG 
Sbjct  173  YFKIVVINHAFRMTSSAGETQDLIMWDQMTDAARIALENTDFGDA-------NVPFKDGN  225

Query  241  FQELLDKAW  249
            F   L  AW
Sbjct  226  FMTKLASAW  234

>PPTG_06973
Length=165

 Score = 217 bits (552),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 127/166 (77%), Gaps = 3/166 (2%)

Query  86   KLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKSK  145
            +L SQ+YAR+ WV D WAIMYAW+FPK R   P   + R  GHRH WEY IVW+D P + 
Sbjct  3    RLDSQVYARTTWVKDKWAIMYAWFFPKARAPFP---VLRFLGHRHGWEYAIVWLDKPNAD  59

Query  146  NSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLIT  205
            NSTILGVS+SAA G+A + PP   Y+DG+S+K+ YYYNH+ G+T+++ T++TGEFQDLIT
Sbjct  60   NSTILGVSVSAAAGWAKEAPPPEKYLDGNSLKVAYYYNHIYGNTAVKYTDETGEFQDLIT  119

Query  206  WDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            W++LS LAR  LN+TDWDET  + A LKMP+KDGVF + L  A+PF
Sbjct  120  WNQLSDLARSYLNNTDWDETPLNAALLKMPMKDGVFMKKLKSAYPF  165

>PHYCA_9358
Length=252

 Score = 219 bits (559),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 153/240 (64%), Gaps = 29/240 (12%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V PF QP+PVT+++KAA+KFKPQL I++GCH YPAV   G  +GGLK +G     
Sbjct  31   IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHISNGCHAYPAVNIGGQTSGGLKTTGAPSAG  90

Query  82   CTGSKLGSQIYARSAW------VNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYV  135
            C GS  GSQ+Y RS W       N +WAIMY+WYFPK   +  L       GHRH+WE+V
Sbjct  91   CKGSGWGSQVYGRSTWHNVPSPHNGIWAIMYSWYFPKDSPSTGL-------GHRHDWEHV  143

Query  136  IVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSL  191
            IVWIDNP+     IL V+ SA  GY++Q PP+A  V+G SVK+ Y      NH LGST+ 
Sbjct  144  IVWIDNPEIAEPKILAVTPSAHSGYSAQVPPDADKVEGTSVKVNYESKWPINHALGSTT-  202

Query  192  QLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
                  G++QDLI W++L+  AR +L +TD+ +         +P+KDG F   L+KAWPF
Sbjct  203  ----KGGDYQDLIMWEQLTDAARLALENTDFGKA-------NVPMKDGNFVGKLNKAWPF  251

>PPTG_18464
Length=247

 Score = 219 bits (559),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 159/231 (69%), Gaps = 8/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+K+AVK+KPQL I+ GCHPY AVQ DGS++GGL  SG  +G+
Sbjct  24   INHDQVQPFSQPEPTTDSEKSAVKYKPQLHISYGCHPYAAVQADGSVSGGLNRSGWANGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
              GS LGSQ+Y+RS W    WAI+YAWY+PKG    P+   T   G RH W Y++VW D+
Sbjct  84   RKGSDLGSQVYSRSDWYRGKWAIVYAWYYPKG----PVFTETGPPGQRHFWSYIVVWTDS  139

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYV-DGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            PK  +STI GV++   VGY  Q PP+  ++ +  +VK+E Y N    + ++QLT+++GE 
Sbjct  140  PKPNHSTIQGVTIPTEVGYEMQVPPKEDFIFEQATVKVESYLNS--ENQAVQLTDESGEI  197

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITW++L+  AR +L+  D++   +    + MPLKD VF  +L++A+PF
Sbjct  198  QDLITWEQLTDQARATLSEFDFN-IKWAYVDMVMPLKDDVFSTILEEAFPF  247

>PHYRA_72345
Length=240

 Score = 218 bits (555),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 156/251 (62%), Gaps = 14/251 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R +  V++ASLA  Q  VIGHDQV PFPQ +P ++++ AA+ FKPQ+ I +GCHPYP
Sbjct  1    MNLRALTTVVLASLASVQGAVIGHDQVVPFPQSQPTSITNTAALLFKPQIWINNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
             V  +G   GGLK +G     C GS  GSQ+Y RSAW N VWAIMY+WYFPK        
Sbjct  61   VVNANGDTGGGLKTTGSSAAGCRGSGYGSQVYGRSAWYNGVWAIMYSWYFPKDE------  114

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH+WE+V+VWIDNP++ N  IL ++ SA  GY++  PP+A  VDG S K+EY
Sbjct  115  -PQDFTGHRHDWEHVVVWIDNPQNTNPKILAMTPSAHSGYSTYAPPDADMVDGTSCKVEY  173

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
              + L     L+ T   GE QDLI W +++  ARY+LN T++ +          P+ DG 
Sbjct  174  TSSWLFIDHHLEGTSTAGETQDLIMWGDMTDAARYALNTTNFGKA-------NTPMNDGN  226

Query  241  FQELLDKAWPF  251
            F   L KA+P+
Sbjct  227  FLPKLGKAYPW  237

>PHYSO_406265
Length=232

 Score = 218 bits (554),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 148/234 (63%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V PF QP+PVT+S++AAVKFKPQL I++GCH YPAV + G  +GGLK +G    +
Sbjct  18   IGHDEVVPFKQPEPVTISERAAVKFKPQLHISNGCHAYPAVNELGETSGGLKKTGAPSSK  77

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  78   CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSSGL-------GHRHDWEHVIVWIDN  130

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P      IL V+ SA  GY++Q PP+A  VDG SVK+ Y      NH L ST+       
Sbjct  131  PDMPEPKILAVTPSAHSGYSAQVPPDADKVDGPSVKVNYESKWPINHALESTT-----KG  185

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G++QDLI W +++  AR +L++T       +     +P+  G F   L KAWPF
Sbjct  186  GDYQDLIMWTQMTDAARQALDNT-------NFGSANVPMNSGNFLGKLGKAWPF  232

>PHYKE_5753
Length=238

 Score = 217 bits (552),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 143/229 (62%), Gaps = 14/229 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF Q    ++++  A+KFKPQ+ I +GCHPYPAV  +G  +GGLK SG +   
Sbjct  22   ISHDQVIPFAQSAATSITNTVALKFKPQIFINNGCHPYPAVNGNGDTSGGLKPSGSESAG  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N+VWAIMY+WYFPK      +       GHRH+WE+V+VWIDN
Sbjct  82   CKGSGYGSQVYGRSTWYNNVWAIMYSWYFPKDNPVTGM-------GHRHDWEHVVVWIDN  134

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P  +N TIL V+ SA  GY++  PP+   VDG S K++Y  + ++ +  L  T   GEFQ
Sbjct  135  PAMENPTILAVTPSAHSGYSTYAPPDPSTVDGASAKVQYTSSWIVINHHLDTTSTAGEFQ  194

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWP  250
            DLI W +L+  AR +LN  D++          +P+KDG F+  L  A+P
Sbjct  195  DLIMWGDLTDAARNALNTADFEAA-------NVPMKDGNFESKLGNAYP  236

>PPTG_19330
Length=316

 Score = 219 bits (558),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 141/234 (60%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PFPQP+PVT+S+KAAVKFKPQL I +GCH YPAV + G  +GGLK  G     
Sbjct  102  IDHDQVKPFPQPQPVTISEKAAVKFKPQLHITNGCHSYPAVDEAGQTSGGLKTKGAPSAG  161

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS+W   VWAIMY WYFPK   +  +       GHRH+WE+VIVWIDN
Sbjct  162  CKGSGWGSQVYGRSSWYQGVWAIMYCWYFPKDEPSTGI-------GHRHDWEHVIVWIDN  214

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P+  N  IL V+ SA  GY    PP    +DG + K+ Y      +H LGSTS     + 
Sbjct  215  PEIANPKILAVTPSAHSGYHKYAPPNPDTIDGATTKVAYESHWPMDHALGSTS-----EA  269

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDLI W +LS+ A  +LN   W            P+ DG F   L KAWPF
Sbjct  270  GDFQDLIMWGQLSENASRALNAVYW-------GNANTPMNDGNFLPKLAKAWPF  316

>PHYKE_7564
Length=473

 Score = 224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 147/230 (64%), Gaps = 14/230 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PFPQ    ++++ AA+K+KPQ+ I +GCHPYPAV  +G  +GGLK  G     
Sbjct  257  IDHDQVQPFPQSAATSLTNTAALKYKPQIFINNGCHPYPAVNANGDTSGGLKTHGSGSAG  316

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK      +       GHRH+WE+VIVWIDN
Sbjct  317  CRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDSPVSGM-------GHRHDWEHVIVWIDN  369

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P++ N TIL ++ SA  GY++  PP A  VDG SVK+EY   +L+ +  L+ T   GE Q
Sbjct  370  PENVNGTILAMTPSAHSGYSTYAPPPADMVDGASVKVEYTSTYLVINHHLEGTSTAGEMQ  429

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W +++  ARY+LN T       D     +P+KDG F   L+KA+P+
Sbjct  430  DLIMWGDMTDAARYALNTT-------DFGNANVPMKDGNFLPKLEKAYPW  472

 Score = 205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 128/197 (65%), Gaps = 7/197 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PFPQ   +++++ AA+KFKPQ+ I +GCHPYPAV  +G  +GGLK  G     
Sbjct  22   INHDQVQPFPQSTAISLTNTAALKFKPQIWINNGCHPYPAVNANGDTSGGLKTHGSSSAG  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK              GHRH+WE+V+VWIDN
Sbjct  82   CRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDE-------PQDFTGHRHDWEHVVVWIDN  134

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P++ N  IL ++ SA  GY++  PP+A  +DG SVK+EY  + L     L+ T   GE Q
Sbjct  135  PQNVNPRILAMTPSAHSGYSTYAPPDADMIDGTSVKVEYTSSWLFIDHHLEGTSTAGEMQ  194

Query  202  DLITWDELSKLARYSLN  218
            DLI W +++  AR SLN
Sbjct  195  DLIMWSDMTDAARNSLN  211

>PHALS_06162
Length=488

 Score = 223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 148/232 (64%), Gaps = 23/232 (10%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HD+V PF QPKPVTV++ AAVKFKPQ+ I +GCHPYPAV   G I+GGLK SG  D  C 
Sbjct  269  HDKVVPFKQPKPVTVAEHAAVKFKPQINIVNGCHPYPAVNATGEISGGLKASGSSDAGCK  328

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS+ GSQ+Y RS W   +WAIMY+WYFPK   A P      L GHRH+WE++IVWIDNP 
Sbjct  329  GSEYGSQVYGRSTWHRGLWAIMYSWYFPKDT-AFP------LLGHRHDWEHIIVWIDNPS  381

Query  144  SKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDTGE  199
                 IL V+ SA   Y  Q+PP    V+G SVK++Y      NH L ST+      +GE
Sbjct  382  LYKPRILAVASSAHSWYTVQSPPHTDRVNGTSVKVKYAGIWPLNHALTSTT-----KSGE  436

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            +QDLI W++L++ AR SL   +     F +A   +P++DG F + LD AW F
Sbjct  437  YQDLIMWEQLTEAARQSLQQAN-----FGMA--NVPMRDGNFLDKLDTAWSF  481

>PHYSO_527352
Length=245

 Score = 216 bits (549),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 158/254 (62%), Gaps = 15/254 (6%)

Query  1    MNFR--IvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHP  58
            MNFR  +   +    +  ++ ++IGHDQV+PF QP+P T S+K+AVK+KPQL I+ GCHP
Sbjct  1    MNFRAFLFAAIASLVVVKSEVKMIGHDQVQPFAQPEPTTESEKSAVKYKPQLHISYGCHP  60

Query  59   YPAVQKDGSITGGLKWS--GPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGA  116
            YPAVQ DGS+ GGLKW+     D +C GS LGSQ+Y+RS W    WAI+YAWYFPKGR  
Sbjct  61   YPAVQADGSVNGGLKWTFWSWADSDCKGSGLGSQVYSRSDWHRGKWAIVYAWYFPKGRD-  119

Query  117  VPLPLITRLF--GHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGD  174
                     F  GHRH W Y I+W D+P    STILGVS+       S  P     +DG 
Sbjct  120  -----FEHSFKRGHRHYWLYAILWTDSPNPDTSTILGVSVPNGFRDKSAAPDAQFVIDGK  174

Query  175  SVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKM  234
            ++K + Y +   G   L LTE TG+ QDLITW++L++ AR +L++ ++D     +    +
Sbjct  175  TIKFDSYRSFTTGRQDLGLTEKTGDTQDLITWEQLTEEARTALSNMNFDGPRQKIV---V  231

Query  235  PLKDGVFQELLDKA  248
            P+KDG F E L +A
Sbjct  232  PMKDGDFAERLARA  245

>PHYRA_71931
Length=239

 Score = 215 bits (548),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 141/228 (62%), Gaps = 15/228 (7%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HDQV+PF QP+P T+S+KA VKFKPQ+ I +GCHPYPAV  +G   GGLK +G     C 
Sbjct  25   HDQVQPFAQPEPATISEKAGVKFKPQIHITNGCHPYPAVNWNGDTGGGLKPTGAPSSSCK  84

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS  GSQ+Y RS W N VWAIMY+WYFPK   +  L       GHRH+WE+V+VWI NP 
Sbjct  85   GSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVVVWITNPD  137

Query  144  SKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDL  203
             +N  IL VS SA  GY+    P A  +DG +VK+  Y +H   + +L +T + G+ QDL
Sbjct  138  VENPVILAVSPSAHSGYSYYVSPSADTIDGTAVKVN-YESHWPINHALDITTEGGDTQDL  196

Query  204  ITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            I WD+++  AR SLN               +P+ DG FQ  L KAWP+
Sbjct  197  IMWDQMTDAARNSLN-------TVSFGDANVPMNDGNFQNKLGKAWPW  237

>PHYSO_414520
Length=213

 Score = 214 bits (545),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 143/232 (62%), Gaps = 23/232 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PFPQP+PVT+S+KAA+KFKPQ++IA GC PYPAV   G  +GGL+ SG   G 
Sbjct  1    INHDAVKPFPQPEPVTISEKAAIKFKPQIRIATGCVPYPAVNDVGETSGGLQTSGSPKGG  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y R+ W NDVWAIMY+WYFPK          +   GHRH+WE+V+VWI+N
Sbjct  61   CRGSGHGSQVYGRAGWFNDVWAIMYSWYFPKDS-------PSSRMGHRHDWEHVVVWINN  113

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYY----NHLLGSTSLQLTEDT  197
            P      ILG+S SA  GY   + P    +DG+SVK+ Y +    NH     +L  T+  
Sbjct  114  PDVPEPKILGISASAHSGYKKYSSPPPENLDGNSVKVNYEHAWPINH-----ALDTTDKA  168

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            G FQDLI W+++++ AR +LN                P+ DG F+  L++AW
Sbjct  169  GTFQDLIMWEQMTEDARRALN-------AVHFGKANTPMNDGNFRHKLERAW  213

>PHYRA_52423
Length=193

 Score = 213 bits (542),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 134/201 (67%), Gaps = 8/201 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF +P+P T S+KAAVKFKPQL +  GC+PYPAVQ DGS++ GL+ SGP DGE
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR           +  RH WE  +VWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRPTK--------YQRRHFWETAVVWIDD  112

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   NSTILGVS++       +TP    ++DG SVKL  Y  +      LQ T+  GEFQ
Sbjct  113  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSYRGYGFPKPRLQFTQIDGEFQ  172

Query  202  DLITWDELSKLARYSLNHTDW  222
            DLITW++L++ AR +L+  D+
Sbjct  173  DLITWEQLTEEARDALSTADF  193

>PYU1_G011231
Length=238

 Score = 214 bits (546),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 146/232 (63%), Gaps = 23/232 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF +P P ++S+KAA+KFKPQ+ I++GCHPYPAV   G+ +GGLK SG Q   
Sbjct  24   ISHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  G+Q+Y RSAW N  WAIMY+WYFPK      L       GHRH+WE+V+VWIDN
Sbjct  84   CKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFTGL-------GHRHDWEHVVVWIDN  136

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY----YYNHLLGSTSLQLTEDT  197
            P + N TIL VS SA  GY    PP+A  VDG S K++Y      NH L ST+       
Sbjct  137  PANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVDYTSKIVINHALDSTTA-----A  191

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            GE Q LI W+++++ AR +L +T + +         +P+KDG F + L KA+
Sbjct  192  GEKQPLIMWEQMTQAARTALENTGFGDA-------NVPMKDGNFMDKLAKAY  236

>PYU1_G011237
Length=235

 Score = 214 bits (545),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 145/232 (63%), Gaps = 23/232 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF +P P ++S+KAA+KFKPQ+ I++GCHPYPAV   G+ +GGLK SG Q   
Sbjct  21   IDHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  G+Q+Y RSAW N  WAIMY+WYFPK      L       GHRH+WE+V+VWIDN
Sbjct  81   CKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFTGL-------GHRHDWEHVVVWIDN  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY----YYNHLLGSTSLQLTEDT  197
            P + N TIL VS SA  GY    PP+A  VDG S K++Y      NH L ST+       
Sbjct  134  PANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVDYSSTIVINHALDSTTT-----A  188

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            GE Q LI W+++++ AR +L +TD+ +         +P+KDG F   L  A+
Sbjct  189  GEKQPLIMWEQMTQAARTALENTDFGDA-------NVPMKDGNFMTKLANAY  233

>PPTG_07660
Length=216

 Score = 212 bits (540),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 149/219 (68%), Gaps = 6/219 (3%)

Query  34   KPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYA  93
            +P T S+K+A+K+KPQL I+ GCHPYPAVQ +GSI+GGLKWSG  +G+C    LGSQ+Y+
Sbjct  2    EPTTDSEKSAIKYKPQLHISYGCHPYPAVQANGSISGGLKWSGKTNGDCEQPNLGSQVYS  61

Query  94   RSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVS  153
            RS W    WAIMYAWY PK      L   T   GHRH W Y +VW D+P   NSTILGVS
Sbjct  62   RSDWYKGKWAIMYAWYLPKA-AQFMLKFDT---GHRHFWLYSMVWTDSPNPDNSTILGVS  117

Query  154  MSAAVGYASQTPPEAMYVD-GDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKL  212
            MS + GY  +  P+  Y++ G ++KLE Y    +G  +L+LT+ +GE QDL+TW++L+  
Sbjct  118  MSGSRGYVKKPSPKTKYIEKGTTIKLESYVGFWMGVQALRLTKKSGETQDLVTWEQLTDE  177

Query  213  ARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            AR +L+  D+ E+   ++ + MPLKD VF+ +L  ++PF
Sbjct  178  ARDALSEFDF-ESDPSISMVVMPLKDDVFRSILKDSYPF  215

>PHYSO_468315
Length=255

 Score = 213 bits (543),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 138/230 (60%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+ VT+S+KAAVKFKPQL I +GCH YPAV + G  +GGLK  G     
Sbjct  39   IDHDQVKPFAQPESVTISEKAAVKFKPQLHITNGCHAYPAVDEAGQTSGGLKTKGAPSAG  98

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W  DVWAIMY WYFPK   +  +       GHRH+WE+V+VWIDN
Sbjct  99   CKGSGWGSQVYGRSGWYQDVWAIMYCWYFPKDEPSSGI-------GHRHDWEHVVVWIDN  151

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P  +N  IL  + SA  GY    PP A  VDG + K+  + +H     +L  T + G+FQ
Sbjct  152  PDVENPKILAGTPSAHSGYHKYAPPNAGTVDGVTTKVA-FESHWPMDHALDSTTEGGDFQ  210

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+L+  AR +LN                P+ DG FQ  L +AWPF
Sbjct  211  DLIMWDQLTDNARRALNS-------VSFGSADTPMNDGNFQAELGRAWPF  253

>PITG_22668
Length=519

 Score = 221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 145/234 (62%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V PF Q +PVT+S+KAAVKFKPQL I  GCHPYPAV   G  +GGLK SG     
Sbjct  304  IDHDAVVPFKQTEPVTISEKAAVKFKPQLHITGGCHPYPAVNAIGQTSGGLKTSGAPSAG  363

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  364  CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWIDN  416

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P+     IL VS SA  GY++Q PP+A  V+G SVK++Y      NH L ST      + 
Sbjct  417  PELAEPKILAVSPSAHGGYSAQVPPDANKVEGTSVKVKYLSKWPINHALESTG-----EG  471

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G++QDLI W +++  AR  L+ T + +         +P+ DG F+  L +AWPF
Sbjct  472  GDYQDLIMWGQMTDAAREGLSRTGFGKA-------NVPMNDGNFESKLGRAWPF  518

>PHYSO_254112
Length=224

 Score = 211 bits (537),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 142/228 (62%), Gaps = 28/228 (12%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+P T S+ AAVKFKP L+++ GC PYPAV  +GS++  LKW+G  DG+
Sbjct  24   INHDQVQPFAQPEPATDSETAAVKFKPFLEVSYGCEPYPAVSANGSVSASLKWTGKNDGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKG-RGAVPLPLITRLFGHRHNWEYVIVWID  140
            C GS LGSQ+Y+RS W  D WA+MYAWYFPKG +GA  +        HRH W + +VWID
Sbjct  84   CEGSALGSQVYSRSDWYKDKWAMMYAWYFPKGWQGASTV-------SHRHLWLHAVVWID  136

Query  141  NPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            NP   NSTIL VS          TP          VKL+           L+LT D GE 
Sbjct  137  NPALDNSTILAVS----------TP----------VKLDASRGFWASKMLLKLTTDKGES  176

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            QDLITWD++++ AR +L+  ++D+ LF     K+P KDGVF + L KA
Sbjct  177  QDLITWDQMTEEARTALSEANFDKHLFKRKNTKVPFKDGVFTDKLKKA  224

>PPTG_08005
Length=759

 Score = 225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 147/234 (63%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V PF QP+PVT+S+KAA+KFKPQL I +GCH YPAV   G  +GGLK SG     
Sbjct  544  IDHDAVVPFKQPEPVTISEKAAIKFKPQLHITNGCHAYPAVNAIGETSGGLKTSGAPSAG  603

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  604  CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWIDN  656

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P+     IL V+ SA  GY++Q PP+A  VDG SVK++Y      NH L ST      + 
Sbjct  657  PEIAEPKILAVTPSAHSGYSAQVPPDANKVDGTSVKVKYLSKWPINHALESTG-----EG  711

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G++QDLI W +++  AR +L+ T + +         +P+ DG F+  L KAWPF
Sbjct  712  GDYQDLIMWGQMTDAAREALSRTSFGDA-------NVPMNDGNFEPKLGKAWPF  758

>PHYCA_18373
Length=246

 Score = 211 bits (538),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 138/211 (65%), Gaps = 13/211 (6%)

Query  41   KAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVND  100
            KAAVKFKPQL I+ GCHPYPAVQ DG ++ GLK +GP DGEC GS LGSQIYARS W   
Sbjct  49   KAAVKFKPQLHISYGCHPYPAVQADGVVSAGLKPTGPDDGECQGSSLGSQIYARSDWYKG  108

Query  101  VWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGY  160
            V+AIMY WY PKG  +            RH WE V+VWID+P + NSTILGVS++  +  
Sbjct  109  VYAIMYTWYLPKGSAS------------RHFWESVVVWIDDPAASNSTILGVSLNYGLQL  156

Query  161  ASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHT  220
              +T  +  Y+ G S+KL+ +    + +  L+LTE  GEFQDL+T+D+L+  A  +L+H 
Sbjct  157  KKETNIDPKYLSGSSLKLDSFPGFAINNPKLRLTELDGEFQDLVTFDQLTDAAGIALSHA  216

Query  221  DWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            ++ + L   A   MPL DGVF E L  AWPF
Sbjct  217  EFSKGLIK-AKTPMPLIDGVFNERLKDAWPF  246

>PHYSO_249751
Length=238

 Score = 211 bits (536),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 155/250 (62%), Gaps = 14/250 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R +  V  ASL   +A VIGHDQV PFPQ    + ++ AA+KFK Q+ I +GCHPYP
Sbjct  1    MNLRAIAAVTAASLISVEAGVIGHDQVVPFPQSAATSAANIAALKFKLQIFINNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV   G  +GGLK SG  +  C GS  GSQ+Y RS   N+  AIMY+WYFPK      L 
Sbjct  61   AVNAAGDTSGGLKPSGSVNAGCKGSGYGSQVYGRSTLYNNKHAIMYSWYFPKDNPVTGL-  119

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH+WE+VIVWIDNP S N+TIL ++ SA  GY++  PP A  VDG SVK+EY
Sbjct  120  ------GHRHDWEHVIVWIDNPASSNATILAMTPSAHSGYSTYAPPPATMVDGTSVKVEY  173

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
              + ++ +  L+ T   GE Q+LI W++++  ARY+LN TD+           +P+KDG 
Sbjct  174  TSSKVVINHHLEGTSTAGETQNLIMWEDMTDAARYALNTTDFGSA-------NVPMKDGN  226

Query  241  FQELLDKAWP  250
            F   L KA+P
Sbjct  227  FISKLGKAYP  236

>PHYKE_4946
Length=263

 Score = 211 bits (538),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 149/230 (65%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H  V+PF QP+P+T+S+KAAVKFKPQL I  GC  YPAV   G  +GGL+ SG   G 
Sbjct  49   IPHKDVKPFIQPEPITISEKAAVKFKPQLAILSGCVSYPAVNDIGETSGGLQESGSPKGG  108

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W +DVWAIMY+WYFPK   +      +RL GHRH+WE+V+VWIDN
Sbjct  109  CRGSGHGSQVYGRSVWYSDVWAIMYSWYFPKDSPS------SRL-GHRHDWEHVVVWIDN  161

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P+     IL VS S   G+    PP A  +DG SVK++Y ++  L + +L +T+  G+FQ
Sbjct  162  PEVLEPKILAVSPSYHSGHKKYAPPSADVIDGTSVKVKYEHSWPL-NHALDVTDKAGDFQ  220

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+++ LAR +LN     ET F  A +  P+ D  F   L++AWPF
Sbjct  221  DLIMWDQMTDLARVALN-----ETKFGKANV--PMNDHNFLRKLEQAWPF  263

>PHYSO_510888
Length=255

 Score = 211 bits (536),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 141/230 (61%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PFPQP PVT+S+KAAVKFKPQ+ I  GC PYPAV   G  +GGL+ SG   G 
Sbjct  40   IGHDEVKPFPQPDPVTISEKAAVKFKPQIDIVTGCVPYPAVNDAGETSGGLQTSGSPRGG  99

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W+N VWAIMY+WYFPK          +   GHRH+WE+V+V+IDN
Sbjct  100  CRGSGHGSQVYGRSTWINGVWAIMYSWYFPKD-------APSSKMGHRHDWEHVVVFIDN  152

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      ILG S S   GY    P  A  +DG SVK++Y ++  L + +L+ T   G FQ
Sbjct  153  PDVPEPKILGCSPSWHNGYNKYAPCPANVIDGTSVKVKYEHSWPL-NHALETTTKPGAFQ  211

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W++++  AR +LN T              P+ D  F   ++KAWPF
Sbjct  212  DLIMWNQMTDFARRALNDT-------KFGKANTPMNDWNFLPKVEKAWPF  254

>PHYRA_74617
Length=337

 Score = 213 bits (542),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 143/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+SDKA VKFKPQ++I  GC+PYPAV + G + GGLK SG   G 
Sbjct  123  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKTSGKSRGN  182

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK     P P +    GHRH+WE+ +V+IDN
Sbjct  183  CAGSGHGSQVYGRSTWHNQVWAIMYSWYFPKDS---PSPGM----GHRHDWEHAVVFIDN  235

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      ILG S+S+  GY    P     +DG S+K+ Y ++  + +  L  T D G FQ
Sbjct  236  PDVPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGIFQ  294

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W +++  AR +LN         +      P+ DG F   ++K+WPF
Sbjct  295  DLIMWGQMTDNARRALNEA-------NFGSANTPMNDGNFYSKVEKSWPF  337

>PHYSO_334487
Length=258

 Score = 210 bits (534),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/251 (47%), Positives = 146/251 (58%), Gaps = 14/251 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R +    +ASLA     +IGHDQV PFPQ +P T+S+KAA+KFKPQL I +GCHPYP
Sbjct  1    MNLRALAADTLASLASVSGGIIGHDQVVPFPQSQPTTISNKAALKFKPQLWINNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
             V   G   GGLK  G     C  S  GSQ+Y RS W N VWAIMY WYFPK        
Sbjct  61   VVNAAGDTGGGLKTHGSSAAGCRCSGYGSQVYGRSTWYNGVWAIMYCWYFPKDE------  114

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH+WE+VIVWIDNP  +N  I+ ++ SA  GY++   P A  VDG S K+EY
Sbjct  115  -PQDGTGHRHDWEHVIVWIDNPDVENPKIMAMTPSAHSGYSTYALPPADMVDGTSCKVEY  173

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
              + L     L+ T   GEFQDLI W +L+  AR +LN T + +          P+ DG 
Sbjct  174  TSSWLFIDHHLEGTSTAGEFQDLIMWSDLTDGARLALNTTSFGKA-------NTPMNDGN  226

Query  241  FQELLDKAWPF  251
            F   + KA+P+
Sbjct  227  FLPKIQKAYPW  237

>PHYSO_397673
Length=224

 Score = 209 bits (531),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 140/230 (61%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+PVT+S+KA VKFKPQ++I +GCHPYPAV + G  +GGLK +G  + +
Sbjct  10   IPHDKVQPFAQPEPVTISEKAGVKFKPQIRIINGCHPYPAVNEAGETSGGLKTTGGHNSK  69

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
               S   SQ+Y RS W   VWAIMY+WYFPK   +  L       GHRH+WE+VIVWIDN
Sbjct  70   SKRSGWNSQVYGRSTWFRGVWAIMYSWYFPKDSPSHGL-------GHRHDWEHVIVWIDN  122

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P +    IL V+ SA   Y    PP A  VDG S K+  Y +H   +  L +T D+GEFQ
Sbjct  123  PDASEPKILAVTPSAHGDYQKYAPPNANTVDGTSAKV-VYESHWPMNHELSVTSDSGEFQ  181

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W ++S+ AR + N                P+ D  F++ L KAWPF
Sbjct  182  DLIMWSQMSENARRAFNSV-------SFGKANTPMNDWGFEDRLGKAWPF  224

>PPTG_12847
Length=331

 Score = 212 bits (540),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 142/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+S+KA VKFKPQ++I  GC PYPAV + G  +GGL+ SG   G 
Sbjct  115  IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGG  174

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK          +   GHRH+WE+ IV+IDN
Sbjct  175  CRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDS-------PSSRMGHRHDWEHAIVFIDN  227

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P+     IL  S+S+  GY   +P     +DG S+K+ Y +   L +  L  T D G FQ
Sbjct  228  PEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  286

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD++S  AR +LN   + +          P  DG F+  L+KAWPF
Sbjct  287  DLIMWDQMSNDARRALNSVHFGKA-------NTPFNDGNFRPKLEKAWPF  329

>PHYRA_71618
Length=243

 Score = 209 bits (532),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 150/235 (64%), Gaps = 20/235 (9%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP PVTVS+KAAV+FKP L+I  GCHPYPAV   G  + GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W  V+VW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVWLDN  136

Query  142  PKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYY---NHLLGSTSLQLTEDT  197
            P  +  T++GVS S+ V  Y+  TPP A  ++G +  + Y     NH  G  S+  T  T
Sbjct  137  PALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNH--GFHSVDTTWKT  194

Query  198  -GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             GEFQDLI W++L+  AR +LN TD+ E         +P  D  F+  L+KAWP+
Sbjct  195  GGEFQDLIMWEQLTDEARAALNDTDFGEHAL------VPFIDANFKANLEKAWPY  243

>PHYCA_108409
Length=282

 Score = 210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 138/230 (60%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PFP+PKPVTVS+KA VKFKPQ++I  GC PYPAV + G  +GGLK +G   G 
Sbjct  68   IGHDEVKPFPEPKPVTVSEKAGVKFKPQIQIRTGCVPYPAVDETGQTSGGLKPTGNSKGG  127

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y R  W+  VW IMY+WYFPK   +  +       GHRH+WE+ IV+IDN
Sbjct  128  CRGSGHGSQVYGRGTWIQGVWGIMYSWYFPKDSPSTGM-------GHRHDWEHAIVFIDN  180

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      IL  S+S+  GY    P     +DG S+K+ Y +   L +  L  T D G FQ
Sbjct  181  PDVPEPKILACSVSSHAGYKKYNPCPPWVIDGTSLKVRYKHGWPL-NHDLDTTGDAGTFQ  239

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD++++ AR +LN                P  DG F+  L+KAWPF
Sbjct  240  DLIMWDQMTEDARRALNS-------VHFGSANTPFNDGNFKPKLEKAWPF  282

>PPTG_12853
Length=342

 Score = 212 bits (540),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 142/230 (62%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+S+KA VKFKPQ++I  GC PYPAV + G  +GGL+ SG   G 
Sbjct  126  IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGG  185

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK          +   GHRH+WE+ IV+IDN
Sbjct  186  CRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDS-------PSSRMGHRHDWEHAIVFIDN  238

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P+     IL  S+S+  GY   +P     +DG S+K+ Y +   L +  L  T D G FQ
Sbjct  239  PEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  297

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD++S  AR +LN   + +          P  DG F+  L+KAWPF
Sbjct  298  DLIMWDQMSNDARRALNSVHFGKA-------NTPFNDGNFRPKLEKAWPF  340

>PHYCA_118356
Length=252

 Score = 209 bits (532),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 142/231 (61%), Gaps = 9/231 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PF QP P    ++AAVK+KP+L ++ GCHPYPAVQ +GS++ GL+ SGP DGE
Sbjct  24   MDHDKVKPFAQPIPTNSFEEAAVKYKPELFVSYGCHPYPAVQANGSVSAGLEGSGPDDGE  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS+LGSQ+Y+RS W ND WAIMY WY PKGR              RH WE  ++WID+
Sbjct  84   CKGSRLGSQVYSRSDWYNDKWAIMYTWYLPKGRSGK--------LQDRHFWETAVIWIDD  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSV-KLEYYYNHLLGSTSLQLTEDTGEF  200
            P  ++S +LGVS++      S+   +  +++   V K E Y         L+ TE  G+ 
Sbjct  136  PTLEDSKLLGVSLNYEDRRVSKIAIKGRHLNASKVLKFESYEAEKSPKPRLRFTEKAGKT  195

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITWD+L   AR  L+ T +  + F     +MPLKD VF + L  AWPF
Sbjct  196  QDLITWDQLPAKARKGLSTTKFYSSPFGSVKREMPLKDEVFLKRLKDAWPF  246

>PPTG_12852
Length=331

 Score = 212 bits (539),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 144/234 (62%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD V+PFPQP+PVT+S+KA VKFKPQ++I  GC PYPAV + G  +GGLK SG   G 
Sbjct  117  IGHDDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETSGGLKTSGKSRGN  176

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK     P P +    GHRH+WEYV+V+I+N
Sbjct  177  CGGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDS---PSPGM----GHRHDWEYVVVFINN  229

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYY----NHLLGSTSLQLTEDT  197
            P+ +   IL  S+++  GY    P     +DG S+K+ Y +    NH      L  T D 
Sbjct  230  PEVQEPKILACSVASHGGYKKFNPCPPWVIDGTSLKVRYKHAWPMNH-----DLDTTGDG  284

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G FQDLI WD+++  AR +LN   + +          P  DG F++ L+ AWPF
Sbjct  285  GSFQDLIMWDQMTNDARRALNSVSFGKA-------NTPFIDGRFRKKLEDAWPF  331

>PHYRA_71588
Length=242

 Score = 209 bits (531),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 147/233 (63%), Gaps = 16/233 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PF QP PVT+S+K AV+FKP L+I +GCH YPAV   G    GLK +G   G+
Sbjct  23   IGHDKVQPFAQPDPVTISEKTAVRFKPILRIDNGCHSYPAVNAAGETNAGLKGTGRPSGD  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y RS W  D+WAIMYAWYFPK      +P++ +  G RH+W  V+VW+DN
Sbjct  83   CKGSSLGSQVYGRSVWHGDLWAIMYAWYFPKD-----MPILGK--GKRHDWANVVVWLDN  135

Query  142  PKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYYNHL-LGSTSLQLT-EDTG  198
            P  +  TI+GVS SA V  YA  TPP A  + G +  + Y  + L  G  +L +  E  G
Sbjct  136  PAHERPTIIGVSPSAYVTTYAKYTPPPANRLTGLTSMISYLADDLNYGYHTLDMNWEAGG  195

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            EFQDL+ W++L+  AR +LN TD+ E         +P  D  F+  L+KAWP+
Sbjct  196  EFQDLVMWEQLTDEARAALNDTDFGENAL------VPFIDANFKANLEKAWPY  242

>PYU1_G011233
Length=239

 Score = 208 bits (530),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 141/228 (62%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF +P P T+++K A+KFKPQ+ I +GCHPYPAV   G++ GGLK  G Q   
Sbjct  24   IDHDQVKPFAEPAPTTLAEKLAIKFKPQIFINNGCHPYPAVDAAGNVGGGLKPDGSQSAG  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  G+Q+Y R+A  NDV+AIMY+WY PK     P+P I    GHRH+WE V+VWIDN
Sbjct  84   CKGSGWGTQVYGRAAPYNDVYAIMYSWYMPKD---TPIPGI----GHRHDWENVVVWIDN  136

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P + N  IL VS SA  GY    PP+A  VDG S K+ Y   +L+   SL  T   GE Q
Sbjct  137  PNAANPKILAVSPSAHSGYEKYAPPKAGTVDGTSAKVIYSTTNLVMDHSLDSTTHAGEQQ  196

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
             LI W++L+  AR +L         +D     +P+KDG F + L K++
Sbjct  197  PLIMWEQLTDAARSTLQD-------YDFGNANVPMKDGNFMDKLGKSY  237

>PPTG_07089
Length=255

 Score = 209 bits (531),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 146/230 (63%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H +V+PF +PKPVT+S+KA VKFKPQ+ +  GC PYPAV +DG  +GGL+ SG   G 
Sbjct  39   ISHKEVKPFAEPKPVTISEKAGVKFKPQIAVKTGCVPYPAVNEDGETSGGLQTSGSPQGG  98

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N +WAIMY+WYFPK          +   GHRH+WE+++V+IDN
Sbjct  99   CRGSGHGSQVYGRSTWFNGLWAIMYSWYFPKD-------APSSRMGHRHDWEHIVVFIDN  151

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P+     ILG S S   GY    P  A  +DG SVK++Y ++  L + +L +T++ G+FQ
Sbjct  152  PEVPEPKILGCSPSWHSGYNKYAPCPADVIDGSSVKVKYEHSWPL-NHALDITKEAGDFQ  210

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD++S LAR +LN T + +          P+ D  F   ++K+WPF
Sbjct  211  DLIMWDQMSDLARRALNDTKFGKA-------NTPMNDWNFLGKVEKSWPF  253

>PPTG_13736
Length=236

 Score = 208 bits (529),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 149/251 (59%), Gaps = 15/251 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R  ++ +VA+LA      + HDQVRPF QP PV+VS+KAAVKFKPQL I +GCHPYP
Sbjct  1    MNLRAFIVSIVAALAATDVIALSHDQVRPFGQPSPVSVSEKAAVKFKPQLHITNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV   G  +GGL  SG     C GS  GSQ+Y RS W    WAIMY+WYFPK   +  L 
Sbjct  61   AVNAAGETSGGLAKSGAPSAGCKGSGWGSQVYGRSTWHKGRWAIMYSWYFPKDSPSTGL-  119

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH+WE+VIVWIDNP   N  IL V+ SA  GY+   PP+A  V G++ K+  
Sbjct  120  ------GHRHDWEHVIVWIDNPDVANPKILAVTPSAHSGYSKYAPPKAGTVSGNTAKIN-  172

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
            Y +H   + +L  T+  GE Q LI WD+++  AR SLN   + +         +P+ DG 
Sbjct  173  YESHWPVNHALDSTDKGGETQPLIMWDQMTDAARRSLNTVSFGDA-------NVPMNDGN  225

Query  241  FQELLDKAWPF  251
            F   +  A P+
Sbjct  226  FLRKIGNASPW  236

>PPTG_13769
Length=349

 Score = 211 bits (538),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 139/234 (59%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H  V+PFPQP+PVT+S+KA VKFKPQ++I  GC PYPAV + G  +GGL  SG   G+
Sbjct  134  IAHKDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEFGETSGGLHTSGKSRGK  193

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RSAW+  VW IMY+WYFPK          +   GHRH+WE  IV+IDN
Sbjct  194  CGGSGHGSQVYGRSAWLKGVWVIMYSWYFPKDS-------PSHGLGHRHDWEEAIVFIDN  246

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYY----NHLLGSTSLQLTEDT  197
            P      ILG S+S+  GYA   P     +DG S+K+ Y +    NH      L +T D 
Sbjct  247  PDVSEPKILGCSVSSHGGYARHAPCPPWVIDGTSLKVRYKHSWPKNH-----DLAITGDG  301

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDLI W +++  AR +LN                P KDG FQ+ ++KAWPF
Sbjct  302  GKFQDLIMWGQMTNDARRALN-------AVSFGSANTPFKDGTFQDKIEKAWPF  348

>PHYCA_69480
Length=213

 Score = 206 bits (525),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 140/228 (61%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+S+KA VKFKPQ++I  GC PYPAV   G  +GGL+ SG   G 
Sbjct  1    IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK          +   GHRH+WE+ IV+IDN
Sbjct  61   CRGSGHGSQVYGRSTWIQGVWAIMYSWYFPKDS-------PSSRMGHRHDWEHAIVFIDN  113

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      IL  S+S+  GY    P     +DG S+KL Y ++  + +  L  T D+G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKLRYKHSWPI-NHDLDTTGDSGTFQ  172

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD++++ AR +LN   + +          P  DG F+  L+KAW
Sbjct  173  DLIMWDQMTEDARRALNSVSFGKA-------NTPFNDGSFKPKLEKAW  213

>PYIR_13251
Length=236

 Score = 207 bits (526),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 153/253 (60%), Gaps = 23/253 (9%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            M F++++   +ASLA   A  I HD V PF QP PVT+  K A+KFKPQ+ I++GCHPYP
Sbjct  1    MMFKVLIASALASLAAVNAASIAHDAVVPFAQPTPVTLEQKVALKFKPQIHISNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV   G+ +GGLK SG Q   C GS  G+Q+Y R+A   DV+A+MY+WYFPK      L 
Sbjct  61   AVDAAGNTSGGLKPSGSQSAGCKGSGWGTQVYGRAAAYKDVYALMYSWYFPKDSPFTGL-  119

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH+WE+V+VWIDNP   N TIL V+ SA  GY    PP+A  VDG S K++Y
Sbjct  120  ------GHRHDWEHVVVWIDNPAVANPTILAVTPSAHSGYEKYAPPKAGTVDGTSAKVDY  173

Query  181  ----YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPL  236
                  NH L ST+     D GE Q LI WD+L+  AR +L +T++ +         +P+
Sbjct  174  TSKVVINHALDSTT-----DAGEKQPLIMWDQLTAAARSALENTNFGDA-------NVPM  221

Query  237  KDGVFQELLDKAW  249
            KDG F   L  A+
Sbjct  222  KDGNFMTKLGNAY  234

>PHYCA_119748
Length=261

 Score = 207 bits (527),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 140/234 (60%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHDQV+PFPQP+PVT+S+KA VKFKPQ++I  GC PYPAV + G   GGLK +G   G 
Sbjct  47   IGHDQVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETGGGLKTTGKSRGN  106

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W   VWAIMY+WYFPK     P P +    GHRH+WE+ IV+IDN
Sbjct  107  CGGSGYGSQVYGRSTWYQGVWAIMYSWYFPKDS---PSPKM----GHRHDWEHAIVFIDN  159

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDT  197
            P+     IL  S+S+  GY    P     +DG S+K+ Y     YNH      L  T D 
Sbjct  160  PEVSEPKILACSVSSHSGYTKYNPCPPWVIDGTSLKVRYKHAWPYNH-----DLDATGDG  214

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDLI W++L++ AR +LN   + +          P  D  F   ++ AWPF
Sbjct  215  GKFQDLIMWNQLTEDARRALNSVSFGKA-------NTPFSDDKFMPKIENAWPF  261

>PYU1_G011235
Length=238

 Score = 206 bits (524),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 143/232 (62%), Gaps = 23/232 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF +P P + S+K AVKFKPQ+ I++GCHPYPAV   G+ +GGLK SG Q   
Sbjct  24   INHDQVVPFAEPTPSSASEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  G+Q+Y R A   D WAIMY+WYFPK         IT L GHRH+WE+V+VWIDN
Sbjct  84   CKGSGWGTQVYGRVASYKDKWAIMYSWYFPKDS------PITGL-GHRHDWEHVVVWIDN  136

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY----YYNHLLGSTSLQLTEDT  197
            PK+ N  IL +S SA  GY    PP+A  VDG S K++Y      NH L ST+       
Sbjct  137  PKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVDYTSKIVINHALDSTTA-----A  191

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            GE Q LI W++++  AR +L +TD+ +         +P+KDG F   L KA+
Sbjct  192  GEKQPLIMWEQMTDAARSALENTDFGKA-------NVPMKDGNFMNKLAKAY  236

>PPTG_07661
Length=223

 Score = 205 bits (521),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 147/225 (65%), Gaps = 11/225 (5%)

Query  34   KPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYA  93
            +P T S+K+A+K+KPQL I+ GC+PYPAVQ +G+I+GGLKWSG  + +C     GSQIY+
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  94   RSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVS  153
            RS W    WAIMYAWYFPK  GA       R  GHRH W   IVW DN    NSTILGVS
Sbjct  62   RSDWYKGKWAIMYAWYFPK--GAFRASKYNR--GHRHFWSSAIVWTDNTNPDNSTILGVS  117

Query  154  MSAAVGYASQTPPEAMYVD-GDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKL  212
            MS + GY  +  P+  Y++ G ++KL+ Y    L + +L+LT+ +G  QDL+TW++L+  
Sbjct  118  MSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDE  177

Query  213  ARYSLNHTDWDETLFDL------AGLKMPLKDGVFQELLDKAWPF  251
            AR +L+  D+D    D       A + MPL+DGVF  +L++++PF
Sbjct  178  ARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  222

>HYAP_09243
Length=266

 Score = 206 bits (524),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 143/229 (62%), Gaps = 15/229 (7%)

Query  23   GHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGEC  82
            GHD + PF +PKPVT+S+KA VKFKP L +  GC PY AV  +G  +GGL+ SG  +  C
Sbjct  46   GHDAIVPFSEPKPVTISEKAGVKFKPLLDVNTGCAPYAAVNAEGETSGGLQTSGDPESGC  105

Query  83   TGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNP  142
             GSK GSQ+Y RS W NDVWAIMYAWYFPK       P++  L GHRH+WE V+V+I++P
Sbjct  106  RGSKYGSQVYGRSTWYNDVWAIMYAWYFPKDS-----PML--LMGHRHDWENVVVFINDP  158

Query  143  KSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQD  202
                 TILG S S   GY    P     ++G SV ++Y ++  L + +L +T+D G +QD
Sbjct  159  DEVEPTILGCSTSWHSGYIKYAPCPTDSINGSSVMIKYEHSFPL-NHALNITKDAGAYQD  217

Query  203  LITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            LI W ++  LAR +LN TD+ + +        P+ D  F E ++ AWPF
Sbjct  218  LIMWHQMPDLARRALNDTDFGKAI-------TPMNDLNFMEKIEAAWPF  259

>PYIR_13252
Length=236

 Score = 205 bits (521),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/253 (44%), Positives = 151/253 (60%), Gaps = 23/253 (9%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            M F++++   + +LA   A  I HD V+PF +P P T + + A+KFKPQ+ I++GC PYP
Sbjct  1    MMFKVIIASALVALATVNAASIAHDAVKPFAEPNPTTTTHRVALKFKPQINISNGCSPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV   G+ +GGLK SG Q   C GS  G+Q+Y R+A   D + IMY+WYFPK       P
Sbjct  61   AVDSAGNTSGGLKPSGSQSAGCKGSGWGTQVYGRAAQYKDAYGIMYSWYFPKDS-----P  115

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
            L     GHRH+WE+V+VWIDNP + N  IL VS SA  GY+   PP+A  VDG S K++Y
Sbjct  116  LTG--LGHRHDWEHVVVWIDNPNAANPKILAVSPSAHSGYSKYAPPKAGTVDGTSAKVDY  173

Query  181  ----YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPL  236
                  NH L ST+     D GE Q LI WD+L+  AR +L +T++ +         +P+
Sbjct  174  TSKVVINHALDSTT-----DAGEQQPLIMWDQLTAAARSALENTNFGDA-------NVPM  221

Query  237  KDGVFQELLDKAW  249
            KDG F   L  A+
Sbjct  222  KDGNFMNKLANAY  234

>PHYRA_74630
Length=343

 Score = 207 bits (528),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 140/230 (61%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PFPQP+PVT+SDKA VKFKPQ++I  GC+PYPAV + G + GGLK +G   G+
Sbjct  129  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKPTGKSRGK  188

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VW IMY+WYFPK     P P +    GHRH+WE+ +V+IDN
Sbjct  189  CAGSGHGSQVYGRSTWHNSVWVIMYSWYFPKDS---PSPGL----GHRHDWEHAVVFIDN  241

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      IL  S+S+  GY    P     +DG S+K+ Y ++  + +  L  T D G FQ
Sbjct  242  PDVPEPKILACSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGTFQ  300

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W +++  AR +LN         +      P+ DG F   +  AWPF
Sbjct  301  DLIMWGQMTDNARRALNEA-------NFGSANTPMNDGNFPNKVQAAWPF  343

>PHYRA_72475
Length=243

 Score = 204 bits (518),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 150/235 (64%), Gaps = 20/235 (9%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+KAAV+FKP L+I  GCHPYPAV   G  +GGLK +G   G+
Sbjct  24   IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDTGCHPYPAVNAAGETSGGLKGTGMPSGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P  ++  G RH+W  V+VW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDQ-----PTFSK--GKRHDWANVVVWLDN  136

Query  142  PKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYY---NHLLGSTSLQLTEDT  197
            P  +  TI+GVS S+ V  Y+  TPP A  + G +  + Y     NH  G  S+  T  T
Sbjct  137  PALERPTIIGVSPSSYVTTYSKYTPPPADGLSGTTSMINYLADANNH--GFHSVDTTWKT  194

Query  198  -GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             GEFQDLI W++L+  AR + N TD+ E         +P  D  F+  L+KAWP+
Sbjct  195  GGEFQDLIMWEQLTDEARGAFNDTDFGEH------APVPFIDPNFKANLEKAWPY  243

>PITG_22916
Length=248

 Score = 204 bits (518),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 139/230 (60%), Gaps = 5/230 (2%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQVRPF QP   T  +KAAVK+KPQL I DGCHPYPAV++DG+I+ GL+WSG  +G 
Sbjct  23   IDHDQVRPFAQPNAATTKEKAAVKYKPQLYIEDGCHPYPAVEEDGTISAGLEWSGDHNGH  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C  S  GSQ+Y+R     D +AIMYAWYFPKG+G            HRH+WE+ I+W D 
Sbjct  83   CKKSPRGSQVYSRGGSYKDKYAIMYAWYFPKGKGHSR----KHHDEHRHDWEFGIIWFDR  138

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
                +S+I GV+ +       + P + ++V G  +KLE Y         L+LT+  G+ Q
Sbjct  139  DSDTDSSIAGVTTNIGRDLHDEVPLQPVHVVGSHIKLESYSTFWSAKQGLRLTKKKGDIQ  198

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W++L K A+ +LN  D+D T      + +P  D  FQE +  ++PF
Sbjct  199  DLIQWEQLPKAAQTALNDADFD-TDKAKTPVVVPFNDNYFQEKVAASYPF  247

>PPTG_19506
Length=223

 Score = 203 bits (516),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 147/225 (65%), Gaps = 11/225 (5%)

Query  34   KPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYA  93
            +P T S+K+A+K+KPQL I+ GC+PYPAVQ +G+I+GGLKWSG  + +C     GSQIY+
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  94   RSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVS  153
            RS W    WAIMYAWYFPK  GA       R  GHRH W   IVW DN    NSTILGVS
Sbjct  62   RSDWYKGKWAIMYAWYFPK--GAFRASKYNR--GHRHFWSSAIVWTDNTNPDNSTILGVS  117

Query  154  MSAAVGYASQTPPEAMYVD-GDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKL  212
            MS + GY  +  P+  Y++ G ++KL+ Y    L + +L+LT+ +G  QDL+TW++L+  
Sbjct  118  MSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDE  177

Query  213  ARYSLNHTDWDETLFDL------AGLKMPLKDGVFQELLDKAWPF  251
            AR +L+  D+D    D       A + +PL+DGVF  +L++++PF
Sbjct  178  ARDALSKFDFDADTSDAIFFSSGATVVIPLEDGVFTSILEESYPF  222

>PITG_08522
Length=382

 Score = 207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 139/230 (60%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD V+ FPQP+PVT+S+KA VKFKPQ++I  GC PYP V + G  +GGL+ SG   G 
Sbjct  126  IGHDDVKLFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPVVNELGETSGGLQTSGNSRGG  185

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK          +   GHRH+WE+ IV+IDN
Sbjct  186  CRGSGHGSQVYGRSTWMEGVWAIMYSWYFPKD-------FPSSRMGHRHDWEHAIVFIDN  238

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P+     IL  S+S+  GY    P  +  +DG S+K+ Y +   L +  L  T D G FQ
Sbjct  239  PEVAEPKILACSVSSHDGYKKYNPCPSYVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  297

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD++S  AR +LN   + +          P  DG F+  L+KAWPF
Sbjct  298  DLIMWDQMSNDARRALNSVHFGKA-------NTPFNDGNFRPKLEKAWPF  340

>PHYSO_334498
Length=229

 Score = 202 bits (515),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 132/217 (61%), Gaps = 15/217 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF QP+PVT+S+KAAVKFKPQL I++GCHPYPAV + G   GGL  +G   G+
Sbjct  25   ISHDQVAPFAQPEPVTISEKAAVKFKPQLHISNGCHPYPAVNEAGDTDGGLSNTGAPSGK  84

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y RS W  DVW IMYAWYFPK   +  L       GHRH+WE+ ++WIDN
Sbjct  85   CKGSGLGSQVYGRSGWHKDVWTIMYAWYFPKDMASFDL-------GHRHDWEHAVIWIDN  137

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      ILGVS S+  GY   T   A  ++G SV L Y     +    L+ T   GE+Q
Sbjct  138  PDVAEPKILGVSASSHAGYEKVTTIPAGSLNGTSVLLNYESTWPV-DHELRFTTKGGEYQ  196

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKD  238
             LI W +L+  AR SL+ TD+   L       MP+ D
Sbjct  197  PLIMWTQLTDAARVSLSTTDFGSAL-------MPMTD  226

>PHYCA_69477
Length=213

 Score = 202 bits (513),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 139/228 (61%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PF QP+PVT+S+KA VKFKPQ++I  GC PYPAV   G  +GGL+ SG   G 
Sbjct  1    IGHDEVKPFAQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK          +   GHRH+WE+ IV+IDN
Sbjct  61   CRGSGHGSQVYGRSTWMQGVWAIMYSWYFPKDS-------PSSRMGHRHDWEHAIVFIDN  113

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      IL  S+S+  GY    P     +DG S+K+ Y ++  + +  L  T D G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDAGTFQ  172

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD++++ AR +LN   + + +        P  DG F+  L+KAW
Sbjct  173  DLIMWDQMTEDARRALNSVSFGKAM-------TPFNDGSFKPKLEKAW  213

>PHYRA_72165
Length=240

 Score = 202 bits (515),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 144/234 (62%), Gaps = 22/234 (9%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+KAAV+FKP L+I  GCHPYPAV   G    GLK +GP  G+
Sbjct  23   IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGPSSGD  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P      G RH+W  V+VW+DN
Sbjct  83   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFGE--GGRHDWANVVVWLDN  135

Query  142  PKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDT---  197
            P  +  TI+GVS S+ V  Y   TPP A  + G +  + Y  + +  +      + T   
Sbjct  136  PAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLADDM--NNGFHTVDTTWLP  193

Query  198  -GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWP  250
             GEFQDLI W++L+  AR +L+ TD+        G  +P  D  F+  L+KAWP
Sbjct  194  GGEFQDLIMWEQLTDEARAALSDTDF--------GALVPFIDANFKANLEKAWP  239

>PYU1_G011230
Length=238

 Score = 201 bits (512),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 143/232 (62%), Gaps = 23/232 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF +P P +  +K AVKFKPQ+ I++GCHPYPAV   G+ +GGLK SG Q   
Sbjct  24   ISHDQVVPFAEPTPSSAYEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  G+Q+Y R A  N V+ +MY+WYFPK         IT L GHRH+WE+V+VWIDN
Sbjct  84   CKGSGWGTQVYGRGAAYNGVYGLMYSWYFPKDS------PITGL-GHRHDWEHVVVWIDN  136

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY----YYNHLLGSTSLQLTEDT  197
            PK+ N  IL +S SA  GY    PP+A  VDG S K++Y      NH L ST+       
Sbjct  137  PKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVDYTSKIVINHALDSTTA-----A  191

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            GE Q LI W+++++ AR +L +T + +         +P+KDG F + L KA+
Sbjct  192  GEKQPLIMWEQMTQAARTALENTGFGDA-------NVPMKDGNFMDKLAKAY  236

>PHYKE_5655
Length=243

 Score = 201 bits (512),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 151/235 (64%), Gaps = 18/235 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PFPQP PVTVS+K AVKFKP L+I  GCH YPAV     I+GGLK +G  DG+
Sbjct  22   IGHDKVQPFPQPDPVTVSEKTAVKFKPSLRIDSGCHSYPAVNAACEISGGLKGTGSDDGD  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQ+Y R+ W ND+WAIMY+WYFPK      +P+     G RH+W  V+VW+++
Sbjct  82   CTGSSLGSQVYGRAVWYNDLWAIMYSWYFPKD-----MPVAIFKKGRRHDWVNVVVWLND  136

Query  142  PKSKNSTILGVSMSAAVGYASQ-TPPEAMYVDGDSVKLEYY---YNHLLGSTSLQLTEDT  197
            P ++   +LGVS S+ V   S+ TPP    ++G S  + Y    Y+H  G  ++  T + 
Sbjct  137  PAAEKPIMLGVSPSSYVSSYSKYTPPPVDGLNGMSCMINYLSNPYDH--GYHTVDTTRNR  194

Query  198  -GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             GEFQDL+ W++L+  AR SLN T + ET       ++P  D  F   L+KAWP+
Sbjct  195  GGEFQDLVMWEQLTDAARISLNETAFGET------AQVPFIDENFVANLEKAWPY  243

>PHYRA_46230
Length=212

 Score = 200 bits (509),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 139/227 (61%), Gaps = 15/227 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H +V+PF QP P T+S+KA VKFKPQ++I  GC PYPAV   G  +GGLK SG   G 
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGG  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RSAW+NDVWAIMY+WYFPK   +  +       GHRH+WE+V+V+IDN
Sbjct  61   CRGSGHGSQVYGRSAWLNDVWAIMYSWYFPKDSPSSGM-------GHRHDWEHVVVFIDN  113

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      I+G S S+  GY    P     +DG SVK+ Y ++  + +  L +T D G FQ
Sbjct  114  PDVAEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQ  172

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            DLI WD++++ AR +LN   + +          P+ DG F   L+KA
Sbjct  173  DLIMWDQMTEDARRALNGVHFGDA-------NTPMNDGNFIPKLEKA  212

>PPTG_07277
Length=298

 Score = 203 bits (516),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 142/234 (61%), Gaps = 23/234 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+++PFPQP PVT+S+KA VKFKPQ++I  GC PYP V + G  +GGL+ SG   G 
Sbjct  84   IGHDEIKPFPQPDPVTISEKAGVKFKPQIQIRTGCVPYPVVNEFGETSGGLQTSGSPRGG  143

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RSAW+N  WAIMY+WYFPK   +      +R+ GHRH+WE+ +V+IDN
Sbjct  144  CRGSVHGSQVYGRSAWINGFWAIMYSWYFPKDSPS------SRM-GHRHDWEFAVVFIDN  196

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYY----NHLLGSTSLQLTEDT  197
            P      I+G S+S+  G     P  +  +DG+S+K+ Y +    NH      L +T D 
Sbjct  197  PGIPEPKIIGCSVSSHDGRKKYNPCPSWVIDGNSLKVRYKHAWPMNH-----DLDVTGDA  251

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G FQDLI WD+++  AR +LN   + +          P  DG F   L+ AW F
Sbjct  252  GTFQDLIMWDQMTDDARRALNSVSFGKA-------NTPFNDGKFLPTLESAWAF  298

>PITG_22734
Length=168

 Score = 198 bits (503),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 8/153 (5%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PF QP P+T S K+AVK+KPQL I+ GCHPYPAV+ +GS +GGL+WSGP DG+
Sbjct  24   VNHDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEYV+VW D+
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWADS  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGD  174
              S NS+I GVSMSA VG+A  TPP   Y+ G 
Sbjct  136  STSTNSSIQGVSMSAGVGHAKATPPMLKYIHGS  168

>PHYRA_54327
Length=219

 Score = 199 bits (507),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 140/228 (61%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H  V+PFPQP+P+T+S+KA VKFKPQ++I  GC PYPAV + G  +GGL+ SG   G 
Sbjct  7    ISHKDVKPFPQPEPITISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGG  66

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   A  +       GHRH+WE+V+V+IDN
Sbjct  67   CRGSGHGSQVYGRSTWYNQVWAIMYSWYFPKDSPASGM-------GHRHDWEHVVVFIDN  119

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      ILG S+S+  GY    P     +DG SVK+ Y ++  L +  L  T D G FQ
Sbjct  120  PDLPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSVKVRYKHSWPL-NHDLDTTGDGGTFQ  178

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI W++++  AR +LN     ET F  A    P+ D  F   ++K+W
Sbjct  179  DLIMWNQMTDNARRALN-----ETKFGKA--NTPMNDWNFHSKVEKSW  219

>PHYKE_7566
Length=260

 Score = 201 bits (511),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 140/228 (61%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF QP   T    A +KFKPQ+ I++GCHPYPAV KDG+ +GGLK +G     
Sbjct  45   ISHDQVVPFAQPTATTTLQAAGIKFKPQIHISNGCHPYPAVNKDGNTSGGLKPTGSASAG  104

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIY R      V+AIMY+WYFPK         IT L GHRH+WE+VIVW+D+
Sbjct  105  CKGSGYGSQIYGRITTYQGVYAIMYSWYFPKDS------PITGL-GHRHDWEHVIVWVDD  157

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
                N +I+ VS SA  GY    PP++  +DG S K++Y  ++L+ + +L  T D GE Q
Sbjct  158  ITLTNPSIVAVSPSAHSGYNIYYPPKSGTIDGYSAKVDYSSSYLVVNHALDSTSDAGETQ  217

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  AR +L +TD+ +         +P+KD  FQ  L  A+
Sbjct  218  DLIMWDQLTDAARTALENTDFGDA-------NVPMKDANFQAKLGNAY  258

>PYIW_25259
Length=246

 Score = 200 bits (508),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 138/241 (57%), Gaps = 32/241 (13%)

Query  22   IGHDQVRPFPQPKPVTV---------SDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGL  72
            I HD V PF QP PVT+         S  AA+KFKPQ+ I++GCHPYPAV   G+  GGL
Sbjct  23   IAHDAVVPFAQPAPVTLEQTPAPTSLSHTAALKFKPQIHISNGCHPYPAVDAAGNTGGGL  82

Query  73   KWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNW  132
            K SG Q   C GS  G+Q+Y RS W N  WAIMY+WYFPK      L       GHRH+W
Sbjct  83   KPSGSQSAGCKGSGWGTQVYGRSTWFNGKWAIMYSWYFPKDSPFTGL-------GHRHDW  135

Query  133  EYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY----YYNHLLGS  188
            E+V+VWIDNP + N  IL V+ SA  GY    PP++  VDG+S K+EY      NH L S
Sbjct  136  EHVVVWIDNPANANPAILAVTPSAHSGYKKYAPPKSGTVDGNSAKVEYKAIIVINHALDS  195

Query  189  TSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            T+       GE Q LI WD+L+  AR  L +TD+           +P+KDG F   +  A
Sbjct  196  TTTG-----GEQQPLIMWDQLTDAARSGLENTDFGSA-------NVPMKDGNFMTKVANA  243

Query  249  W  249
            +
Sbjct  244  Y  244

>PHYRA_49009
Length=216

 Score = 199 bits (505),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 146/233 (63%), Gaps = 22/233 (9%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+KAAV+FKP L+I  GCHPYPAV   G    GLK +G   G+
Sbjct  1    IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGMPSGD  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLF--GHRHNWEYVIVWI  139
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +          +F  G RH+W  V+VW+
Sbjct  61   CKGSGLGSQVYARAVWHSDLWAIMYAWYFPKDKA---------IFGKGERHDWANVVVWL  111

Query  140  DNPKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYYNHL-LGSTSLQLTEDT  197
            DNP  +  TI+GVS S+ V  Y   TPP A  + G +  + Y  N +  G  ++  T  T
Sbjct  112  DNPAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLANDMNNGFHTVDTTWKT  171

Query  198  -GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
             GEFQDLI W++L+  AR +L++TD+        G  +P  D  F+  L+KAW
Sbjct  172  GGEFQDLIMWEQLTDEARAALSNTDF--------GALVPFIDANFKANLEKAW  216

>PHYKE_4541
Length=147

 Score = 196 bits (497),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 109/147 (74%), Gaps = 0/147 (0%)

Query  105  MYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQT  164
            MYAWYFPKGR AV +    R FGHRHNWEY IVWIDNP   +  ILGVSMSAA  Y+ + 
Sbjct  1    MYAWYFPKGREAVSMHPYARFFGHRHNWEYAIVWIDNPALDDPAILGVSMSAATSYSKRA  60

Query  165  PPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDE  224
            PP A Y+DGDS+K+EYY N ++ ST+L+LT+  GEFQDL+TWD+L   AR +L  TDWD 
Sbjct  61   PPMAKYLDGDSLKVEYYSNAVVASTALRLTKTKGEFQDLVTWDQLPDAARNALIDTDWDT  120

Query  225  TLFDLAGLKMPLKDGVFQELLDKAWPF  251
            TLF+ AG K PLKDGVF E L KA+P 
Sbjct  121  TLFNTAGAKFPLKDGVFNETLAKAYPL  147

>PPTG_22174
Length=771

 Score = 211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 152/231 (66%), Gaps = 6/231 (3%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF + +P T S+K+A+K+KPQL I+DGCHPYP VQ DGS++ GLKWSG     
Sbjct  545  IDHDEVQPFEEMEPTTDSEKSAIKYKPQLHISDGCHPYPVVQADGSVSAGLKWSGRYRSG  604

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RSAW    WAIMYAWYFPK  GA P+ +     GHRH W + IVW D+
Sbjct  605  CKGSDLGSQVYSRSAWYKGKWAIMYAWYFPK--GANPVSVFGS--GHRHYWLHAIVWTDS  660

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYV-DGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            P   NSTILG SM+        +  ++ Y+ +G S+KL+ +     G  +L+LT+ +GE 
Sbjct  661  PNPDNSTILGASMAGTTNNEKTSTVKSKYLANGTSLKLDSFVGLWTGIQALRLTKKSGET  720

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLITW++L+  AR +L+   ++ +      + MPL+D  F+ LL  ++PF
Sbjct  721  QDLITWEQLTDEARDALSDFSFESSESR-EWVVMPLRDSAFKVLLKNSYPF  770

>PPTG_15231
Length=258

 Score = 199 bits (505),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 139/228 (61%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V PF QP   T   KA VKFKPQ+ I++GCHPYPAV  +G+ +GGLK +G     
Sbjct  43   ISHDAVVPFAQPTATTTEQKAGVKFKPQIHISNGCHPYPAVDANGNTSGGLKPTGSSSAG  102

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y R A  N V+AIMY+WYFPK      L       GHRH+WE+V+VW+D+
Sbjct  103  CKGSGYGSQVYGRVATYNGVYAIMYSWYFPKDSPVTGL-------GHRHDWEHVVVWVDD  155

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
             K  + +I+ VS SA  GY    PPE+  +DG S K++Y  + ++ + +L  T D GE Q
Sbjct  156  IKLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVINHALDSTTDAGETQ  215

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  AR +L +TD+ +         +P+KDG F   +  A+
Sbjct  216  DLIMWDQLTDAARTALENTDFGDA-------NVPMKDGNFLTKVGNAY  256

>PHYSO_329114
Length=236

 Score = 196 bits (499),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 131/218 (60%), Gaps = 11/218 (5%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQVRPF QPKP TVS+KAAVKF PQ+ I +GCHPYPAV   G  +GGL+ +G     
Sbjct  23   INHDQVRPFAQPKPATVSEKAAVKFNPQIHITNGCHPYPAVNAAGETSGGLQTNGAPSAG  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W    WAIMY+WYFPK   +  L       GHRH+WE+V+VWIDN
Sbjct  83   CKGSGWGSQVYGRSTWYKGRWAIMYSWYFPKDSPSTTL-------GHRHDWEHVVVWIDN  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P   N  IL V+ SA  GY+   PP+A  V G++ K+  Y +H   + +L  T+  G+ Q
Sbjct  136  PAVANPKILAVTPSAHSGYSKYAPPKAGTVTGNTAKVN-YESHWPVNHALDSTDVGGDAQ  194

Query  202  DLITWDEL-SKLARYSLNHTDWDETLFDLAGLKMPLKD  238
            DLI W++   KL R    H  W   L D +    P+ D
Sbjct  195  DLIMWEQQHGKLRRRQCTHERWK--LHDESRKGFPVVD  230

>PYU1_G011236
Length=237

 Score = 196 bits (498),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 136/228 (60%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V PF +P P T + K  +KFKPQL I++GCHPYPAV   G+ +GGLK +G  D  
Sbjct  23   IAHDAVVPFVEPTPTTTAQKLGIKFKPQLHISNGCHPYPAVDAAGNTSGGLKPTGSSDAG  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  G+Q+Y R+A  N V+A+MY+WYFPK   +        L GHRH+WE+V+VWIDN
Sbjct  83   CKGSGYGTQVYGRAAAYNGVYALMYSWYFPKDSPST-------LLGHRHDWEHVVVWIDN  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P + +  IL VS SA  GY    PP    + G+S K++Y    +L + +  +T   GE Q
Sbjct  136  PDAASPKILAVSASAHSGYNKYHPPATTTLAGNSAKIDYKSIVVL-NHAFDMTTAAGETQ  194

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
             LI WD+++  AR +L  TD+ +         +P+KDG F   L  A+
Sbjct  195  PLIMWDQMTVAARTALETTDFGDA-------NVPMKDGNFMTKLANAY  235

>PHYCA_69479
Length=213

 Score = 194 bits (493),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 134/228 (59%), Gaps = 15/228 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H  ++PFPQP PVT+S+KA VKFKPQ++I  GC PYPAV + G  +GGLK +G   G 
Sbjct  1    ISHHDIKPFPQPVPVTISEKAGVKFKPQIQIRTGCVPYPAVNEFGETSGGLKPTGNPRGG  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK     P P +    GHRH+WE+ IV+IDN
Sbjct  61   CRGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDS---PSPGL----GHRHDWEHAIVFIDN  113

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      IL  S+S+  GY    P     +DG S+K+ Y +   + +  L  T D G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHAWPM-NHDLDTTGDGGSFQ  172

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI W+++++ AR +LN         +      P  DG F   L+ AW
Sbjct  173  DLIMWNQMTEDARRALNSV-------NFGSANTPFNDGRFMPKLENAW  213

>PHYRA_83592
Length=237

 Score = 194 bits (492),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 135/230 (59%), Gaps = 14/230 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PFPQP+PVT+S+KA VKFKP+L I +GC  YPAV   G  +GGLK +G  D  
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C    LGSQ+Y R+ W NDVWAIMYAWYFPKG          +    RH+W  V+VWIDN
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWDKCPYWRHDWSNVVVWIDN  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P  + S +LG+S+S +          A  +   +  + Y Y    GS  L    D G+FQ
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  193

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI WD+L+  AR +LN  D      +    ++P+ D  F E L+KAWPF
Sbjct  194  DLIMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPEHLEKAWPF  237

>HYAP_08306
Length=286

 Score = 195 bits (496),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 130/232 (56%), Gaps = 17/232 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            +GHD ++PFPQPKPVT  D  A+K KP+L I  GCHPYPAV   G  + GLK SG  DG 
Sbjct  58   VGHDTLQPFPQPKPVTRLDVVAIKLKPELFIVHGCHPYPAVNATGHTSNGLKTSGDADGH  117

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y R+ W    WAIMYAWYFPK              G RH+WE+ IVWI+N
Sbjct  118  CKGSGHGSQVYGRATWFRGKWAIMYAWYFPKD-------APDEESGQRHDWEHAIVWINN  170

Query  142  PKSKNSTILGVSMSAA--VGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199
            PK K   IL VS+S     GY  +  P     DG  +KL Y  +H      L LT + GE
Sbjct  171  PKVKQPKILAVSVSCGKFFGYLKKVAPGPAVFDGTRLKLSYGADH-KHEHRLDLTAEKGE  229

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             QDLI W++L+  AR + +   W   +       MPL D  ++  L +AWPF
Sbjct  230  DQDLIMWEQLTDEARCAFDTILWTNDM-------MPLNDAWYKHELTRAWPF  274

>PHYRA_52960
Length=223

 Score = 193 bits (490),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 138/228 (61%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD V PF QP P T   K AVK KPQ+ IA+GCHPYPAV +DG+ +GGLK +G Q   
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  68

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS+LGSQIY R A    V+A MY+WY PK +    LP +    G+RH+WE  +VWI N
Sbjct  69   CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQ---TLPGL----GYRHDWEACVVWISN  121

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
               +   I+ +S+S    Y +  P +  Y++GDS K+EY  + ++   SL  T   GE Q
Sbjct  122  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  181

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  AR +L  TD+        G ++P KD  F+E L KA+
Sbjct  182  DLIMWDQLTAAARTALEDTDF-------GGARVPFKDANFKEKLAKAY  222

>PHYRA_52955
Length=223

 Score = 193 bits (490),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 138/228 (61%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD V PF QP P T   K AVK KPQ+ IA+GCHPYPAV +DG+ +GGLK +G Q   
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  68

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS+LGSQIY R A    V+A MY+WY PK +    LP +    G+RH+WE  +VWI N
Sbjct  69   CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQ---TLPGL----GYRHDWEACVVWISN  121

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
               +   I+ +S+S    Y +  P +  Y++GDS K+EY  + ++   SL  T   GE Q
Sbjct  122  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  181

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  AR +L  TD+        G ++P KD  F+E L KA+
Sbjct  182  DLIMWDQLTAAARTALEDTDF-------GGARVPFKDANFKEKLAKAY  222

>PYIR_13275
Length=237

 Score = 193 bits (491),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 134/232 (58%), Gaps = 23/232 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V PF QP  VT   K  VKFKPQ+ I++GCHPYPAV   G+ +GGL  +G  D  
Sbjct  23   IAHDAVVPFVQPTAVTTEQKLGVKFKPQIHISNGCHPYPAVDAAGNTSGGLNPTGSSDAG  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  G+Q+Y R    N V+A+MY+WYFPK      L       GHRH+WE+V+VWIDN
Sbjct  83   CKGSGYGTQVYGRGVAYNGVYALMYSWYFPKDSPFTGL-------GHRHDWEHVVVWIDN  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY----YYNHLLGSTSLQLTEDT  197
            P + +  IL +S SA  GY    PP+   VDG+S K++Y      NH L ST+       
Sbjct  136  PDAASPVILAISPSAHSGYEKYAPPKTDTVDGNSAKVDYKSIVVINHALDSTTT-----A  190

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            GE Q LI WD+L+  AR +L +TD+ +         +P+KDG F   +  A+
Sbjct  191  GEQQPLIMWDQLTAAARTALENTDFGDA-------NVPMKDGNFMTKIANAY  235

>PHALS_06084
Length=260

 Score = 193 bits (490),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 135/230 (59%), Gaps = 15/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I +DQVR F QPKP T+S + A+ FKPQL I  GC PYPAV + G  +GGL      + +
Sbjct  45   IPYDQVRGFRQPKPTTISQQVALTFKPQLDIVTGCLPYPAVNRLGETSGGLPKDADTETK  104

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS+  SQ+Y RS W NDVW +M++WYFPK     P PL+    GHRH+WE V+++ID+
Sbjct  105  CHGSQFNSQVYGRSTWFNDVWVMMFSWYFPKDS---PFPLL----GHRHDWENVVIFIDS  157

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            PK     ILG SMS    Y    P      +G SVK++Y  +  L   +L +TE  G FQ
Sbjct  158  PKVPLPKILGCSMSYHSEYIKFAPCPTFATNGTSVKVKYEDSFPLNH-ALNVTEKEGTFQ  216

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            DLI W++L  + R SLN T       D     +P+ D  F + +++AWPF
Sbjct  217  DLIMWNQLPPIVRKSLNDT-------DFGSANVPMNDWNFLKKVEEAWPF  259

>PHYSO_330015
Length=241

 Score = 191 bits (486),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 132/232 (57%), Gaps = 19/232 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PFPQP PVTVS+KAAVK+KP L I D CHPYPAV   G  +GGLK +G +DG 
Sbjct  24   IDHDKVQPFPQPGPVTVSEKAAVKYKPNLLILDACHPYPAVNAAGETSGGLKGTGKRDGA  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKG---RGAVPLPLITRLFGHRHNWEYVIVW  138
            C GS LGSQ+Y R+ W +D+WAIMYAWYFPK    RG           G RHNW   +VW
Sbjct  84   CKGSGLGSQVYGRAGWHDDMWAIMYAWYFPKDVYYRGTFSDK------GFRHNWVNAVVW  137

Query  139  IDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            +DNP  +        +    GY   +PP   Y +G S  L Y  N    S   Q T   G
Sbjct  138  LDNPALETPRYSPCRLR---GYQECSPPFTGYFNGTSAMLVYEANGEEPSALSQNTLGGG  194

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWP  250
            E QDLI W++L+  AR +L+ TD+ ET       K+P  D  F   L  A P
Sbjct  195  ELQDLIMWEQLTVEARDALSTTDFGET-------KVPFIDANFNANLKAARP  239

>PHYRA_72390
Length=237

 Score = 191 bits (485),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 134/230 (58%), Gaps = 14/230 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PFPQP+PVT+S+KA VKFKP+L I +GC  YPAV   G  +GGLK +G  D  
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C    LGSQ+Y R+ W NDVWAIMYAWYFPKG          +    RH+W  V+VWIDN
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWDKCPYWRHDWSNVVVWIDN  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P  + S +LG+S+S +          A  +   +  + Y Y    GS  L    D G+FQ
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  193

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             LI WD+L+  AR +LN  D      +    ++P+ D  F E L+KAWPF
Sbjct  194  GLIMWDQLADAARAALNDQD------NFGRTEVPISDDHFPEHLEKAWPF  237

>PHYRA_72477
Length=238

 Score = 190 bits (483),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 135/232 (58%), Gaps = 17/232 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+KA VKFKP L I  GC  YPAV   G  +GGLK SG     
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTSG  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR-GAVPLPLITRLFGHRHNWEYVIVWID  140
            C    LGSQ+Y R+ W NDVWAIMYAWYFPKG   A P          RH+W   +VWID
Sbjct  82   CALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPF--------WRHDWSNAVVWID  133

Query  141  NPKSKNSTILGVSMSAAVG-YASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199
            NP  +N   LG+S+S +   Y S    E  + +G +  L  Y   +  +T L    D+GE
Sbjct  134  NPALENPKALGLSISRSENKYGSTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGE  192

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            FQDLI WD+L+  AR +LN  D      +    ++P+ D  F + L++AWPF
Sbjct  193  FQDLIMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPKRLEEAWPF  238

>PHYCA_6835
Length=210

 Score = 189 bits (481),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 127/215 (59%), Gaps = 23/215 (11%)

Query  41   KAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVND  100
            ++AVKFKPQL I +GCH YPAV + G   GGLK  G     C GS  GSQ+Y RS W  D
Sbjct  14   RSAVKFKPQLHITNGCHSYPAVDEAGETGGGLKTKGAPSAGCKGSGWGSQVYGRSGWYQD  73

Query  101  VWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGY  160
            VWAIMY WYFPK   +  +       GHRH+WE+VIVWIDNP  +N  IL V+ SA  GY
Sbjct  74   VWAIMYCWYFPKDEPSSGI-------GHRHDWEHVIVWIDNPAVENPKILAVTPSAHSGY  126

Query  161  ASQTPPEAMYVDGDSVKLEYY----YNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYS  216
                PP A  +DG + K+ Y      +H L STS     + G+FQDLI WD+LS+ AR +
Sbjct  127  HKYAPPNADTIDGVTTKVAYDSKWPMDHALDSTS-----EAGDFQDLIMWDQLSENARRA  181

Query  217  LNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            LN  ++ +          P+ DG FQ  L KAWPF
Sbjct  182  LNSVNFGKA-------NTPMNDGNFQPKLAKAWPF  209

>PHYCA_132529
Length=232

 Score = 190 bits (482),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 143/235 (61%), Gaps = 27/235 (11%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + + +++PF QP+P+TVSDK AV+FKPQL+I DGCHPYPAV + G I+ G   SG  D  
Sbjct  12   VDYQEIKPFAQPEPITVSDKVAVRFKPQLRIKDGCHPYPAVNEAGDISSGAD-SGWGDSS  70

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C+GS +GSQ+Y RSAW   VW +MYAWYFPK                 H WE V+VWID+
Sbjct  71   CSGSDVGSQVYGRSAWCGGVWGMMYAWYFPKDETT-------------HRWENVVVWIDD  117

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAM--YVDGDSVKLEYYYNHLLGSTSLQLTEDT--  197
            P  +N TILGVS S+  GY    P +      DGD+V+++Y  + ++ +T +    DT  
Sbjct  118  PAVENPTILGVSTSSDGGYIRYAPLDDNDWARDGDNVQIQYRLDDVMATTRVFHHLDTSW  177

Query  198  --GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWP  250
              G+ Q L+TW++L++ AR +L + D+ E+       K+PLK+  F   LD A P
Sbjct  178  RGGDIQGLVTWEQLTEEARNTLENGDFGES-------KVPLKNSTFTANLDFAIP  225

>HYAP_06628
Length=245

 Score = 190 bits (482),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 137/231 (59%), Gaps = 15/231 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H +V+ F QP+PVT+S+KAAV+  P L +  GC PYPAV + G  +GGLK +G  +G 
Sbjct  29   IPHHEVKAFAQPEPVTISEKAAVRLNPTLLVTYGCQPYPAVNEFGQTSGGLKPTGDHNGH  88

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+YARSAW  D WAIM+A+YFPK +         R    RH+WE+ +VWI N
Sbjct  89   CKGSGHGSQVYARSAWFGDKWAIMFAYYFPKSQ-------PRRSVSVRHSWEFAVVWIAN  141

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTE-DTGEF  200
            P++   T+   + S A GY   T  +A  +DG+ VKL  Y+ H      L+LT  D G  
Sbjct  142  PEAPEKTLALTTRSFAYGYFKYTSFDASEMDGERVKLR-YWQHADSDLYLELTSLDGGVT  200

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            + LI W++L + AR +LN   W+       G K PL D  F+ LL+ +WPF
Sbjct  201  RPLIMWEQLPEKARCALNEATWN------GGFKCPLSDEAFEPLLNASWPF  245

>PITG_16866
Length=238

 Score = 189 bits (481),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 141/229 (62%), Gaps = 15/229 (7%)

Query  22   IGHDQVRPFPQPKPVTVSD-KAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDG  80
            I HD V PF QP   T ++ KA +KFKPQ+ I++GCHPYPAV  DG+ +GGL  +G    
Sbjct  22   ISHDAVIPFAQPTTTTTTEQKAGIKFKPQIHISNGCHPYPAVDADGNTSGGLNPTGSSSA  81

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             C GS  GSQIY R A  N V+AIMY+WYFPK       PL     GHRH+WE+V+VW+D
Sbjct  82   GCKGSGYGSQIYGRVATYNGVFAIMYSWYFPKDS-----PLTG--LGHRHDWEHVVVWVD  134

Query  141  NPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            + K  + +++ VS SA  GY    PPE+  +DG S K++Y  + L+ + +L  T D GE 
Sbjct  135  DIKLNSPSVIAVSPSAHSGYNIYHPPESNTIDGYSTKVDYSSSWLVINHALDSTTDAGET  194

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            Q+LI WD+L+  AR +L +TD+ +         +P+KDG F   +  A+
Sbjct  195  QNLIMWDQLTDAARTALENTDFGDA-------NVPMKDGNFLTKVGNAY  236

>PHYCA_12462
Length=177

 Score = 187 bits (474),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 11/161 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+P T S+K+AVK+KPQL+I+       AVQ DGS++ GLKW+G  DG+
Sbjct  24   INHDKVQPFTQPEPTTNSEKSAVKYKPQLRIS------TAVQADGSVSAGLKWTGWSDGD  77

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS+LGSQ+Y+RS W  D WAIMYAWYFPKGR  +        FGHRH W Y IVW+D+
Sbjct  78   CKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYIS----KYRFGHRHYWSYAIVWMDS  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYY  181
                NSTILGVSMSA VGY+ +T P++ Y VDG +VK E Y
Sbjct  134  DVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESY  174

>PHYCA_123797
Length=241

 Score = 189 bits (480),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 138/233 (59%), Gaps = 30/233 (13%)

Query  22   IGHDQVRPFP--QPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQD  79
            I +D+V PFP  QP   TV++KAA+KF+P+LK+ +GCHPYPAV   G ++ GL+ + P  
Sbjct  35   IAYDKVVPFPMAQPSESTVTEKAAIKFRPKLKVVNGCHPYPAVNAAGQVSNGLEVADPTG  94

Query  80   GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139
              C GSKLG+Q+Y RSAW   VWAIMYAWYFP                   +WE+VIVW 
Sbjct  95   AACKGSKLGTQVYGRSAWFGRVWAIMYAWYFPDVTA---------------DWEHVIVWT  139

Query  140  DNPKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            +NP   N  +L V+ S +  GY SQ PP+A  + G SVK+ Y  N       L+ T + G
Sbjct  140  NNPNVTNQVVLAVTTSNSKGGYTSQVPPDATMMSGKSVKVSYNNN------GLESTTEEG  193

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
              Q+LI W +L+  A+ +LN    D+  FD  G+++P+ D  F   L KAWPF
Sbjct  194  GAQNLILWHQLTAAAQEALN----DDQNFD--GVQVPVNDDYFLLNLGKAWPF  240

>PHYRA_86968
Length=239

 Score = 189 bits (479),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 136/233 (58%), Gaps = 18/233 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+KA VKFKPQL I  GC PYPAV   G  +GGLK +G  + +
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-DELD  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR-GAVPLPLITRLFGHRHNWEYVIVWID  140
            C  S LGSQ+Y R+ W N VWAIMYAWYFPKG    VP          RH+W   +VWID
Sbjct  81   CILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVPY--------WRHDWSNAVVWID  132

Query  141  NPKSKNSTILGVSMSAAVGYASQT--PPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            NP  +N  ILG+S+S +      T  P  A  ++  +    Y Y   L +  L+L+   G
Sbjct  133  NPALENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRG  192

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
              QDLI W +L+  AR +LN  D      +     +P+ D  F +LL++AWPF
Sbjct  193  PVQDLIMWGQLTDAARAALNDQD------NFGRTDVPISDDHFPKLLEEAWPF  239

>PHYRA_45457
Length=199

 Score = 187 bits (476),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 120/196 (61%), Gaps = 8/196 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF +P PVT+S+KA VKFKPQL I++GCH YPAV + G   GGLK SG    +
Sbjct  12   ISHDQVIPFAEPAPVTISEKAGVKFKPQLHISNGCHSYPAVNEAGDTGGGLKTSGAPSSK  71

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIY RS W +DVWAIMYAWYFPK   +  L       GHRH+WE+ ++WIDN
Sbjct  72   CKGSGYGSQIYGRSGWHSDVWAIMYAWYFPKDMASTTL-------GHRHDWEHAVIWIDN  124

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      ILGVS+S+  GYA  T      + G +V + Y     L    L LT   G+ Q
Sbjct  125  PDVAEPKILGVSVSSHSGYAKTTTIPVGSLVGTTVLINYESFWPL-DHELSLTTKGGDLQ  183

Query  202  DLITWDELSKLARYSL  217
             LI W +L+  AR SL
Sbjct  184  PLIMWSQLTDAARNSL  199

>PHYSO_496064
Length=254

 Score = 189 bits (480),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 135/246 (55%), Gaps = 30/246 (12%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+P TVS+KAAVKFKP ++I  GCHPYPAV   G  +GGLK SG  DG+
Sbjct  22   IDHDKVQPFAQPEPTTVSEKAAVKFKPSIRIRSGCHPYPAVNAAGETSGGLKPSGEPDGD  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C  S LGSQ+Y R+ W  D+WAIMY WYFPK              G RH W   IVW+DN
Sbjct  82   CKNSSLGSQVYGRAVWYKDLWAIMYTWYFPKDSYGTFF-----RSGQRHKWASFIVWLDN  136

Query  142  PKSKNSTILGVSMS-------------AAVGYASQTPPEAMYVDGDSVKLEY---YYNHL  185
            P  +   IL VS S              A G  S +PP   Y++G S  L Y   +Y  +
Sbjct  137  PSLEKPKILAVSTSFQTGEYQILKNGPPACGRRSCSPPFTDYINGTSAMLAYLDTFYGSI  196

Query  186  LGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELL  245
            L  T+ +     GE QDLI W++L++ A+ +LN TD+ E        ++P  D      L
Sbjct  197  LEMTTAR---TGGELQDLIMWEQLTEEAQIALNETDFGEK------ARVPFIDANLNANL  247

Query  246  DKAWPF  251
            ++   F
Sbjct  248  EQTRSF  253

>PHYRA_43347
Length=220

 Score = 187 bits (476),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 134/205 (65%), Gaps = 17/205 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP PVTVS+KAAV+FKP L+I  GCHPYPAV   G  + GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  82   CTGSKLGSQI---YARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVW  138
            C GS LGSQ+   YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W  V+VW
Sbjct  84   CKGSGLGSQVVLRYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVW  136

Query  139  IDNPKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYY---NHLLGSTSLQLT  194
            +DNP  +  T++GVS S+ V  Y+  TPP A  ++G +  + Y     NH  G  S+  T
Sbjct  137  LDNPALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNH--GFHSVDTT  194

Query  195  EDT-GEFQDLITWDELSKLARYSLN  218
              T GEFQDLI W++L+  AR +LN
Sbjct  195  WKTGGEFQDLIMWEQLTDEARAALN  219

>PHYRA_84273
Length=237

 Score = 188 bits (478),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 136/232 (59%), Gaps = 18/232 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+KA VKFKPQL I  GC  YPAV   G  +GGLK SG   G 
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPQLHITTGCTSYPAVNAAGETSGGLKGSGGTSG-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR-GAVPLPLITRLFGHRHNWEYVIVWID  140
            C    LGSQ+Y R+ W NDV+AIMYAWYFPKG   A P          RH+W   +VWID
Sbjct  81   CMLPPLGSQVYGRAGWHNDVYAIMYAWYFPKGFWDASPF--------WRHDWSNAVVWID  132

Query  141  NPKSKNSTILGVSMSAAVG-YASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199
            NP  K   ILG+S+S +   Y      E  + +G +  L  Y   +  +T L    D+GE
Sbjct  133  NPAHKTPKILGLSLSTSENKYGKTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGE  191

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            FQDLI WD+L+  AR +LN  D      +    ++P+ D  F + L++AWPF
Sbjct  192  FQDLIMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPKRLEEAWPF  237

>PHYKE_7568
Length=372

 Score = 192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 143/249 (57%), Gaps = 14/249 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            M+ R +    +A+L   QA VI HDQV PF QP P T   + A+KFKPQ+ I +GCHPYP
Sbjct  136  MHLRYIAPTALAALTFTQATVISHDQVVPFSQPTPTTTIQEVAIKFKPQIYINNGCHPYP  195

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV +DG+ +GGL  +G +   C GS  GSQIY R+     V+A MY+WY PK      LP
Sbjct  196  AVDEDGNTSGGLAPTGSESAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE---TLP  252

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
             +    GHRH+WE  +VW+D+       I+ +S SA  GY    PP + Y+DGDS K+EY
Sbjct  253  GL----GHRHDWEACVVWLDDITLDEPNIVALSASAHSGYNVYYPPSSSYLDGDSAKIEY  308

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
              ++++   SL  T   GE QDLI WD+L+  AR +L  TD+           +P K+  
Sbjct  309  SSSYIVIDHSLSATSTAGETQDLIMWDQLTDAARAALEDTDF-------GSANVPFKEAN  361

Query  241  FQELLDKAW  249
            FQ  L  A+
Sbjct  362  FQTKLGNAY  370

 Score = 111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 87/144 (60%), Gaps = 15/144 (10%)

Query  105  MYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQT  164
            MY+WYFPK       PL    FGHRH+WE+++VW++NP   +  IL VS SA  GY    
Sbjct  1    MYSWYFPKDS-----PLTG--FGHRHDWEHIVVWLNNPAITSPEILAVSTSAHSGYTVYY  53

Query  165  PPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDE  224
            PP++ Y+DG+S K++ YY+ LL + + ++T D GE QDLI WD+L+  A+ +L  TD+ +
Sbjct  54   PPDSDYLDGNSAKID-YYSVLLINHAFRMTSDAGETQDLIMWDQLTDAAQTALEDTDFGD  112

Query  225  TLFDLAGLKMPLKDGVFQELLDKA  248
                     +P KD  F+  L  A
Sbjct  113  A-------NVPFKDANFETKLANA  129

>PHYRA_41766
Length=209

 Score = 186 bits (473),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 135/227 (59%), Gaps = 18/227 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I H +V+PF QP P T+S+KA VKFKPQ++I  GC PYPAV   G  +GGLK SG   G 
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGG  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RSAW+NDVW    +WYFPK   +  +       GHRH+WE+V+V+IDN
Sbjct  61   CRGSGHGSQVYGRSAWLNDVWX---SWYFPKDSPSSGM-------GHRHDWEHVVVFIDN  110

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P      I+G S S+  GY    P     +DG SVK+ Y ++  + +  L +T D G FQ
Sbjct  111  PDVAEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQ  169

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            DLI WD++++ AR +LN   + +          P+ DG F   L+KA
Sbjct  170  DLIMWDQMTEDARRALNGVHFGDA-------NTPMNDGNFIPKLEKA  209

>PHYSO_490000
Length=241

 Score = 187 bits (475),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 142/232 (61%), Gaps = 16/232 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PFPQ +P T+++KAA+K KP+L I +GCH +PAV  +G  +GGLK  G  +G 
Sbjct  23   IDHDQVVPFPQSQPTTITNKAALKLKPRLFINNGCHLHPAVNANGDTSGGLKPKGSPEGG  82

Query  82   CTGSKLGSQIY--ARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139
            C GS  GSQ+Y   RS W N VWAIMYAWYFPK          T   GHRH+WE+VIV I
Sbjct  83   CRGSGSGSQVYRYGRSTWYNGVWAIMYAWYFPKDEP-------TDFDGHRHDWEHVIVRI  135

Query  140  DNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199
            +NP  +N TIL ++ SA  GY++  PP A  V G S K+EY  + +     L+ T   GE
Sbjct  136  NNPVLENPTILAMTPSAHSGYSTYAPPPADMVSGTSCKVEYTSSWIFIDHHLEGTSTAGE  195

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             QDLI W +L+  ARY+L+ T++ +          P+ +G F   L KAWP+
Sbjct  196  TQDLIMWSDLTDAARYALSTTNFGKA-------DTPMNNGTFNWKLSKAWPW  240

>PHYCA_123205
Length=177

 Score = 185 bits (469),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 115/161 (71%), Gaps = 11/161 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+P T S+ +AVK+KPQL+I+       AVQ DGS++ GLKW+G  DG+
Sbjct  24   INHDKVQPFTQPEPTTNSENSAVKYKPQLRIS------TAVQADGSVSAGLKWAGWSDGD  77

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS+LGSQ+Y+RS W  D WAIMYAWYFPKGR  +        FGHRH W Y IVW+D+
Sbjct  78   CKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYIS----KYRFGHRHYWSYAIVWMDS  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYY  181
                NSTILGVSMSA VGY+ +T P++ Y VDG +VK E Y
Sbjct  134  DVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESY  174

>PHYCA_69457
Length=213

 Score = 186 bits (472),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 137/232 (59%), Gaps = 23/232 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PFPQP+PVT+S+KA VKFKPQ+++  GC PYPAV + G  +GGLK +G   G 
Sbjct  1    INHDQVKPFPQPEPVTISEKAGVKFKPQIQVRTGCEPYPAVNEFGETSGGLKPTGNPRGG  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK     P P +    GHRH+WE+ IV+IDN
Sbjct  61   CGGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDS---PSPGL----GHRHDWEHAIVFIDN  113

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYY----NHLLGSTSLQLTEDT  197
            P      IL  S+S+  GY    P     +DG S+K+ Y +    NH      L  T D 
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHSWPTNH-----DLDTTGDG  168

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            G FQDLI W+++++ AR +LN         +      P  DG F   L+ AW
Sbjct  169  GSFQDLIMWNQMTEDARRALNSV-------NFGSANTPFNDGKFMPKLENAW  213

>PHYSO_254099
Length=235

 Score = 187 bits (474),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 135/233 (58%), Gaps = 28/233 (12%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF Q +    S+KAA+KFKPQL+I+ GCHPYPAVQ DG+++ GLKW G  DG+
Sbjct  24   INHDQVHPFAQVEAANASEKAAIKFKPQLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  83

Query  82   CTGSKLGSQIYA-----RSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVI  136
              GS LGSQ+Y+     R      V AI                           W Y++
Sbjct  84   YQGSGLGSQVYSARPGTRYERREQVSAIATC-----------------------GWLYMV  120

Query  137  VWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTED  196
            +WIDNP++ N  ILGV +    G   + PP+A ++DG S+KL+YY       T LQLT+D
Sbjct  121  IWIDNPEAINPAILGVCVRTEGGNEQRVPPDAKFLDGSSLKLDYYKRTWHRKTGLQLTKD  180

Query  197  TGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
             GEFQDL+TW+++++ AR +L   D+D+   +   L +P  DG F   L+KAW
Sbjct  181  KGEFQDLVTWEQMTEEARITLTEADFDDHWQERNDLDVPFIDGEFTVNLEKAW  233

>PPTG_07991
Length=276

 Score = 187 bits (476),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 138/233 (59%), Gaps = 30/233 (13%)

Query  22   IGHDQVRPF--PQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQD  79
            I +DQV PF   QP   TV++KAA+KF+P+L + +GCHPYPAV   G ++ GL+ +   D
Sbjct  70   IAYDQVEPFEMAQPSDATVTEKAAIKFRPKLHVVNGCHPYPAVNAAGQVSKGLQKADATD  129

Query  80   GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139
             EC+GSKLG+Q+Y RSAW   VWAIMYAWYFP                   +WE+VIVW 
Sbjct  130  AECSGSKLGTQVYGRSAWFGRVWAIMYAWYFPD---------------VSPDWEHVIVWT  174

Query  140  DNPKSKNSTILGVSMSAAVG-YASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            +NP   N  IL V+ S + G Y+SQ PP+A  + G SVK+ Y  N      +L+ T   G
Sbjct  175  NNPNVTNQVILAVTTSDSTGKYSSQVPPDASMISGKSVKIAYNNN------ALESTTKEG  228

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
              Q+L+ W +L+  A+ +LN    D+  F   G+++P+ D  F   L KAWPF
Sbjct  229  GAQNLVLWHQLTPEAQEALN----DDQSF--GGVQVPVNDDYFLLNLGKAWPF  275

>PHYSO_526541
Length=239

 Score = 186 bits (473),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 133/232 (57%), Gaps = 17/232 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP P TVS+KAAVKFKP L+I DGCHPYPAV   G  +GGLK +GP DG+
Sbjct  22   IDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPVDGK  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y RS W  D+WAIMY+WYFPK +            G RH W   +VW+DN
Sbjct  82   CKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDKH-------LGYKGQRHKWVDAVVWLDN  134

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY---YYNHLLGSTSLQLTEDTG  198
            P  +   +L  ++     + S     A +++  +  + Y   Y      +  +  T  TG
Sbjct  135  PAFETPKVLA-NVPQRCEHGSCGKAFAEFMNNTTPMISYRPFYMETSFHTLEMTSTRGTG  193

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWP  250
            E QDLI W++LS  AR +L+ TD+ E        K+P  D  F+  L+ A P
Sbjct  194  ELQDLIMWEQLSPEARTALSETDFGE------AAKVPFIDANFETNLELARP  239

>PHYSO_336498
Length=238

 Score = 186 bits (471),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 134/232 (58%), Gaps = 17/232 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V PFPQP PVT+S+KAAVKFKPQL I DGC  +PAV   G  +GGLK     +  
Sbjct  22   IDHDKVEPFPQPDPVTISEKAAVKFKPQLLIEDGCVSFPAVNAAGETSGGLK-GNSGNSA  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG           +   R +W   +VWIDN
Sbjct  81   CDSAPLGSQVYGRAMWYKDVWAIMYAWYFPKG-------FFVGVASRRFDWSSAVVWIDN  133

Query  142  PKSKNSTILGVSMSAA-VGYASQTP-PEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199
            P      ILG+S S +   Y ++TP P+   +DG +  L    +   G   L  +  TG+
Sbjct  134  PDFAAPKILGISTSTSDDDYETKTPAPDYAILDGTTTLLFRSTSREAGQPKLYYSSRTGD  193

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             Q LI W++L + AR +LN TD     F LA   +P+ D  F++ L KAWPF
Sbjct  194  SQPLIMWEQLPEAARLALNTTD-----FGLA--YVPINDDTFEKKLKKAWPF  238

>PPTG_17295
Length=238

 Score = 186 bits (471),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/253 (41%), Positives = 150/253 (59%), Gaps = 17/253 (7%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MNFR +++++ A+LA   A+ + HD++ P PQP PVT+S+KAA+KFKPQL IADGC  +P
Sbjct  1    MNFRGLVIIIAATLAAVTARRVDHDKLGPIPQPDPVTISEKAAIKFKPQLNIADGCVSFP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV   G  +GGLK S   +  C  + +GSQ+Y R+AW ND WAIMYAW+FPKG       
Sbjct  61   AVNDGGDFSGGLKGSN-GNSACDDAPMGSQVYGRAAWYNDKWAIMYAWFFPKG-------  112

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVG-YASQTP-PEAMYVDGDSVKL  178
                +   R++W   +VWIDNP      +LG+S S +   Y  ++P P+   ++G +  L
Sbjct  113  FFMGVASRRYDWSSAVVWIDNPDFATPAVLGLSTSTSDDEYQRKSPAPDFGILNGVTPLL  172

Query  179  EYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKD  238
                + + G   L  +  TG+FQ LI W++L+  AR +LN        FD    ++P  D
Sbjct  173  YRSISEVAGQPMLDYSSRTGDFQPLIMWEQLTDAARETLN-------TFDFGNAQVPFND  225

Query  239  GVFQELLDKAWPF  251
              F+E L KA+PF
Sbjct  226  ANFEEKLKKAYPF  238

>PHYRA_44405
Length=232

 Score = 185 bits (469),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 140/230 (61%), Gaps = 16/230 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+PVT+S+KAAV+FKP+L+I  GCHPYPAV   G  + GLK +G  DG+
Sbjct  16   IDHDKVQPFAQPEPVTISEKAAVQFKPRLQIFGGCHPYPAVNAAGETSAGLKGTGTHDGD  75

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C  S+LGSQ+Y RS W  D+W IMYAWYFPK +     P   +  GHRH W  V+VW+DN
Sbjct  76   CMRSRLGSQVYGRSVWYGDLWGIMYAWYFPKDK-----PKYRK--GHRHEWANVVVWLDN  128

Query  142  PKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYYNHLL-GSTSLQLT-EDTG  198
            P  +  T++G+S S  V  YA          DG +  + Y  + L  G  S+ +  E  G
Sbjct  129  PAHERPTMIGMSTSWFVTTYAKYKFVPTNGFDGKTYTINYKDDVLNDGFHSVDVIWEIGG  188

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            EFQDLI W++L+  AR +L+ TD+ E         +P  D  F+  L+KA
Sbjct  189  EFQDLIMWEQLTDEARAALSDTDFGED------APVPFIDANFKANLEKA  232

>PPTG_04799
Length=245

 Score = 185 bits (469),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 144/239 (60%), Gaps = 24/239 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQL--KIADGCHPYPAVQKDGSITGGLKWSGPQD  79
            I HD++ PFPQPKPVT+S+KAA+KFKPQL   I   C P+PAV   G +TGGLK +   D
Sbjct  22   IDHDKIEPFPQPKPVTMSEKAAIKFKPQLFTSIKTVCAPFPAVNAAGDVTGGLKGTNGND  81

Query  80   GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139
              C  ++ GSQ+Y R+ W  D+WAIMYAWYFPKG     +   TR    RH+W+ V+VWI
Sbjct  82   A-CRFARKGSQVYGRAGWHKDMWAIMYAWYFPKG---FWMDFPTR----RHDWKNVVVWI  133

Query  140  DNPKSKNSTILGVSMSAAVGYASQTPPEA------MYVDG-DSVKLEYYYNHLLGSTSLQ  192
            DNP  ++  I+ VSMS + G +  T  ++       + +G D   L ++Y   LGS  L 
Sbjct  134  DNPDLESPKIVAVSMSKS-GRSYHTEDQSGGLISRSFFNGFDRTSLRFHYQTDLGSPYLN  192

Query  193  LTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
                 GE+QDLI W++L+  AR +LN       +++    ++P  D  F++ LDKAWPF
Sbjct  193  FAWWGGEYQDLIMWEQLTDPARVALND------IYNFGDAEVPFSDNNFEDYLDKAWPF  245

>PHYSO_255972
Length=215

 Score = 184 bits (466),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 129/230 (56%), Gaps = 37/230 (16%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP P TVS+KAAVKFKP L+I DGCHPYPAV   G  +GGLK +GP DG+
Sbjct  22   IDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPVDGK  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y RS W  D+WAIMY+WYFPK +            G RH W   +VW+DN
Sbjct  82   CKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDKH-------LGYKGQRHKWVDAVVWLDN  134

Query  142  PKSKNSTILGVSM-SAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            P  +   +L VS  S   GY S                     H L  TS   T  TGE 
Sbjct  135  PAFETPKVLAVSTWSWGGGYTS--------------------FHTLEMTS---TRGTGEL  171

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWP  250
            QDLI W++LS  AR +L+ TD+ E        K+P  D  F+  L+ A P
Sbjct  172  QDLIMWEQLSPEARTALSETDFGE------AAKVPFIDANFETNLELARP  215

>PHYSO_527850
Length=195

 Score = 182 bits (463),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 116/176 (66%), Gaps = 9/176 (5%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PFP+ +PV  S+KAAVKFKPQL+I+ G H YPAV++DG+++ GLKW G  DGE
Sbjct  20   INHDEVQPFPELEPVGASEKAAVKFKPQLQISYGFHTYPAVRRDGAVSNGLKWGGKPDGE  79

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQ+Y RS W    WAIMYAWYFPK            L  HRH W Y++VWIDN
Sbjct  80   CKGSAWGSQVYTRSDWYQGKWAIMYAWYFPKAWQE------NDLISHRHLWLYIVVWIDN  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDT  197
            P++ N  +LGV +  A G   + PP+A + +G S+K EYY +   G T LQ T+  
Sbjct  134  PEAVNPAVLGVYVRTAGGSERRAPPDAKFFEGSSLKSEYYKS---GKTGLQRTDKA  186

>PHYRA_72385
Length=237

 Score = 184 bits (466),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 149/249 (60%), Gaps = 14/249 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R   +    SLA AQA VI HDQV PF QP P T    A +KFKPQ+ I++GCHPYP
Sbjct  1    MNLRDFFVAAAVSLAFAQADVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV + G+ +GGLK +G     C GS  GSQIY R      V+A+MY+WYFPK      L 
Sbjct  61   AVDEAGNTSGGLKPTGSSSAGCKGSGYGSQIYGRITTYEGVYALMYSWYFPKDSPVTGL-  119

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH+WE+V+VW+D+    + +I+ VS SA  GY    PPE+  +DG S K++Y
Sbjct  120  ------GHRHDWEHVVVWVDDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDY  173

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
              + ++ + +L  T D+GE QDLI WD+L+  AR +L +TD+ +         +P+KDG 
Sbjct  174  SSSWVVVNHALDSTSDSGESQDLIMWDQLTDAARTALENTDFGDA-------NVPMKDGN  226

Query  241  FQELLDKAW  249
            F   L  A+
Sbjct  227  FLTKLGNAY  235

>PHYRA_39489
Length=237

 Score = 184 bits (466),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 134/231 (58%), Gaps = 18/231 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+KA VKFKPQL I  GC PYPAV   G  +GGLK +G  + +
Sbjct  22   VDHDKVQPFPQPAPVTISEKAXVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-DELD  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR-GAVPLPLITRLFGHRHNWEYVIVWID  140
            C  S LGSQ+Y R+ W N VWAIMYAWYFPKG    VP          RH+W   +VWID
Sbjct  81   CILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVPY--------WRHDWSNAVVWID  132

Query  141  NPKSKNSTILGVSMSAAVGYASQT--PPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            NP  +N  ILG+S+S +      T  P  A  ++  +    Y Y   L +  L+L+   G
Sbjct  133  NPALENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRG  192

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
              QDLI W +L+  AR +LN  D      +     +P+ D  F +LL++AW
Sbjct  193  PVQDLIMWGQLTDAARAALNDQD------NFGRTDVPISDDHFPKLLEEAW  237

>PPTG_17453
Length=254

 Score = 184 bits (466),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/268 (40%), Positives = 147/268 (55%), Gaps = 31/268 (12%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADG-CHPY  59
            M  R++   + A+L    +  + HD++ PFPQP+P T+S+KAAVKFKPQL   +  C PY
Sbjct  1    MKLRVLATTVFAALLSCASATVDHDKIEPFPQPEPATISEKAAVKFKPQLYTPNSVCVPY  60

Query  60   PAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPL  119
            PAV   G + GGLK +   D  C  +  GSQIY R+ W ND+WAIMYAWYFPKG      
Sbjct  61   PAVNVAGEVAGGLKGTNGNDA-CKYAPKGSQIYGRAGWYNDLWAIMYAWYFPKG------  113

Query  120  PLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAA-VGYASQTPP------------  166
                     RH+W+ V+VWIDNP+S+   I+GVSMS +   Y  +T              
Sbjct  114  -FWMDSPSRRHDWKSVVVWIDNPESQTPKIVGVSMSKSDTRYNKETKTWPSNFAGYRMEG  172

Query  167  ---EAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWD  223
                  Y+ G +  L + Y   LGS  L   +  GE+QDLI W++L+  AR +LN  +  
Sbjct  173  RRYHRTYIYGSNTSLRFQYQSDLGSPYLNFGDWEGEYQDLIMWEQLTDAARAALNDGN--  230

Query  224  ETLFDLAGLKMPLKDGVFQELLDKAWPF  251
                +    ++P  D  +++ LDKAWPF
Sbjct  231  ----NFGDAEVPFSDEHYEKHLDKAWPF  254

>PPTG_00460
Length=259

 Score = 184 bits (466),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 137/227 (60%), Gaps = 12/227 (5%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HD+V+PF QP+P+T ++KAAVKFKP L +  GCHPYPAV   G  + GLK +G  DGEC 
Sbjct  22   HDKVQPFAQPEPITDAEKAAVKFKPSLAVKAGCHPYPAVNAAGDTSAGLKGTGAPDGECE  81

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS LGSQ+Y+RS W  D WAIMYAWYFPK    +   LI +  G RH+W  ++VW+DNP 
Sbjct  82   GSPLGSQVYSRSKWYEDKWAIMYAWYFPKDMQNI--GLIKK--GVRHDWVNLVVWLDNPA  137

Query  144  SKNSTILGVSMSA-AVGYASQTPPE-AMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
                TIL  S S    GY    PP+ +  ++G + K+ Y  ++  G  ++    + GE+Q
Sbjct  138  LAEPTILATSASTYGTGYEISKPPKRSDIINGTTPKVRYDEDNREGWHTIFQFHEEGEYQ  197

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            DLI W++L+   R +L +TD+     D A   +P  D  F+  L  A
Sbjct  198  DLIQWNQLTNATRKALENTDFG----DFA--NVPFNDAYFETNLKAA  238

>PPTG_11469
Length=253

 Score = 182 bits (463),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 144/247 (58%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADG-CHPYPAVQKDGSITGGLKWSGPQDG  80
            + HD+++PFPQP+PVT+S+KAA+KFKPQL I +G C  YPAV   G  TGGLK S   D 
Sbjct  21   VDHDKIQPFPQPEPVTISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTGGLKGSNGNDA  80

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG   V  P  TR    RH+W+ V+VWID
Sbjct  81   -CKSAPLGSQVYGRAGWYKDVWAIMYAWYFPKGFW-VGFP--TR----RHDWKSVVVWID  132

Query  141  NPKSKNSTILGVSMSAAVG--------YASQTPPEAM--------YVDGDSVKLEYYYNH  184
            NP  +   I+GVSMS +          +AS      M        Y  G +  L + Y  
Sbjct  133  NPDLEVPKIVGVSMSKSDTKYDKRLELFASDFAGFQMMGQGRFRTYTYGSNTSLRFGYQM  192

Query  185  LLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQEL  244
             LGS  L      GE+QDLI W++L+  AR +LN    D+  F+ A  ++P  D  +++ 
Sbjct  193  ELGSPYLNFGVRDGEYQDLIMWEQLTDAARAALN----DDNNFEKA--EVPFSDEHYEDH  246

Query  245  LDKAWPF  251
            LDKAWP 
Sbjct  247  LDKAWPL  253

>HYAP_07436
Length=267

 Score = 182 bits (463),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 133/228 (58%), Gaps = 14/228 (6%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HD+++PF + +P T ++KA V+FKPQ+K  DGCH Y AV   G  +GGLK  G  +G+C 
Sbjct  50   HDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGKCK  109

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS  GSQIY RSA   + WAIMYA YFPK      + ++ R  G+RH +E+VIVWID+  
Sbjct  110  GSGFGSQIYGRSAPFGNKWAIMYALYFPKD-----MKVLNR--GYRHAFEHVIVWIDDIA  162

Query  144  SKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDL  203
             K+  IL V+      Y     P+   +DGDSVKL Y    L G   L  +   GEFQ L
Sbjct  163  LKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQPL  222

Query  204  ITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            I W++L+  AR +L   +W          KMPL D  F E L++AWPF
Sbjct  223  IMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  263

>HYAP_07925
Length=267

 Score = 182 bits (462),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 133/228 (58%), Gaps = 14/228 (6%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HD+++PF + +P T ++KA V+FKPQ+K  DGCH Y AV   G  +GGLK  G  +G+C 
Sbjct  50   HDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGKCK  109

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS  GSQIY RSA   + WAIMYA YFPK      + ++ R  G+RH +E+VIVWID+  
Sbjct  110  GSGFGSQIYGRSAPFGNKWAIMYALYFPKD-----MKVLNR--GYRHAFEHVIVWIDDIA  162

Query  144  SKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDL  203
             K+  IL V+      Y     P+   +DGDSVKL Y    L G   L  +   GEFQ L
Sbjct  163  LKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQPL  222

Query  204  ITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            I W++L+  AR +L   +W          KMPL D  F E L++AWPF
Sbjct  223  IMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  263

>PHYRA_71310
Length=237

 Score = 181 bits (458),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/249 (44%), Positives = 148/249 (59%), Gaps = 14/249 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R   +    SLA AQA VI HDQV PF QP P T    A +KFKPQ+ I++GCHPYP
Sbjct  1    MNLRDFFVAAAVSLAFAQADVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV + G+ +GGLK +G     C GS  GSQIY R      V+A+MY+WYFPK      L 
Sbjct  61   AVDEAGNTSGGLKPTGSSSAGCKGSGYGSQIYGRITTYEGVYALMYSWYFPKDSPVTGL-  119

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH+WE+V+VW+D+    + +I+ VS SA  GY    PPE+  +DG S K++Y
Sbjct  120  ------GHRHDWEHVVVWVDDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDY  173

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
              + ++ + +L  T D+GE QDLI W +L+  AR +L +TD+ +         +P+KDG 
Sbjct  174  SSSWVVVNHALDSTSDSGESQDLIMWGQLTDAARTALGNTDFGDA-------HVPMKDGN  226

Query  241  FQELLDKAW  249
            F   L  A+
Sbjct  227  FLTKLGNAY  235

>PHYRA_71307
Length=237

 Score = 180 bits (457),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/249 (43%), Positives = 144/249 (58%), Gaps = 14/249 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN + +  V +A+LAGAQA VI HDQV PF QP P T     AV FKPQ+ I +GCHPYP
Sbjct  1    MNLQAIAAVALATLAGAQAAVIDHDQVVPFAQPTPNTTVQSVAVNFKPQIYINNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV +DG+ +GGLK +G Q   C GS  GSQIY R+     V+A MY+WY PK      LP
Sbjct  61   AVDEDGNTSGGLKPTGSQSAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE---TLP  117

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
             +    GHRH+WE  +VW+D+       I+ +S S    Y    PP++ Y+DG+S K+EY
Sbjct  118  GL----GHRHDWENCVVWLDDITLDEPNIVALSASYHSTYLYYYPPDSDYLDGNSAKIEY  173

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
              + ++   SL  T  +GE QDLI W +L+  AR +L  TD+           +P K+G 
Sbjct  174  STSWVILDHSLSATSTSGETQDLIMWGQLTDAARTALEDTDF-------GSANVPFKEGN  226

Query  241  FQELLDKAW  249
            F   +  A+
Sbjct  227  FATKVANAY  235

>PHYRA_84277
Length=240

 Score = 180 bits (456),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 132/233 (57%), Gaps = 17/233 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + HD+V+PFPQP PVT+S+KA VKFKP L I  GC  YPAV   G  +GGLK SG     
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTSG  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR-GAVPLPLITRLFGHRHNWEYVIVWID  140
            C    LGSQ+Y R+ W NDVWAIMYAWYFPKG   A P          RH+W   +VWID
Sbjct  82   CALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPF--------WRHDWSNAVVWID  133

Query  141  NPKSKNSTILGVSMSAAVG-YASQTPPEAMYVDGDSVKLEYYYNHL-LGSTSLQLTEDTG  198
            NP  +N   LG+S+S +   Y S    ++++  G +  L  Y   +   + S     +  
Sbjct  134  NPALENPKALGLSISRSENKYGSTYTDDSVFEYGTTPSLSRYLPPMQTAALSTSSFPNDF  193

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            E QDLI WD+L+  AR +LN  D      +     +P+ D  F +LL++AWPF
Sbjct  194  ELQDLIMWDQLTDAARAALNDQD------NFGRTDVPISDDHFPKLLEEAWPF  240

>PITG_23228
Length=254

 Score = 180 bits (456),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 142/247 (57%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADG-CHPYPAVQKDGSITGGLKWSGPQDG  80
            I HD+V+PF QP PVT+S+KAA+ FKPQL      C P+PA    G ITGGLK S   D 
Sbjct  22   IDHDKVQPFSQPTPVTISEKAAITFKPQLYTPKSVCVPFPAANAYGEITGGLKGSNGNDA  81

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             C    LGSQ+Y R  W  DVWAIMYAWYFPKG     +  ++R    RH+W+ V+VWID
Sbjct  82   -CVFPPLGSQVYGRVGWFRDVWAIMYAWYFPKG---FWMGFVSR----RHDWKNVVVWID  133

Query  141  NPKSKNSTILGVSMSA----------------AVGYASQTPPEAMYVDGDSVKLEYYYNH  184
            NP  +   ILGVSMS                 A  Y      +  Y+ G +  L +YY+ 
Sbjct  134  NPGLEEPKILGVSMSKSETKYTKERRLWPSNFAGFYRMGRRYDRSYIYGFNTFLRFYYHF  193

Query  185  LLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQEL  244
             +G+ +L L+E  GE+QDLI W++L+ +AR +LN ++      +   +++P+ D  F+  
Sbjct  194  DVGTPNLYLSEWEGEYQDLIMWEQLTDVARAALNGSN------NFEEVEVPISDEHFETR  247

Query  245  LDKAWPF  251
            LD+AW F
Sbjct  248  LDEAWLF  254

>PHALS_13513
Length=240

 Score = 179 bits (454),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 139/236 (59%), Gaps = 24/236 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I  + V+PFP+ KP T S+++A+K+KP L +++GCHPYPAVQ++GS++ G +W       
Sbjct  23   IDANSVQPFPEQKPQTDSERSALKYKPHLHVSEGCHPYPAVQQNGSVSAGFEWDEDYSQP  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPK-----GRGAVPLPLITRLFGHRHNWEYVI  136
            C  S  GSQIY+RS+W    WAIMYAWYFPK     GRG         + G RH W + I
Sbjct  83   CGRSPQGSQIYSRSSWYKGKWAIMYAWYFPKAAVHIGRG---------VSGRRHYWLHAI  133

Query  137  VWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTE  195
            VW D     NS+ILGV+MSA +G   +T  ++ Y + G ++KL  Y +      +L+ T 
Sbjct  134  VWTDEENPNNSSILGVTMSAGIGLLKRTKIKSHYIIGGTTLKLMSYVSFWGRRLALKFTV  193

Query  196  DTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
              GE QDLITW++LS  AR +L      +T         PL+D  F  L+ +A+PF
Sbjct  194  KLGETQDLITWEQLSHEARKALALDYKSDT---------PLQDYRFDGLIKEAYPF  240

>PYVX_22469
Length=474

 Score = 185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/251 (44%), Positives = 152/251 (61%), Gaps = 15/251 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN + VL+ L+A L+ AQA VI HD V  F QP P T S++ A+ +KPQL IA+GCHPYP
Sbjct  1    MNIKTVLVSLLAPLSIAQAAVINHDAVAAFAQPSPTTTSEEIAITYKPQLYIANGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV  DG+ +GGLK +G QD +C GS LG+QIY R+   N V+AIMY+WY PK     PL 
Sbjct  61   AVDADGNTSGGLKPTGAQDSDCKGSALGTQIYGRATEYNGVYAIMYSWYMPKDS---PL-  116

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH WE V+VW+D+  + + +I+ VS SA   Y    PP +  V+G S K++ 
Sbjct  117  ---SGLGHRHEWENVVVWLDSATASSPSIVAVSPSAHGNYHIYNPPSSSNVNGTSAKVK-  172

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
            Y + ++ + SL +T  +GE Q LI +++LS+ AR +L  TD+           +P K+  
Sbjct  173  YESQVVINHSLDITTVSGETQPLILYEQLSEAARQALETTDF-------GSATVPFKNTT  225

Query  241  FQELLDKAWPF  251
            F   L  A P 
Sbjct  226  FTANLALASPI  236

 Score = 172 bits (437),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 129/228 (57%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V PF QP P T    AAVKFKP L I +GCHPYPAV +DG+ +GGLK +G   G 
Sbjct  259  IDHDAVVPFAQPTPNTTEQSAAVKFKPTLYIDNGCHPYPAVDEDGNTSGGLKPTGSTTGG  318

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQIY R    + VWAIMY+WY PK     P P I    GHRH+WE  ++W+D+
Sbjct  319  CTGSSLGSQIYGRVMEYDGVWAIMYSWYMPKDE---PSPYI----GHRHDWENAVIWVDD  371

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
              S + +I+ +S S   GY    PP A Y  G + K++Y     L    L  T   GE Q
Sbjct  372  ITSASPSIVAISASEHSGYKVYYPPSADYYSGYTAKIKYESVFFLVDHCLYATSTAGETQ  431

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  A+ +L  TD+           +P K+  F   + KA+
Sbjct  432  DLIMWDQLTAAAQTALEDTDF-------GSANVPFKEANFATKVAKAY  472

>PPTG_15234
Length=235

 Score = 178 bits (452),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 131/228 (57%), Gaps = 16/228 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF QP P T     AV+FKPQ+ I +GCHPYPAV +DG+ +GGLK +G +   
Sbjct  22   IDHDQVVPFAQPTPNTTVQSVAVQFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSESAG  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIY R+   + V+A MY+WY PK      L       GHRH+WE  +VW+D+
Sbjct  82   CKGSGYGSQIYGRAVEYDGVYAFMYSWYMPKDETLDGL-------GHRHDWENCVVWLDS  134

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
                N +I+ +S S    Y    PP++ Y+DGDS K+EY  + ++   SL  T   GE Q
Sbjct  135  --LDNPSIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVILDHSLSATSTVGETQ  192

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  AR +L  TD+ +         +P K+  F   +  A+
Sbjct  193  DLIMWDQLTDAARTALEDTDFGDA-------NVPFKETNFATKVANAY  233

>PHALS_14425
Length=302

 Score = 179 bits (455),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 134/230 (58%), Gaps = 10/230 (4%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            +G D V PFP+ K  T S K+A+ F+PQL I DGCHPYPAVQ +GS+  GL++   +D  
Sbjct  81   LGADSVHPFPRTKARTSSQKSALMFQPQLYIEDGCHPYPAVQSNGSLNAGLEYELFRDPT  140

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS+W    WA +Y WYFP        P  T   GHRH W + IVW  +
Sbjct  141  CEGSPLGSQVYSRSSWYQMKWATIYTWYFPVAYDHAS-PFST---GHRHYWLWAIVWTTD  196

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            P       L VSMS   G +S T P   + V+G +V L+ + + +    +L LTE +GE 
Sbjct  197  PNPAEGHFLAVSMSGNFGISSYTLPHIKHLVNGTTVLLKSHKSLMSARLALDLTEKSGEK  256

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWP  250
            +DLITW+EL+  AR +L+     E     A    PL+D  F  LL+KA+P
Sbjct  257  EDLITWEELTPEARAALSSVKRTE-----ATANSPLQDNKFFSLLEKAYP  301

>PHYKE_208
Length=187

 Score = 176 bits (445),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 118/181 (65%), Gaps = 13/181 (7%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R  ++  VA++A  +A VI HDQV PF QP+  T+S+KAAVKFKPQ+ + +GCHPYP
Sbjct  1    MNLRTFVVTAVAAIAAVEADVISHDQVVPFAQPEATTISEKAAVKFKPQIHVTNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV   G  +GGLK +G   G C GS  GSQ+Y RS W +  WAIMY+WYFPK   +  L 
Sbjct  61   AVNSAGDTSGGLKPTGAPSGSCKGSGYGSQVYGRSTWYSGRWAIMYSWYFPKDSPSTGL-  119

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
                  GHRH+WE+V+VWIDNP  +N TILGVS SA  GY+   PP +  VD      EY
Sbjct  120  ------GHRHDWEHVVVWIDNPDVENPTILGVSPSAHSGYSKYVPPSSDTVD------EY  167

Query  181  Y  181
            Y
Sbjct  168  Y  168

>PHYRA_75425
Length=237

 Score = 177 bits (448),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 130/228 (57%), Gaps = 14/228 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V PF QP P T     AVKFKPQ+ I +GCHPYPAV +DG+ +GGLK +G Q   
Sbjct  22   IDHDAVVPFAQPTPTTTLQTLAVKFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSQSSG  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQIY R+     V+A MY+WY PK              GHRH+WE  +VW+D+
Sbjct  82   CTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLDGVGHRHDWENCVVWLDD  134

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
                   I+ +S S    Y    PP++ Y+DGDS K+EY  + +L   SL  T  +GE Q
Sbjct  135  ITLDEPNIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVLLDHSLSATSTSGETQ  194

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  AR +L  TD+ +         +P K+  F+  L  A+
Sbjct  195  DLIMWDQLTDAARTALEDTDFGDA-------NVPFKEANFETKLANAY  235

>PHYRA_52426
Length=152

 Score = 173 bits (439),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 107/160 (67%), Gaps = 8/160 (5%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I +++++PF +P+P T S+KAAVKFKPQL +  GC+PYPAVQ DGS++ GL+ SGP DGE
Sbjct  1    IDNEKIQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY WY PKG            +  RH WE  +VWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKG--------CPTKYQRRHFWETAVVWIDD  112

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY  181
            P   NSTILGVS++       +TP    ++DG SVKL  Y
Sbjct  113  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSY  152

>PHYSO_365942
Length=233

 Score = 176 bits (446),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 125/223 (56%), Gaps = 28/223 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+K AVKFKP L+I  GCHPYPAV   G  + GLK  GP+DGE
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIVGGCHPYPAVNAAGETSAGLKGRGPKDGE  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +G   +       G RH W   +VW+DN
Sbjct  61   CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDKGYGSI----LAKGQRHKWVSAVVWLDN  116

Query  142  PKSKNSTILGVSM-SAAVGY--ASQTPPEAMYVDGDSVKLEYYYN---------------  183
            P  +   IL +S  +   GY      PP+      D+ K   Y N               
Sbjct  117  PALETPKILAISTWNVEGGYDILKNEPPQCYRYSCDA-KFAEYINMTTPMLSYERCRPEP  175

Query  184  --HLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDE  224
              H L  T+ +    TGE QDL+ W++LS+ AR +L   D+ E
Sbjct  176  SYHTLRPTTAR---GTGELQDLVMWEQLSEEARIALGEADFGE  215

>PHYCA_553546
Length=280

 Score = 177 bits (450),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 142/271 (52%), Gaps = 57/271 (21%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PFPQP+PVT+S+KAAVK+KPQL+I DGC  +PAV   G ITGGLK  G +D E
Sbjct  26   IDHDQVKPFPQPEPVTISEKAAVKYKPQLEIGDGCVSFPAVNAAGEITGGLK--GTKDTE  83

Query  82   -CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             CT + LGSQ+Y RS W  D WA+MY+WYFPK   A            RH+W  V++WID
Sbjct  84   ACTEAPLGSQVYGRSTWFQDKWAMMYSWYFPKNFCAYKA-------AGRHDWANVVIWID  136

Query  141  NPKSKNSTILGVSMSAA-----------VGYASQTP-------PEAMYVDGDSV------  176
            NP ++N T LG S+S             +G  ++ P       P   +   + +      
Sbjct  137  NPAAENVTFLGASLSQQTLEPIKLAILPMGTRNEEPYQNQKAIPMMAFAGAERITTGRVG  196

Query  177  KLEYYYNHLLGSTS----------------LQLTEDTGEFQDLITWDELSKLARYSLNHT  220
            +  Y Y ++ GS +                +   +  GE QDLI W++L+  AR +L   
Sbjct  197  RWSYTYKYVAGSNTTMRFSHSYPGTWGWIDMTFADSDGESQDLIMWNQLTDKARAALESA  256

Query  221  DWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            D+ +T       ++P  D  F   L  AWPF
Sbjct  257  DFGDT-------QVPFTDKNFDTNLQAAWPF  280

>PHYSO_423056
Length=233

 Score = 176 bits (446),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 129/222 (58%), Gaps = 26/222 (12%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+K AVKFKP L+I  GCHPYPAV   G  + GLK SGP DG+
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIDGGCHPYPAVNAAGETSAGLKGSGPDDGK  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +G   +       G RH W   +VW+DN
Sbjct  61   CKGSGLGSQVYGRAIWYKDLWAIVYGWYFPKDKGFGGI----LAKGQRHKWVSAVVWLDN  116

Query  142  PKSKNSTILGVSM-SAAVGYA--SQTPPE----------AMYVDGDSVKLEY--YYN---  183
            P  +   IL +S  +   GY      PPE          A Y++  +  L Y  Y+    
Sbjct  117  PAVETPKILAISTWNLEGGYVILKNEPPECSRHGCDPKFAEYINMTTPMLSYEPYFQRDS  176

Query  184  -HLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDE  224
             H L  T+ +    TGE QDL+ W++LS+ AR +L   D+ E
Sbjct  177  FHTLRPTTAR---GTGELQDLVMWEQLSEEARIALGEADFGE  215

>HYAP_14846
Length=221

 Score = 175 bits (444),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 131/236 (56%), Gaps = 27/236 (11%)

Query  22   IGHDQVRPFPQ----PKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGP  77
            I HDQV+PF Q      P  V   AA+KFKPQL I+ GCH YPAV   G  +GGLK +G 
Sbjct  4    IKHDQVQPFQQVVGDDSPTAV---AALKFKPQLHISSGCHSYPAVNTVGEFSGGLKPTGH  60

Query  78   QDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIV  137
             +G+C GS  GSQ+Y RSAW  D WAIMY WYFPK                RH+WE+++V
Sbjct  61   DNGKCKGSGYGSQVYGRSAWHQDKWAIMYVWYFPKDNRD----------DDRHDWEHIVV  110

Query  138  WIDNPKSKNSTILGVSM--SAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTE  195
            W+DNP   N  +L VS+       Y +   P  ++VDG SVKL+Y   +     +L LT 
Sbjct  111  WLDNPAVANQKLLAVSLWNGRKSDYWTLAIPGPVFVDGSSVKLDYGKAN-KDERTLSLTH  169

Query  196  DTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
              GEFQ LI W ++S+ AR + N   W +         MPL D  F++ L KA+ F
Sbjct  170  LAGEFQPLIMWGQMSEKARTTFNTVLWRKEF-------MPLSDSCFEQHLKKAYDF  218

>PPTG_14652
Length=257

 Score = 176 bits (447),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 135/233 (58%), Gaps = 20/233 (9%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PF QP+P+T+++KAAVKFKP L +  GCHPYP V   G  + GL+ +GP DG 
Sbjct  20   INHDMVKPFAQPEPITIAEKAAVKFKPSLAVKSGCHPYPIVNAAGDTSTGLEGTGPPDGG  79

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPK---GRGAVPLPLITRLFGHRHNWEYVIVW  138
            C G +LGSQ+Y+RS W  D WAIMYAWYFPK    RG V         G RH+W  ++VW
Sbjct  80   CEGPELGSQVYSRSTWCEDKWAIMYAWYFPKDIQNRGLVKT-------GVRHDWVNLVVW  132

Query  139  IDNPKSKNSTILGVSMS--AAVGYASQTPPEAMYVDGDSVKLEYYYNHLLG-STSLQLTE  195
            +DNP      +L  S S    +   S+ P  +  ++G + KL Y  +      T  Q  E
Sbjct  133  LDNPALVKPAMLATSASTYGNLYVISKPPKTSDVINGTTPKLRYDEDGYEAWHTVFQFHE  192

Query  196  DTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            + GE+QDLI W++L+  AR +L +TD     F + G  +P  D  F+  L +A
Sbjct  193  E-GEYQDLIQWNQLTDAAREALTNTD-----FGVFG-HVPFIDAFFETNLKEA  238

>PHYSO_254223
Length=227

 Score = 175 bits (444),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 136/234 (58%), Gaps = 41/234 (18%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+ FPQP+PVT  +K AVK+KPQL I++GCHPYPAVQ D                
Sbjct  24   IDHDQVQSFPQPEPVTDFEKFAVKYKPQLHISNGCHPYPAVQAD----------------  67

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
                     +Y+RS W    W IMYAWYFPKGR A      T   GHRH WE V+VW+DN
Sbjct  68   ---------VYSRSDWYRGKWTIMYAWYFPKGR-ACKDDFKT---GHRHFWEDVVVWVDN  114

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYV-DGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            P   NST+LGV M A   +    P +  Y+ DG +VK   Y +  LG+  + LTED GE 
Sbjct  115  PNPDNSTLLGVPMYAGHRHIKVVPVDEKYLKDGKTVKFGSYKS--LGAQVVGLTEDYGEI  172

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAG----LKMPLKDGVFQELLDKAWP  250
            QDLITW++L+  AR +L+     E  F + G    + +P+KDG F++ L+ A+P
Sbjct  173  QDLITWEQLTVEARTALS-----EANFHVDGGVREVVVPIKDGQFEKTLESAYP  221

>PHYSO_560790
Length=237

 Score = 175 bits (444),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 142/251 (57%), Gaps = 18/251 (7%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R  LL  +AS A   A VI HDQV PF QP P T   +AAVK+KPQ+ I++GCHPYP
Sbjct  1    MNLRPALLATLASFAYVSASVINHDQVVPFTQPTPTTALQQAAVKYKPQIHISNGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV  +G+ +GGL  +G +   C GS  G+QIY R+     V+A MY+WY PK      L 
Sbjct  61   AVDNNGNTSGGLNPTGSESAGCKGSGYGTQIYGRAVKYQGVYAFMYSWYMPKDETLTGL-  119

Query  121  LITRLFGHRHNWEY--VIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKL  178
                  GHRH+WE    +VW+D+    N +I+ +S S    Y    PP++ Y+DG+S K+
Sbjct  120  ------GHRHDWEACNCVVWLDS--LDNPSIVALSASYHSTYLYYYPPDSDYLDGNSAKI  171

Query  179  EYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKD  238
            EY  + ++   SL  T   GE QDLI WD+L+  AR +L  TD+ +         +P K+
Sbjct  172  EYSTSWVILDHSLSATSTAGETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKE  224

Query  239  GVFQELLDKAW  249
              F+     A+
Sbjct  225  ANFETKRANAY  235

>PHYCA_129892
Length=234

 Score = 175 bits (443),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 137/228 (60%), Gaps = 16/228 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF QP P T     AV++KPQ+ IA+GCHPYPAV +DG+ +GGLK +G Q   
Sbjct  21   IDHDQVVPFAQPTPTTTLQTLAVQYKPQIYIANGCHPYPAVDEDGNTSGGLKPTGSQSAG  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIY R+     V+A MY+WY PK      LP +    GHRH+WE  +VW+D+
Sbjct  81   CKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE---TLPGL----GHRHDWEACVVWLDS  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
             ++ N  ++ +S S    Y +  PP++ Y+DG+S K+EY  + ++   SL  T  +GE Q
Sbjct  134  LENPN--VVALSASYHSTYLTYYPPDSGYLDGNSAKIEYSTSWVILDHSLSATSTSGETQ  191

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  AR +L  TD+ +         +P KD  F+  L  A+
Sbjct  192  DLIMWDQLTDAARTALEDTDFGDA-------NVPFKDANFETKLANAY  232

>PHYSO_504553
Length=257

 Score = 175 bits (444),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 135/248 (54%), Gaps = 33/248 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+PVTVS+K AVKFKP L I DGCHPYPAV   G  + GLK SG  DG+
Sbjct  24   IDHDKVQPFAQPEPVTVSEKTAVKFKPSLHIVDGCHPYPAVNAAGETSAGLKGSGRIDGK  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +    +  + +  G RH W   +VW+DN
Sbjct  84   CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDK----VDFLNK--GQRHKWVSAVVWLDN  137

Query  142  PKSKNSTILGVSM-SAAVGY--ASQTPPEAM----------YVDGDSVKLEYYYN-----  183
            P  +   IL +S  +   GY      PPE            Y++  +  L Y  +     
Sbjct  138  PAVETPKILAISTWNVKGGYDILKNEPPECYRYGCDPKFVEYINMTTPMLSYVRSLEEPV  197

Query  184  HLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQE  243
            H L  T+ +    TGE QDL+ W++LS+ AR +L   D+ E         +P  D     
Sbjct  198  HTLRPTTAR---GTGELQDLVMWEQLSEEARIALGEADFGEK------SPVPFIDTNLNA  248

Query  244  LLDKAWPF  251
             L+ A PF
Sbjct  249  NLEAARPF  256

>PITG_00957
Length=298

 Score = 176 bits (445),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 129/229 (56%), Gaps = 12/229 (5%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+P+T  +KAAVKFKP L +  GCHPYPAV   G  + GLK +G  DG 
Sbjct  58   IDHDKVQPFAQPQPITDVEKAAVKFKPSLAVMSGCHPYPAVNAAGETSAGLKGTGEPDGG  117

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS+LGSQ+Y+RS W    WAIMYAWYFPK      L       G RH+W  V+VW++N
Sbjct  118  CEGSELGSQVYSRSTWYEGRWAIMYAWYFPKDIQNGGLAKK----GIRHDWVNVVVWLNN  173

Query  142  PKSKNSTILGVSMSA-AVGYASQTPPEAM-YVDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199
            P     TIL  S S     Y    PP++   +DG + KL Y         ++      GE
Sbjct  174  PAVAAPTILATSASTYGTRYVISKPPKSSDIIDGITAKLRYDEEGGEEWHTIFQFYGEGE  233

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            FQDLI WD+L+  AR +L +TD+ +       + +P  D  F+  L  A
Sbjct  234  FQDLIQWDQLTDAAREALQNTDFGDY------VNVPFNDAYFETNLKAA  276

>PHYRA_76657
Length=239

 Score = 174 bits (440),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 133/233 (57%), Gaps = 18/233 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKI--ADGCHPYPAVQKDGSITGGLKWSGPQD  79
            I HD+V+PFPQP PVT+++K+ VKFKP+LKI    GC  YPAV   G  +GGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELKIDTEHGCVSYPAVNSAGETSGGLKGTKGTS  81

Query  80   GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139
              CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG          R    RH+W   +VWI
Sbjct  82   A-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWNRRAYWRHDWSNAVVWI  133

Query  140  DNPKSKNSTILGVSMSAAVG-YASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            D+P  +N  +LG+S+S +   Y  +  P     +G +  L Y         +L L   +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAALALYYASG  192

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            + QDLI W +L+  AR +LN  D      +    ++P+ D  F + L+KAWPF
Sbjct  193  DVQDLIMWGQLTDAARAALNDQD------NFGRTEVPINDDHFLKHLEKAWPF  239

>PHYCA_544885
Length=256

 Score = 174 bits (441),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/271 (42%), Positives = 155/271 (57%), Gaps = 35/271 (13%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQL---KIADGCH  57
            MN R+++  + A+LA   +  + HDQ+ PFPQP+PVTVS+KAA+KFKPQL   KI   C 
Sbjct  1    MNLRLLVATVFAALAANASATVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKIV--CV  58

Query  58   PYPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAV  117
            P+PAV   G +TGGLK +   DG C  +  G+QIY R+ W  D+WAIMY+WYFPKG G  
Sbjct  59   PFPAVNAAGEVTGGLKGTNGNDG-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWF  117

Query  118  PLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAA-VGYASQTPPEAMYVDGDSV  176
              P  TR    RH+W+ V+VWIDNP  +   I+GV+MS +   Y+ +      Y  G   
Sbjct  118  DSP--TR----RHDWKNVVVWIDNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRT  171

Query  177  --KLEYYYNHLLGSTSLQLTEDT--------------GEFQDLITWDELSKLARYSLNHT  220
              +      +L  +TSL+   DT              GE+QDLI W++L+  AR +LN  
Sbjct  172  EGRFSSRVEYLGSNTSLRFEYDTSDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALN--  229

Query  221  DWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
              D   F  A  ++P  D  +++ L KAWPF
Sbjct  230  --DGKSFGKA--EVPFNDEHYEDHLGKAWPF  256

>PPTG_08703
Length=254

 Score = 174 bits (441),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 136/247 (55%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIAD-GCHPYPAVQKDGSITGGLKWSGPQDG  80
            + HD++ P PQP+PVT+S KAA+KFKPQL  ++  C  +PAV   G +TGGLK +   D 
Sbjct  22   VDHDKIEPIPQPEPVTISQKAAIKFKPQLYTSEIACVSFPAVNAAGEVTGGLKGTNGNDA  81

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             C  +  GSQ+Y R+ W  D+WAIMYAWYFPKG     +   TR    RH+W+ V+VWID
Sbjct  82   -CKYAPKGSQVYGRAGWYKDLWAIMYAWYFPKG---FWMDFPTR----RHDWKNVVVWID  133

Query  141  NPKSKNSTILGVSMSAA---------------VGYASQTPP-EAMYVDGDSVKLEYYYNH  184
            NP  +   I+GVSMS +                GY  +       Y+ G +  L + Y  
Sbjct  134  NPDLETPKIVGVSMSKSDKKYFKETKIWASNFAGYRMEGRRYHRTYIYGSNTSLRFQYQT  193

Query  185  LLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQEL  244
             LGS  +      GE+QDLI W++L+ + R +LN +       +    ++P  D  F++ 
Sbjct  194  TLGSPYMNFARWDGEYQDLIMWEQLTDVVRVALNDSK------NFGKAEVPFSDEHFEDH  247

Query  245  LDKAWPF  251
            LDKAWP 
Sbjct  248  LDKAWPL  254

>PHYCA_576423
Length=234

 Score = 173 bits (438),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 126/228 (55%), Gaps = 16/228 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV PF QP P T     A++FKPQ+ I +GCHPYPAV  DG+ +GGLK +G Q   
Sbjct  21   IDHDQVIPFAQPMPNTTLQSVAIQFKPQIYINNGCHPYPAVDADGNTSGGLKPTGSQSAG  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIY R+     V+A MY+WY PK              GHRH+WE  +VW+D+
Sbjct  81   CKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLDGQGHRHDWENCVVWLDS  133

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
                  +I+ +S S    Y    PP + Y+DG+S K++Y  + ++   SL  T   GE Q
Sbjct  134  --LDRPSIVALSASYHSTYNYYYPPSSSYLDGNSAKIQYSTSWIVLDHSLSATSTAGEIQ  191

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
            DLI WD+L+  AR +L  TD+           +P K+  F   L KA+
Sbjct  192  DLIMWDQLTDAARTALEDTDF-------GSANVPFKEDNFIAKLAKAY  232

>PITG_23211
Length=245

 Score = 173 bits (438),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 131/229 (57%), Gaps = 12/229 (5%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PF QP+P T ++K AVKFKP L +  GCHPYP V   G    GLK +G  DGE
Sbjct  6    IDHDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGE  65

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CTGS LGSQ+Y+RS    + WAIMYAWYFPK    +   LI +  G RH+W  ++VW+DN
Sbjct  66   CTGSPLGSQVYSRSTLYENKWAIMYAWYFPKNMQNI--GLIKK--GVRHDWVNLVVWLDN  121

Query  142  PKSKNSTILGVSMSA-AVGYASQTPPE-AMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199
            P     TIL  S S     Y    PP+ +  ++G + K+ Y  +   G  ++    + GE
Sbjct  122  PTLAKPTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFHEEGE  181

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            +QDLI W +L+  AR +L +TD+     D A   +P  D  F+  +  A
Sbjct  182  YQDLIQWTQLTDAAREALENTDFG----DFA--NVPFNDAYFETNVKAA  224

>PHYRA_72531
Length=236

 Score = 172 bits (436),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 134/233 (58%), Gaps = 21/233 (9%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PFPQP+ VT+++K+ VKFKPQL I  GC PYPAV   G  + GL+ +G  D  
Sbjct  22   IGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEYGCSPYPAVNAAGETSEGLETNGVFD--  79

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR-GAVPLPLITRLFGHRHNWEYVIVWID  140
            C    L SQ+Y R+ W NDVWAIMYAWYFPKG     P          RH+W   +VWID
Sbjct  80   CIIPSLSSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTPW--------WRHDWSNAVVWID  131

Query  141  NPKSKNSTILGVSMSAAVG-YASQTPPEAMYVDGDSVKLEYYYNHL-LGSTSLQLTEDTG  198
            NP  +   +LG+S+S +   Y +   P     +G +  L    N L + S +L    + G
Sbjct  132  NPAHEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLS--RNVLPMRSAALGPAVNPG  189

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            EFQDL+ WD+L+  AR +LN  D      +    ++P+ D  F + L KAWPF
Sbjct  190  EFQDLVMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPKHLKKAWPF  236

>PHYCA_124462
Length=280

 Score = 173 bits (439),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 138/275 (50%), Gaps = 65/275 (24%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHDQV+PFPQP+PVT+S+KAAVK+KP L I +GC  +PAV   G ITGGLK  G +D E
Sbjct  26   IGHDQVKPFPQPEPVTISEKAAVKYKPLLSIGNGCVSFPAVNAAGEITGGLK--GTKDTE  83

Query  82   -CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGH----RHNWEYVI  136
             CT + LG+Q+Y RS W  D WA+MY+WYFPK              GH    RH+W  V+
Sbjct  84   DCTEAPLGTQVYGRSTWFQDKWAMMYSWYFPK-----------NFCGHKAADRHDWANVV  132

Query  137  VWIDNPKSKNSTILGVSMSA-----------AVGYASQTPPE-------------AMYVD  172
            +WIDNP  +N+T LG S+S             V    + P +                V 
Sbjct  133  IWIDNPALENATFLGASLSQQTLEPKKFVFLTVAKRKEEPYQKQKAIPMMAFAGTEQIVT  192

Query  173  GDSVKLEYYYNHLLGSTS----------------LQLTEDTGEFQDLITWDELSKLARYS  216
            G   +  Y Y ++ GS +                +      GE QDLI W++L+  AR +
Sbjct  193  GRVSRHSYTYKYVGGSNTTMRFIHKYPEKSAWIGMSFANSDGESQDLIMWNQLTDKARAA  252

Query  217  LNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            L   D+  T       ++P  D  F+  L  AWPF
Sbjct  253  LESADFGNT-------QVPFTDKNFETNLQAAWPF  280

>PITG_23051
Length=280

 Score = 173 bits (438),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 132/243 (54%), Gaps = 31/243 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADG-CHPYPAVQKDGSITGGLK-WSGPQD  79
            + HD+V PFPQP+PVT+S+KAA+KFK QL I  G C  YPAV   G + GGL  W    D
Sbjct  22   VDHDKVEPFPQPEPVTISEKAAIKFKTQLVIPQGVCVSYPAVNAAGEVGGGLNDWDNGND  81

Query  80   GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139
              C  + LGSQ+Y R+ W  D WAIMYAWYFPK          T    HRH+W+ V+VWI
Sbjct  82   A-CLSAALGSQVYGRAGWHKDRWAIMYAWYFPKD-------FWTGFPTHRHDWKSVVVWI  133

Query  140  DNPKSKNSTILGVSMSAA-----------VGYASQTPPEAMYVDGDSVKLEYYYNHLLGS  188
            DNP  +   I GVSMS +             Y S  P      +G +  L + Y    GS
Sbjct  134  DNPALEIPKIEGVSMSKSDTKYKKKLKLKESYFSGAP-----TNGSNTSLRFEYEAGFGS  188

Query  189  TSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            T +  T   GE+Q+LI W++L+  AR +LN    D   F      +P  D  F++ LD+A
Sbjct  189  TFMGFTRWDGEYQNLIMWEQLTDAARATLN----DGNNFGKEA-SVPFSDEHFEDRLDEA  243

Query  249  WPF  251
            WPF
Sbjct  244  WPF  246

>PHYRA_72430
Length=238

 Score = 171 bits (434),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 124/231 (54%), Gaps = 15/231 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I   +V P  QP P T ++K  VKFKPQL I DGC  +PAV   G    GLK        
Sbjct  22   IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C+ + LGSQ+Y RSAW N  +AI+YAWYFPKG           +   RH+W   +VWID 
Sbjct  82   CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKG-------FWANVATRRHDWASAVVWIDR  134

Query  142  PKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            P + + +ILG+S+S A   Y +Q P  +    G + +L +      G   L  T+ TG  
Sbjct  135  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  194

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLI W++LS  AR +L+ TD+          K+P+ D  FQ  L KAWPF
Sbjct  195  QDLIMWEQLSSAARTALSTTDFGNA-------KVPMSDANFQTKLKKAWPF  238

>PHYRA_72306
Length=238

 Score = 171 bits (434),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 124/231 (54%), Gaps = 15/231 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I   +V P  QP P T ++K  VKFKPQL I DGC  +PAV   G    GLK        
Sbjct  22   IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C+ + LGSQ+Y RSAW N  +AI+YAWYFPKG           +   RH+W   +VWID 
Sbjct  82   CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKG-------FWANVATRRHDWASAVVWIDR  134

Query  142  PKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            P + + +ILG+S+S A   Y +Q P  +    G + +L +      G   L  T+ TG  
Sbjct  135  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  194

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            QDLI W++LS  AR +L+ TD+          K+P+ D  FQ  L KAWPF
Sbjct  195  QDLIMWEQLSSAARTALSTTDFGNA-------KVPMSDANFQTKLKKAWPF  238

>PHYSO_334500
Length=235

 Score = 171 bits (434),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 144/249 (58%), Gaps = 16/249 (6%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R ++   V SLA     VI HD V PF QP P T     AVKFKPQ+ IA+GCHPYP
Sbjct  1    MNLRAIVATTVGSLALVSGAVIDHDTVVPFAQPTPTTTLQTLAVKFKPQIYIANGCHPYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  120
            AV +DG+ +GGLK +G +    TGS LGSQIY R+     V+A MY+WY PK      LP
Sbjct  61   AVDEDGNTSGGLKPTGSESSGYTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDE---TLP  117

Query  121  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  180
             +    GHRH+WE  +VW+D+    + +I+ +S S    Y +  PP++ Y+DG+S K+EY
Sbjct  118  GL----GHRHDWEACVVWLDSL--DDPSIVALSASYHSTYLTYYPPDSDYLDGNSAKIEY  171

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
              + ++   SL  T   GE QDLI WD+L+  AR +L  TD+           +P K+  
Sbjct  172  STSWVILDHSLSATSTAGETQDLIMWDQLTDAARTALEDTDF-------GSANVPFKEAN  224

Query  241  FQELLDKAW  249
            F   + KA+
Sbjct  225  FATKVAKAY  233

>PITG_22981
Length=259

 Score = 172 bits (435),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 131/228 (57%), Gaps = 14/228 (6%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HD V+PF QP+P T ++K AVKFKP L +  GCHPYP V   G    GLK +G  DGECT
Sbjct  22   HDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGECT  81

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS LGSQ+Y+RS    + WAIMYAWYFPK    +   LI +  G RH+W  ++VW+DNP 
Sbjct  82   GSPLGSQVYSRSTLYENKWAIMYAWYFPKDMQDI--GLIKK--GVRHDWVNLVVWLDNPT  137

Query  144  SKNSTILGVSMSA-AVGYASQTPPE-AMYVDGDSVKLEYYYNHLLG-STSLQLTEDTGEF  200
                TIL  S S     Y    PP+ +  ++G + K+ Y  +   G  T  Q  E+ GE+
Sbjct  138  LAKPTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFLEE-GEY  196

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            QDLI W +L+  AR +L +TD+     D A   +P  D  F+  L  A
Sbjct  197  QDLIQWTQLTDAAREALENTDFG----DFA--NVPFNDAYFETNLKAA  238

>PHYSO_482931
Length=254

 Score = 172 bits (435),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 123/247 (50%), Gaps = 36/247 (15%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP PVT+S+K AVKFKP L I + CHPYPAV   G  + GLK  G  + +
Sbjct  24   IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS+LGSQ+Y R+ W   +WAIMYAWYFPK             FG RH W   +VW+DN
Sbjct  84   CRGSELGSQVYGRATWHKGMWAIMYAWYFPKDS--------VSKFGQRHKWNAAVVWLDN  135

Query  142  PKSKNSTILGVSMSAAVG-YASQT---PPEAM--------------YVDGDSVKLEYYYN  183
            P      IL VS     G Y  +T   PP                  ++G +  L Y   
Sbjct  136  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  195

Query  184  HLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQE  243
             +            GEFQDLI W++L++ AR +L   D+            P  DG F+ 
Sbjct  196  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAADFGA----------PFVDGAFKS  245

Query  244  LLDKAWP  250
             LD A P
Sbjct  246  NLDSARP  252

>PPTG_18463
Length=254

 Score = 172 bits (435),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 147/270 (54%), Gaps = 35/270 (13%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MNF   ++V + +L       I  D V+PF QP PVT+S+KAA+KFKPQL I DGC  +P
Sbjct  1    MNFFAAIVVCLVALQSVYCATINRDLVQPFAQPGPVTISEKAAIKFKPQLFILDGCVSFP  60

Query  61   AVQKDGSITGGLKWSGPQDGE-CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPL  119
            AV   G  TGGL  +G Q GE C+ + LGSQ+Y RS W  D WA+M+AWY PK   A   
Sbjct  61   AVNAAGDTTGGL--NGTQGGEGCSKAPLGSQVYGRSTWYQDKWAMMFAWYIPKSYMAA--  116

Query  120  PLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAV----------------GYASQ  163
                 +   RH+W  ++VWI+NP  +   ILGVS+S +                 GY ++
Sbjct  117  -----ITSRRHDWASMVVWIENPSLEIPEILGVSLSNSANGYLRYTGNIYDWNFSGYVAR  171

Query  164  TPPEAMYVDGD--SVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTD  221
            +      + G   S+++E+       S  L L +  G++QDLI W +L++ AR +LN TD
Sbjct  172  SRRRDRDIPGSSTSLRVEHTVRKDFRSAFLNLAQTDGDYQDLIMWGQLTEEARMALNTTD  231

Query  222  WDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            +  +       K+P  DG F   L +A+PF
Sbjct  232  FGRS-------KVPFNDGNFLIKLRQAYPF  254

>PHYCA_109174
Length=277

 Score = 172 bits (436),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 141/273 (52%), Gaps = 60/273 (22%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PF QP PVTVS+KAAVK+KPQL+I+D C  +PAV   G ITGGLK +   DG 
Sbjct  22   IGHDKVQPFAQPDPVTVSEKAAVKYKPQLQISDSCVSFPAVNAAGEITGGLKGTKGTDG-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPK---GRGAVPLPLITRLFGHRHNWEYVIVW  138
            CT + LGSQ+Y RS W  D WA+M+AWYFPK   G GA            RH W  +++W
Sbjct  81   CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPKNFWGGGA----------KSRHLWANMVLW  130

Query  139  IDNPKSKNSTILGVSMSA-----------AVGYASQTP-------PEAMYVDGDSV----  176
            IDNP  +   ILG S+S            ++G   + P       P   +V   ++    
Sbjct  131  IDNPALETPKILGASLSRQTLEVPKAVFLSMGEQQKDPYSKVTAIPPMGFVGMQAIQTSR  190

Query  177  --KLEYYYNHLLGS----------------TSLQLTEDTGEFQDLITWDELSKLARYSLN  218
              +  Y YN+  GS                 SL      GE+QDLI W++L+  AR +L 
Sbjct  191  ISRFRYTYNYTGGSDISTRVSQGYPDNSAWISLTFAGTDGEYQDLIMWNQLTDQARAALE  250

Query  219  HTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
              D+ E        K+P  D  F+  L +AWPF
Sbjct  251  SADFGED------TKVPFNDKNFEAALAQAWPF  277

>PHYRA_47241
Length=176

 Score = 168 bits (426),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 108/160 (68%), Gaps = 8/160 (5%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP+PVT S+KAAV+FKP L+I  GCHPYPAV   G  + GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPEPVTDSEKAAVRFKPSLQIFSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W  V+VW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWVNVVVWLDN  136

Query  142  PKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEY  180
            P  +  TI+GVS S+ V  Y   TPP A  + G +  + Y
Sbjct  137  PALERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTSMINY  176

>PHYSO_365377
Length=220

 Score = 170 bits (430),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 128/227 (56%), Gaps = 17/227 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I +DQV PFP+  P T+S+KAA+KFKP L I DGCHPY AV   G  +GGL      D E
Sbjct  1    IDYDQVEPFPELGPKTISEKAAIKFKPTLFIKDGCHPYAAVNAAGDTSGGLD-PKASDDE  59

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  + WA MYAWYFPK            L G RH+W   IVW+DN
Sbjct  60   CKGSTLGSQVYSRSTWYRNTWATMYAWYFPKDTNLY-------LRGVRHDWVSAIVWLDN  112

Query  142  PKSKNSTILGVSMSAAVG-----YASQTPPEAMYVDGDSVKLEYY-YNHLLGSTSLQLTE  195
            P   N T++GVS S+        +  ++     YVDG   K+EY   +   G  ++  +E
Sbjct  113  PALANQTLIGVSFSSGGASYGGFHLDRSRMWDGYVDGTHPKMEYSAADTRSGYHTIDASE  172

Query  196  DTGEFQDLITWDELSKLARYSLNHTDWDETL---FDLAGLKMPLKDG  239
            D G+FQDLI W +L++ AR +L   D+       F+ A  K  L+ G
Sbjct  173  DVGDFQDLIHWSQLTEEARNALETGDFGSDTPVPFNNANFKKNLERG  219

>PPTG_00471
Length=239

 Score = 170 bits (431),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 130/227 (57%), Gaps = 13/227 (6%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HD+V+PF QP+P+T ++KAA+K+KP L +  GCHPYPAV   G  + GLK +G  DGEC 
Sbjct  22   HDKVQPFAQPEPITDAEKAAIKYKPSLAVKAGCHPYPAVNAAGETSAGLKGTGAPDGECE  81

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS LGSQ+Y+RS W    WAIMYAWYFPK    V   LI +  G RH+W  ++VW+DNP 
Sbjct  82   GSPLGSQVYSRSTWYEGKWAIMYAWYFPKDIKDV--GLIKK--GLRHDWVNLVVWLDNPA  137

Query  144  SKNSTILGVSMSAAVGYASQTPP--EAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
                 IL  + S    Y   + P   +  ++G + K+ Y  +   G  ++    + GE+Q
Sbjct  138  LAKPKILATATSTFGAYYKISKPFKRSEVINGITPKVCYDNDDYKGWHTIFPFHEEGEYQ  197

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKA  248
            DLI W++L+  AR +  + D+ E         +P  D  F+  L  A
Sbjct  198  DLIQWNQLTDAAREAFENGDFGEA-------NVPFNDAYFETNLKSA  237

>PHYRA_52427
Length=124

 Score = 166 bits (420),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 95/132 (72%), Gaps = 8/132 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF +P+P T S+KAAVKFKPQL +  GC+PYPAVQ DGS++ GL+ SGP DGE
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR        TR    RH WE  +VWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRS-------TR-HQRRHFWETAVVWIDD  112

Query  142  PKSKNSTILGVS  153
            P   NSTILGVS
Sbjct  113  PALANSTILGVS  124

>PHYRA_52260
Length=234

 Score = 169 bits (429),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 139/250 (56%), Gaps = 17/250 (7%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  60
            MN R + +V+  + +  +A  + +D+V+PFPQP PVT ++K+ VKFKPQL I  GC  YP
Sbjct  1    MNIRQIFIVVAVAFSSVEALSVDYDKVQPFPQPDPVTTTEKSGVKFKPQLDIEYGCSSYP  60

Query  61   AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR-GAVPL  119
            AV   G I GGL  SG  D  C  +  GSQ+Y R+ W NDVWAIMYAWYFPKG   A P 
Sbjct  61   AVNAAGDINGGLPTSGIAD--CQFALGGSQVYGRAEWYNDVWAIMYAWYFPKGFWDAAPY  118

Query  120  PLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLE  179
                     RH+W   +VWIDNP  +N  ILG+S+S +      T   A  ++  +    
Sbjct  119  --------WRHDWSNAVVWIDNPALENPKILGLSLSTSENKYGNTYVPAEAIENGTTPTL  170

Query  180  YYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDG  239
                 +  +  L+ + + GEFQDLI W +L+  AR +LN  D           ++P+ D 
Sbjct  171  NRNLPVFRAAELRPSTNRGEFQDLIMWGQLTDAARAALNDQD------TFGRTEVPISDD  224

Query  240  VFQELLDKAW  249
             F + L++AW
Sbjct  225  HFPKRLEEAW  234

>PPTG_13026
Length=238

 Score = 169 bits (428),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 128/231 (55%), Gaps = 15/231 (6%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            +  ++V P  QP P T + KAA+KFKP+L I +GC  +PAV   G  + GL+        
Sbjct  22   VDFNKVVPIAQPSPSTSAQKAAIKFKPRLSITNGCVSFPAVNSAGETSSGLQEGYRGSSG  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CT + LGSQ+Y R+ W N  +AI+Y WYFPKG               RH+W   +VWIDN
Sbjct  82   CTNAPLGSQVYGRTTWYNGTFAILYTWYFPKG-------FWNEYATRRHDWASAVVWIDN  134

Query  142  PKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEF  200
            P+  + +ILG+S+S A   + +  P  +   DG + +L +  N   G   L  T+  G+F
Sbjct  135  PELASPSILGLSVSTADWKFKTFAPASSGITDGTTPRLAHVLNVEKGYPYLTTTDTVGDF  194

Query  201  QDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            Q+LI WD+L+  AR +LN TD     F +A  K+P+ D  F   L KAWPF
Sbjct  195  QELIMWDQLTTAARTALNTTD-----FGVA--KVPVSDAAFDTKLKKAWPF  238

>PHYSO_480321
Length=254

 Score = 169 bits (427),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 122/247 (49%), Gaps = 36/247 (15%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP PVT+S+K AVKFKP L I + CHPYPAV   G  + GLK  G  + +
Sbjct  24   IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  83

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS+LGSQ+Y R+ W   +WAIMYAWYFPK             FG RH W   +VW+DN
Sbjct  84   CRGSELGSQVYGRATWHKGMWAIMYAWYFPKDS--------VSKFGQRHKWNAAVVWLDN  135

Query  142  PKSKNSTILGVSMSAAVG-YASQT---PPEAM--------------YVDGDSVKLEYYYN  183
            P      IL VS     G Y  +T   PP                  ++G +  L Y   
Sbjct  136  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  195

Query  184  HLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQE  243
             +            GEFQDLI W++L++ AR +L   D+            P  D  F+ 
Sbjct  196  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAADFGA----------PFVDEAFKS  245

Query  244  LLDKAWP  250
             LD A P
Sbjct  246  NLDSARP  252

>PHALS_12600
Length=267

 Score = 169 bits (427),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 143/234 (61%), Gaps = 21/234 (9%)

Query  25   DQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECTG  84
            D+V+PF Q KP T+S ++A+K+KP+L + +GCHPYP VQ++GS++ G++W       C G
Sbjct  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107

Query  85   SKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLF--GHRHNWEYVIVWIDNP  142
            S  GSQIY+RS W    WA++Y WY P    +      T  F  GHRH W +V++W D+P
Sbjct  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDS------TAWFVDGHRHFWLWVVIWTDSP  161

Query  143  KSKNSTILGVSMSAAVGYASQ----TPPEAMYVDGD-SVKLEYYYNHLLGSTSLQLTEDT  197
               +STIL  SMS   G+  +     P ++ Y+  D ++K++   + +     L+LT+  
Sbjct  162  DPDDSTILAASMS---GFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV  218

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            GEFQDLITW++LS  AR +L++    E   +      P++D +F E+L+K++PF
Sbjct  219  GEFQDLITWEQLSDEARAALSNFHRLEKRAN-----PPIQDKLFYEVLEKSYPF  267

>PITG_23076
Length=276

 Score = 169 bits (428),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 139/270 (51%), Gaps = 55/270 (20%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP PVT+S+KAAVKFKPQL I  GC  +P V   G I+GGLK +   DG 
Sbjct  22   IDHDKVQPFAQPDPVTISEKAAVKFKPQLHIDRGCVSFPVVNAAGEISGGLKGTKGTDG-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C  S LGSQ Y+RSAW  D WAI++AWYFPKG  A   P I      RH W  +++WIDN
Sbjct  81   CRESPLGSQTYSRSAWYQDRWAIVFAWYFPKGFAA-GQPRI------RHYWSSMVLWIDN  133

Query  142  PKSKNSTILGVSMSAAV-----------------GYASQTP-PEAMYVDGD---------  174
            P     TILGVS+S  +                  Y  QT  P A +V            
Sbjct  134  PALDTPTILGVSLSQQLLKPAKFLIGLFTAELQEPYNKQTSIPPAGFVGAQATVVSQING  193

Query  175  -------------SVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTD  221
                         S+++ + Y +     +L      GE+ DL+TWD+L++ AR +LN  D
Sbjct  194  WSNPSNYSGGSNVSIRVSHTYTNKDDWLALTFATQDGEYHDLVTWDQLTEEARAALNSAD  253

Query  222  WDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            + E+       K+P  D  FQ  L+ +W F
Sbjct  254  FGES-------KVPFSDQNFQRTLELSWLF  276

>PPTG_16647
Length=254

 Score = 168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/247 (40%), Positives = 133/247 (54%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIA-DGCHPYPAVQKDGSITGGLKWSGPQDG  80
            + HD+V PFPQP PVT+S+KAA+KFKPQL    + C P+P V   G +TGGLK +   D 
Sbjct  22   VDHDKVEPFPQPVPVTISEKAAIKFKPQLYTPYNICVPFPGVNAVGEVTGGLKGTNGNDA  81

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             C  +  GSQIY R  W  D+WAIMYA Y PKG           L   RH+ + V+VWI+
Sbjct  82   -CKYAPKGSQIYGRGGWYKDIWAIMYACYLPKG-------FWMDLPSRRHDGKSVVVWIN  133

Query  141  NPKSKNSTILGVSMS---------------AAVGYASQ-TPPEAMYVDGDSVKLEYYYNH  184
            NP  +   I+GVSMS               A  GY  +    E  Y+ G +  L + Y  
Sbjct  134  NPGFETPKIVGVSMSKSDTKYYKETKIGPFAFAGYRKEGRRSERAYIYGSNTSLRFQYES  193

Query  185  LLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQEL  244
             LGS+ L   +  GE+QDLI W++L+  AR +LN  +      +    ++P  D  +++ 
Sbjct  194  GLGSSYLSFADCDGEYQDLIMWEQLTDAARAALNDGN------NFGDAEVPFSDEHYKQH  247

Query  245  LDKAWPF  251
            LDKAWP 
Sbjct  248  LDKAWPL  254

>PHYCA_69122
Length=249

 Score = 168 bits (425),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 140/246 (57%), Gaps = 31/246 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIAD-GCHPYPAVQKDGSITGGLKWSGPQDG  80
            + HDQ+ PFPQP+PVTVS+KAA+KFKPQL      C P+PAV   G ITGGLK +   DG
Sbjct  17   VNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKLVCVPFPAVNTAGEITGGLKGTNGNDG  76

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             C  +  G+QIY R+ W  D+WAIMY+WYFPKG G    P  TR    RH+W+ ++VWID
Sbjct  77   -CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDSP--TR----RHDWKNIVVWID  129

Query  141  NPKSKNSTILGVSMSAA-VGYASQTPPEAMYVDGDSV--KLEYYYNHLLGSTSLQLTEDT  197
            NP  +   I+GV+MS +   Y+ +      Y  G     +      +L  +TSL+   DT
Sbjct  130  NPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYLGSNTSLRFEYDT  189

Query  198  --------------GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQE  243
                          GE+QDLI W++L+  AR +LN    D   F+ A  ++P  D  +++
Sbjct  190  SDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALN----DGKSFEKA--EVPFSDEHYED  243

Query  244  LLDKAW  249
             L KAW
Sbjct  244  HLGKAW  249

>PHYCA_109192
Length=278

 Score = 169 bits (427),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/279 (38%), Positives = 137/279 (49%), Gaps = 71/279 (25%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP PVTVS+KAAVK+KPQL I  GC  +PAV   G ITGGLK +   DG 
Sbjct  22   IDHDKVQPFKQPDPVTVSEKAAVKYKPQLVIGSGCVSFPAVNAAGDITGGLKGTKSTDG-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPK----GRGAVPLPLITRLFGHRHNWEYVIV  137
            CT + LGSQ+Y RS W  D WA+M+AWYFPK    G G             RH W  ++V
Sbjct  81   CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPKNFWGGEGE-----------SRHLWSNMVV  129

Query  138  WIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYV--------------------------  171
            WIDNP  +   ILG S+S      +  PP+A+++                          
Sbjct  130  WIDNPALETPKILGASLSRQ----TLDPPKALFLFSLADRQKVPYKKVTGIDPMHFVGMQ  185

Query  172  ---DGDSVKLEYYYNHLLGSTS----------------LQLTEDTGEFQDLITWDELSKL  212
                G   +  Y YN+  GS +                L+     GE+QDLI W++L+  
Sbjct  186  AIQTGRIGRYRYTYNYTGGSNTSTRVYHGFPDSSAWIGLEFVNVNGEYQDLIMWNQLTDQ  245

Query  213  ARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            AR +L   D+ E        K+P  D  F+  L +AWPF
Sbjct  246  ARATLESADFGEK------TKVPFNDKNFEAALAQAWPF  278

>PHYRA_72403
Length=239

 Score = 167 bits (423),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 132/233 (57%), Gaps = 18/233 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKI--ADGCHPYPAVQKDGSITGGLKWSGPQD  79
            I HD+V+PFPQP PVT+++K+ VKFKP+L I    GC  YPAV   G  +GGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGTKGTS  81

Query  80   GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139
              CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG         +R +  RH+W   +VWI
Sbjct  82   A-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGF------WDSRAYW-RHDWSNAVVWI  133

Query  140  DNPKSKNSTILGVSMSAAVG-YASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            D+P  +N  +LG+S+S +   Y  +  P     +G +  L Y          L     +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYECAELVPYYASG  192

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            E QDLI WD+L+  AR +LN  D      +    ++P+ D  F + L+KAWP 
Sbjct  193  EVQDLIMWDQLTDAARAALNDQD------NFGRTEVPINDDHFLKHLEKAWPL  239

>PHYSO_516261
Length=227

 Score = 166 bits (421),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 123/230 (53%), Gaps = 24/230 (10%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD V+PF QP PVTVS+KAAVKF+P L +  GC P+PAV   G  +GGLK +G   G 
Sbjct  22   IDHDAVQPFAQPNPVTVSEKAAVKFQPLLFVESGCVPFPAVNSAGETSGGLKGTGGTSGC  81

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
                  GSQ+Y R+ W  D WAIMYAWYFPKG         +R     H+W  ++VWIDN
Sbjct  82   KEAGATGSQVYGRAVWYKDDWAIMYAWYFPKG-------FWSRWASRHHDWASIVVWIDN  134

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQ  201
            P  +   ++G+S S          P+ +          Y     L     QL +  G+ Q
Sbjct  135  PALETPKMIGISTSEGDNDYRTAGPDDV----------YETTPRLRRVLAQLFKILGDTQ  184

Query  202  DLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             LI W++L+  AR +LN TD+ +        K+P+ D  FQ  L+KAWPF
Sbjct  185  PLIMWEQLTDEARITLNTTDFGKA-------KVPMSDANFQGKLEKAWPF  227

>PHYCA_114913
Length=224

 Score = 166 bits (420),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 126/227 (56%), Gaps = 26/227 (11%)

Query  25   DQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECTG  84
            D+V PFP+ +P T+S KAAV+ KPQL I+ GCHPY AV   G IT G+  +  +D +C+G
Sbjct  21   DKVEPFPELEPTTISQKAAVRLKPQLHISKGCHPYAAVNAAGEITAGI--TTTRDPDCSG  78

Query  85   SKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKS  144
              +GSQ+Y RS W  DVWAIMYAWYFP         LI       H+W+ ++VWIDNP  
Sbjct  79   RGIGSQVYVRSTWYKDVWAIMYAWYFPSS-------LI-------HDWKNIVVWIDNPSL  124

Query  145  KNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLI  204
                +LGVS     GY           DG S K++Y Y        L  T   GEFQ+LI
Sbjct  125  AVPRVLGVSAQVDGGYLRYNKFNWDKFDGASPKIKYDY------PDLDWTSKRGEFQNLI  178

Query  205  TWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             WD+L++ AR +LN+T++           +P  D  F+  LD A P+
Sbjct  179  MWDQLTEAARTALNNTNFKGN----GDATVPFIDANFKANLDFAIPY  221

>PHYSO_253029
Length=252

 Score = 167 bits (422),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 125/232 (54%), Gaps = 16/232 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADG-CHPYPAVQKDGSITGGLKWSGPQDG  80
            I  ++V PF QP   T + KAAVKFKP+L I  G C  +PAV   G  + GL   G    
Sbjct  22   IDLNKVAPFAQPTASTSAQKAAVKFKPRLSIGSGACVSFPAVNSAGDTSSGLSEEGKGST  81

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
            +CT + LGSQ+Y R+AW N  +AI+YAWYFPKG               RH+W   +VWID
Sbjct  82   DCTNAPLGSQVYGRAAWYNTRFAILYAWYFPKG-------FWNDYPTRRHDWASAVVWID  134

Query  141  NPKSKNSTILGVSMSAAV-GYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199
            NP S    ILG+S+S A   Y++Q P  +   DG + KL +  +   G   L  T+ +G+
Sbjct  135  NPDSNTPKILGLSLSTADWEYSTQAPATSGISDGTTPKLSHELSVECGDPYLTTTDGSGD  194

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            FQ LI W++L+  AR +LN         D    K+P  D  F+  L  AWPF
Sbjct  195  FQPLIMWEQLTTAARTALNSA-------DFGNAKVPTSDVNFEMKLKSAWPF  239

>PHYKE_8391
Length=778

 Score = 177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 10/144 (7%)

Query  105  MYAWYFPKGR---GAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYA  161
            MYAWYFPKGR   G   L       GHRHNWEY IVWIDNP   NSTILGVSMSA+ GY+
Sbjct  1    MYAWYFPKGRKITGGAGL-------GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYS  53

Query  162  SQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTD  221
              +PP+A +VDG SVKL+YYY+ + G+T+L+ TED GE QDLITWD+L  +A+ +LN+TD
Sbjct  54   KSSPPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTD  113

Query  222  WDETLFDLAGLKMPLKDGVFQELL  245
            WD TL+++  +KMPLKDG F + L
Sbjct  114  WDTTLWNMCDVKMPLKDGEFTKNL  137

>PPTG_03796
Length=255

 Score = 167 bits (422),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 149/269 (55%), Gaps = 32/269 (12%)

Query  1    MNFRIvllvlvaslagaqaqvIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIA--DGCHP  58
            M  R+++ VL A+L G  A  + HD+V PFPQP P T+S+KAA+KFKPQL  A  + C  
Sbjct  1    MELRVLVTVLFAALVGYVAATVDHDKVEPFPQPDPATISEKAAIKFKPQLYSAKLEYCVS  60

Query  59   YPAVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVP  118
            +PAV   G +TGGLK +   D  C  + LGSQIY R+ W ND WAIMYAWYFPKG     
Sbjct  61   FPAVNAVGEVTGGLKGTNGNDA-CRLAPLGSQIYGRAGWHNDRWAIMYAWYFPKG---FY  116

Query  119  LPLITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAA---------------VGYASQ  163
            + L TR    RH+W+ V+VWIDN + +   ILGVS S +                GY  Q
Sbjct  117  MGLPTR----RHDWKSVVVWIDNAELETPKILGVSTSVSDTRYKRDLVIFPRNFAGYQLQ  172

Query  164  TPP-EAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDW  222
             P      V G +  L +     L    +   +  GE+QDLI W++L+  AR +LN    
Sbjct  173  GPRFHHTEVFGSNTSLRFKIWPTLFVPYMGFADFDGEYQDLIMWEQLTDAARAALN----  228

Query  223  DETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            D+  F  A  ++P  D  ++E L+ AWPF
Sbjct  229  DDNNFGRA--EVPFSDTHYKEHLENAWPF  255

>PHYCA_109089
Length=277

 Score = 167 bits (424),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 139/274 (51%), Gaps = 64/274 (23%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+KAAVKFKPQ+ I DGC P+PAV   G ++GGL  +   DG 
Sbjct  24   INHDQVQPFAQPEPVTISEKAAVKFKPQIHITDGCVPFPAVNAAGEVSGGLNPTKYTDG-  82

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGH-RHNWEYVIVWID  140
            CT S +GSQ+Y R++W  D WAIMYAWYFPK   A         F   RH W  +++W+D
Sbjct  83   CTESPMGSQVYGRASWYRDHWAIMYAWYFPKNFRA--------FFARGRHGWANMVLWLD  134

Query  141  NPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYY--YNHL--LGSTSLQLTED  196
            NP  +N  +LG S+S     A +     +++  D  + E Y  +N +  +G   +Q    
Sbjct  135  NPALENQKLLGASLSQQTLKAEKI----LFIPLDEREKEPYQKFNGIPPMGFVGMQEIRH  190

Query  197  T---------------------------------------GEFQDLITWDELSKLARYSL  217
            T                                       GE+QDLI W++L+  AR  L
Sbjct  191  TQLSRWSWNYTYEGGSNVSTRVIHMMDKFDWIHLSFLGRDGEYQDLIMWEQLTDEARAGL  250

Query  218  NHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            N  D+ +T         P  D  F+  L+KAWPF
Sbjct  251  NSADFGDTF-------APFTDDNFKTALEKAWPF  277

>PHYSO_521124
Length=254

 Score = 167 bits (422),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 136/244 (56%), Gaps = 31/244 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I +D+V+PFP+ +P T+S+KAA+K+KP L I DGCH Y AV   G  +GG+    P  G 
Sbjct  11   IDYDKVQPFPELEPKTISEKAAIKYKPSLAIWDGCHSYAAVNAAGDTSGGMDPKAPDGGT  70

Query  82   ---------CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKG-----RGAVPLPLITRLFG  127
                     C GS LGSQ+Y+RS W  DVWAIMYAWYFP+        + P+        
Sbjct  71   QVQNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWYEESSPPV--------  122

Query  128  HRHNWEYVIVWIDNPKSKNSTILGVSMS-AAVGYASQTPPEAMYVDGDSVKLEYYYNHLL  186
             RH+W   IVW+DNP  +N ++LGVS S     Y +  P    Y++G   K+EYY   ++
Sbjct  123  -RHDWINTIVWLDNPALENPSLLGVSASREGAVYVTYPPTVKGYMNGTHPKMEYYLGFIV  181

Query  187  GS-TSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELL  245
            G   ++ ++ + G+FQDL+ W +L+  AR +L   D+           +P  D  F++ L
Sbjct  182  GGYHTIDVSLEAGDFQDLVHWSQLTDQARKALETADFGVV------TPVPFNDVNFEKNL  235

Query  246  DKAW  249
            ++ W
Sbjct  236  ERGW  239

>PHALS_14423
Length=379

 Score = 170 bits (431),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 137/235 (58%), Gaps = 17/235 (7%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            +  ++V+PF Q KP T S K+A+K++P+L +   C+PYPAVQ DGS++ GL W       
Sbjct  157  VNVNEVQPFKQRKPTTDSQKSAIKYQPRLYVLGACYPYPAVQADGSLSEGLPWKIFFQSR  216

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS  GSQIY+RS W    WAIMYAWY P+         I  + GH H W +V+VW D+
Sbjct  217  CNGSPRGSQIYSRSDWYRGKWAIMYAWYLPRALDQN----IWDVDGHSHFWTFVVVWTDS  272

Query  142  PKSKNSTILGVSMSAAVGYASQ-TPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199
            P    STIL  S S       + +P ++ Y ++  S+K++ + NH    T L+LTE  GE
Sbjct  273  PDPDVSTILAASTSGVGNRIKKYSPLKSKYLLNHKSLKVKLHENHFWDKTGLKLTEKVGE  332

Query  200  FQDLITWDELSKLARYSL---NHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
             Q LITW++L+  AR +L   +++DW         ++ P++D  F+ +L  A+PF
Sbjct  333  LQTLITWEQLTDEARAALSSVHYSDWR--------MESPIQDKWFRPMLSSAYPF  379

>PITG_23094
Length=237

 Score = 166 bits (420),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 136/232 (59%), Gaps = 23/232 (10%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            +D+V PFP+  P T  +K A+KFKPQL I+ GCHPYPAV  DG+   GL  +      C 
Sbjct  24   YDEVVPFPEVLPTTTENKVALKFKPQLHISSGCHPYPAVDADGNTNAGLGITKVFTS-CE  82

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
            GS  GSQ+Y R      V AIMYAWYFP+     P+       GHRH+WE+ IVW+D   
Sbjct  83   GSPQGSQVYGRMTEYEGVVAIMYAWYFPREFMVSPV-----WVGHRHDWEHAIVWLDGLG  137

Query  144  SKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYY----NHLLGSTSLQLTEDTGE  199
            ++ + +L V++   +GY +  PP+A ++DG S K++Y +     H L +T+     + GE
Sbjct  138  TR-AEVLAVTVQQLLGYKTYKPPKAKHMDGSSAKIKYTWLIQTQHYLSATT-----EAGE  191

Query  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            FQDLI W+ ++  A+ +L  T +    +  A    P+ +G FQ+ ++KA+PF
Sbjct  192  FQDLIMWENMTAAAQEALEDTKF---FWSWA----PINEGQFQDNIEKAYPF  236

>PHYCA_124383
Length=280

 Score = 167 bits (423),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 134/270 (50%), Gaps = 55/270 (20%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HDQV+PF QP+PVT+S+KAAVK+KP L I DGC  +PAV   G ITGGLK       +
Sbjct  26   IDHDQVKPFRQPEPVTISEKAAVKYKPLLSIGDGCVSFPAVNTAGEITGGLK-GTKNTKD  84

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CT + LGSQ+Y RSAW  D WA+MY WYFPK   A            RH+W  V+VWIDN
Sbjct  85   CTEAPLGSQVYGRSAWYQDKWAMMYTWYFPKNFCAYKA-------AGRHDWANVVVWIDN  137

Query  142  PKSKNSTILGVSMSA-----------AVGYASQTP-------PEAMYVDGDSV------K  177
            P  +N+T LG S+S            A+    + P       P   +   + +      +
Sbjct  138  PALENATFLGASLSQQTLEPIKLVFLALAQRKEEPYENQKEIPMMAFAGTEQIATAMVGR  197

Query  178  LEYYYNHLLGSTS----------------LQLTEDTGEFQDLITWDELSKLARYSLNHTD  221
              Y Y ++ GS +                +      GE QDLI W++L+  AR +L   D
Sbjct  198  WSYIYKYVGGSNTTMRFIHKYPQKFAWIGMSFAYSDGESQDLIMWNQLTDKARAALESAD  257

Query  222  WDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            +  T       ++P  D  F+  L  AWPF
Sbjct  258  FGNT-------QVPFTDKNFETNLQAAWPF  280

>PHYCA_109163
Length=247

 Score = 166 bits (421),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 138/241 (57%), Gaps = 26/241 (11%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKI-ADGCHPYPAVQKDGSITGGLKWSGPQDG  80
            + HDQ+ PFPQP+PVTVS+KAA+KFKPQL    + C P+PAV   G +TGGLK +   +G
Sbjct  22   VDHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPGNLCAPFPAVNAAGEVTGGLKGTN-GNG  80

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             C  +  G+Q+Y R+ W  DVWAIMY+WYFPKG   +  P  TR    RH+W+ V+VWID
Sbjct  81   ACKHATKGAQVYGRAGWYKDVWAIMYSWYFPKGFNWLGFP--TR----RHDWKNVVVWID  134

Query  141  NPKSKNSTILGVSMSAA-VGYASQTPPEAMYVDGDSVKLE---------YYYNHLLGSTS  190
            NP  +   I+GV++S +   Y         Y  G  ++ +         ++YN  +  + 
Sbjct  135  NPALETPKIVGVALSKSDTKYRKVREVWPPYFVGSEIRYDSSPASSTNIHFYN--VAGSD  192

Query  191  LQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWP  250
            L      GE+ DLI W++L+  AR +LN++++          ++P  D  ++  LD+A P
Sbjct  193  LDFARWDGEYHDLIMWEQLTDAARVALNNSEF------FGDAEVPFSDEHYENHLDRACP  246

Query  251  F  251
             
Sbjct  247  L  247

>PPTG_15220
Length=236

 Score = 166 bits (419),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 132/236 (56%), Gaps = 27/236 (11%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            + +D+V PFP+  P T   K A+KFKPQL I++GCHPYPAV  DG+   GL  +      
Sbjct  22   LEYDEVAPFPEVLPTTTESKVALKFKPQLHISNGCHPYPAVDADGNTNAGLGITEVLTS-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C GS LGSQ+Y R      V AIMYAWYFP+     P+       GHRH+WE+ IVW+D+
Sbjct  81   CKGSPLGSQVYGRVTEYEGVVAIMYAWYFPRDYMVSPM-----WVGHRHDWEHAIVWLDS  135

Query  142  PKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYY----NHLLGSTSLQLTEDT  197
              + ++ +L V+    +GY +  PP A ++DG SVKL+Y +     H L +T+       
Sbjct  136  LDT-SAELLAVTAQHLLGYKTYKPPRAKHMDGSSVKLKYTWLIQTQHYLSATT-----KA  189

Query  198  GEFQDLITWDELSKLARYSLNHTD--WDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            G+FQDL  W  ++  A+ +L  T   W +          P+ D  FQ  ++KA+PF
Sbjct  190  GKFQDLAMWSNMTDAAQDALGSTKFFWSQA---------PMNDAKFQSNIEKAYPF  236

>PHYCA_109162
Length=257

 Score = 166 bits (421),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 134/251 (53%), Gaps = 36/251 (14%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADG-CHPYPAVQKDGSITGGLKWSGPQDG  80
            + HD++ PFPQP+PVTVS+KAA+KFKPQL      C P+PAV   G +TGGL  +   D 
Sbjct  22   VDHDKIEPFPQPEPVTVSEKAAIKFKPQLYTHKQLCAPFPAVNAAGEVTGGLSGANGNDA  81

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             C  +  G+Q+Y R+ W  DVWAIMY+WYFPKG   +  P  TR    RH+W+ V+VWID
Sbjct  82   -CKYALKGAQVYGRAGWYKDVWAIMYSWYFPKGFNWLGFP--TR----RHDWKNVVVWID  134

Query  141  NPKSKNSTILGVSMSAA---------------VGYASQTPPEAMYVD-----GDSVKLEY  180
            NP+ +   I+GV+M+ +               VG   Q              G S  L +
Sbjct  135  NPELETPKIIGVAMAGSDTKYRREREMYNSNFVGSQVQVTRRDRRYYRSDSPGSSTNLRF  194

Query  181  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  240
                  G+T L      G++QDLI W++L+  AR +LN    D   F  +  ++P  D  
Sbjct  195  EN----GATHLDFARQDGDYQDLIMWEQLTDAARIALN----DNGSFGYSYAEVPFSDEH  246

Query  241  FQELLDKAWPF  251
            F+   DKAWP 
Sbjct  247  FEANRDKAWPL  257

>PHYRA_83851
Length=239

 Score = 166 bits (419),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 132/235 (56%), Gaps = 22/235 (9%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PFPQP PVT+S+KA VKFKPQL    GC  YPAV   G  +GGLK +G   G 
Sbjct  22   IAHDEVQPFPQPDPVTISEKAGVKFKPQLHFEGGCAAYPAVNAAGETSGGLKGNGDISG-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR-GAVPLPLITRLFGH-RHNWEYVIVWI  139
            C  S LGSQ+Y RS W NDVWAIMYAWYFPKG   A P         H RH+W   ++WI
Sbjct  81   CEISLLGSQVYGRSEWYNDVWAIMYAWYFPKGFWDADP---------HWRHDWSNAVLWI  131

Query  140  DNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG-  198
            DNP  +N  ILG+S+S +          +  ++  +  L      +  S +L  ++  G 
Sbjct  132  DNPALENPKILGLSLSTSENKYHTKNTYSPTINSTAPALCRDLPSV-ASAALVSSDVCGR  190

Query  199  --EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
              E QDLI W +L+  AR +LN  D      +    ++P+ D  F + L++AWP 
Sbjct  191  PLETQDLIMWGQLTDAARAALNDQD------NFGRTEVPISDDHFPKHLEEAWPL  239

>PHYCA_10570
Length=278

 Score = 166 bits (421),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 135/274 (49%), Gaps = 61/274 (22%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PF QP PVTVS+KAA+K+KPQL I  GC  +PAV   G ITGGLK +   DG 
Sbjct  22   IDHDKVQPFKQPDPVTVSEKAALKYKPQLVIGGGCVSFPAVNAAGDITGGLKGTKSTDG-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPK---GRGAVPLPLITRLFGHRHNWEYVIVW  138
            CT + LGSQ Y RS W  D WA+M+AWYFPK   G GA            RH W  ++VW
Sbjct  81   CTEAPLGSQAYGRSTWYQDKWAMMFAWYFPKNFWGGGA----------DSRHLWSNMVVW  130

Query  139  IDNPKSKNSTILGVSMS------------------AAVGYASQTPPEAMYVDGDSV----  176
            IDNP  +   ILGVS+S                    V Y   T  + M   G       
Sbjct  131  IDNPSLETPKILGVSLSQQTIDVPKLFYMFPLVNRQKVPYKKVTAIKPMDFAGMQAIKTG  190

Query  177  ---KLEYYYNHLLGSTS----------------LQLTEDTGEFQDLITWDELSKLARYSL  217
               +  Y YN+  GST+                L      GE+QDLI W++L+  AR +L
Sbjct  191  RIGRHRYTYNYTGGSTTSTRVYNGYTDQSGWHGLDFVNADGEYQDLIMWNQLTDQARSAL  250

Query  218  NHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
               D+ E        K+P  D  F+  L +AWPF
Sbjct  251  ESADFGEK------TKVPFDDKNFEAALTQAWPF  278

>PHYRA_76603
Length=239

 Score = 164 bits (415),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 128/233 (55%), Gaps = 18/233 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKI--ADGCHPYPAVQKDGSITGGLKWSGPQD  79
            I HD+V+PFPQP PVT+++K+ VKFKP+L I    GC  YPAV   G  +GGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCVSYPAVNSAGETSGGLKGTKGTS  81

Query  80   GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139
              CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG          R    RH+W   +VWI
Sbjct  82   A-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWDRRAYWRHDWSNAVVWI  133

Query  140  DNPKSKNSTILGVSMSAAVG-YASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            D+P  +N  +LG+S+S +   Y  +  P     +G +  L Y          L     +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAELVPYYASG  192

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            E QDLI W +L+  AR +LN         +    ++P+ D  F + L+KAWP 
Sbjct  193  EVQDLIMWGQLTDAARAALNDQG------NFGRTEVPINDDHFLKHLEKAWPL  239

>PHYCA_109095
Length=277

 Score = 165 bits (417),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 137/270 (51%), Gaps = 54/270 (20%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            IGHD+V+PF QP PVT+S+KAAVK+KPQL I D C  +PAV   G ITGGLK +   D  
Sbjct  22   IGHDKVQPFAQPDPVTISEKAAVKYKPQLVIFDSCVSFPAVNAAGDITGGLKGTSGTDA-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            CT + LGSQ+Y RS W    WA+M+AWYFPK        L +R    RH W  +++W+DN
Sbjct  81   CTKAPLGSQVYGRSTWYQGKWAMMFAWYFPKNF----WNLESR---SRHLWANMVLWLDN  133

Query  142  PKSKNSTILGVSMSAAV-----------------GYASQTP-PEAMYVDGDSV------K  177
            P  +  TILG S+S                     Y+  TP P   +V    +      +
Sbjct  134  PALETPTILGASLSRQTLEVPKWLFIPSGVQQKNSYSKATPIPPMGFVGTQQIRTARIGR  193

Query  178  LEYYYNHLLGST----------------SLQLTEDTGEFQDLITWDELSKLARYSLNHTD  221
             +Y YN+  GST                 L  T   G++QDLI W++L+  AR +L   D
Sbjct  194  FQYTYNYTGGSTISTRVSQSYPDTSGWVGLDFTYLDGQYQDLIMWNQLTDQARAALESAD  253

Query  222  WDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            +          K+P  D  F+  L +AWPF
Sbjct  254  FGR------DTKVPFNDKNFEAALAQAWPF  277

>PHALS_13512
Length=243

 Score = 163 bits (412),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 133/228 (58%), Gaps = 17/228 (7%)

Query  29   PFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECTGSKLG  88
            PF QP P T S K+A+K++P+L +   C+PYPAVQ +GS++ GL W      +C GS  G
Sbjct  28   PFKQPTPTTDSQKSAIKYQPRLYVVSDCYPYPAVQANGSLSYGLPWEVFAPTKCNGSPYG  87

Query  89   SQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPKSKNST  148
            SQIY+RS W   +WAIMYAWY P+            + GHRH W +V+VW ++P    ST
Sbjct  88   SQIYSRSDWYRGMWAIMYAWYLPRALDHSSW----LVDGHRHFWTFVVVWTNSPDPNVST  143

Query  149  ILGVSMSAAVGYASQ-TPPEAMY-VDGDSVKLEYYYNHLLGSTSLQLTEDTGEFQDLITW  206
            IL  S S       +  P ++ Y +D  ++K++ Y N+ L  T L+LT+  G+ Q LITW
Sbjct  144  ILAASTSGTDNRIKKYLPVKSKYLLDRRTLKVKLYQNYWLDKTGLKLTDKVGDLQPLITW  203

Query  207  DELSKLARYSL---NHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            ++L+  AR +L   ++ DW         ++ P++D  F+ +L  A+PF
Sbjct  204  EQLTDEARAALSSFHYPDWR--------METPIQDKWFRYMLSSAYPF  243

>PITG_22709
Length=281

 Score = 163 bits (413),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/266 (38%), Positives = 136/266 (51%), Gaps = 53/266 (20%)

Query  24   HDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECT  83
            HDQV+PF QPKP T+S+KAAVK++PQL + DGC  +PAV   G ITGGLK +   DG CT
Sbjct  31   HDQVQPFAQPKPATISEKAAVKYRPQLHVLDGCASFPAVNAAGDITGGLKPTKGTDG-CT  89

Query  84   GSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDNPK  143
             + LGSQ+Y RS W  D WA+M+AWYFPKG        IT     RH W  +++W+DNP 
Sbjct  90   EAPLGSQMYGRSKWYQDRWAMMFAWYFPKG-------FITGQPRIRHYWMNMVLWLDNPA  142

Query  144  SKNSTILGVSMSAAVGYASQ-----------------TPPEAMYVDGDSV------KLEY  180
             +  TILG S+S  +    +                 T P   +V    +      +  +
Sbjct  143  LETPTILGASLSQRLLKPRRWMGLKLTEEKDPYRKFTTIPPIGFVGTKEIRQNRLTRTRW  202

Query  181  YYNHLLGST---------------SLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDET  225
             + +  GS                 L  +   G++ DLI WD+L+  AR +LN  D+ E+
Sbjct  203  NFTYEGGSNISTRVFTVIDSKDWLPLTFSYYDGQYHDLIMWDQLTDEARAALNSADFGES  262

Query  226  LFDLAGLKMPLKDGVFQELLDKAWPF  251
                   K+P  D  F+ LL  AWPF
Sbjct  263  -------KVPFNDENFEALLSLAWPF  281

>PHYRA_72541
Length=239

 Score = 162 bits (410),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 132/233 (57%), Gaps = 18/233 (8%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKI--ADGCHPYPAVQKDGSITGGLKWSGPQD  79
            I HD+V+PFPQP PVT+++K+ VKFKP+L I    GC  YPAV   G  +GGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGTKGTS  81

Query  80   GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139
              CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG         +R +  RH+W   +VWI
Sbjct  82   A-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGF------WDSRAY-WRHDWSNAVVWI  133

Query  140  DNPKSKNSTILGVSMSAAVG-YASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTG  198
            D+P  +N  +LG+S+S +   Y  +  P     +G +  L Y          L     +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAELVPYYASG  192

Query  199  EFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251
            E QDLI W +L+  AR +LN    D+  F     ++P+ D  F + L+KAWP 
Sbjct  193  EVQDLIMWGQLTDAARAALN----DQGNF--GRTEVPINDDHFLKHLEKAWPL  239

>PPTG_10591
Length=254

 Score = 162 bits (411),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 130/247 (53%), Gaps = 31/247 (13%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADG-CHPYPAVQKDGSITGGLKWSGPQDG  80
            I HD+V+ FPQP+PVT S+K A+KFKP+L      C PYPAV   G ++GGLK +   D 
Sbjct  22   IDHDKVQAFPQPEPVTASEKTAIKFKPRLYTPRHVCVPYPAVNAAGEVSGGLKGTNGNDA  81

Query  81   ECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWID  140
             C  S  GSQ+Y R+ W  D+WAIMY WYFPKG               RH+W+ V+VWI+
Sbjct  82   -CKYSIQGSQVYGRAGWYRDLWAIMYTWYFPKG-------FFADFASKRHDWQNVVVWIN  133

Query  141  NPKSKNSTILGVSMSAA-VGYASQTPPEAMY---------------VDGDSVKLEYYYNH  184
            NP  +   I+GVSMS     Y ++    A Y               + G +  L + Y  
Sbjct  134  NPDLEWPKIVGVSMSNVDSEYTTKLEMMAYYFSGYRMEGTRGYRRSIYGSATSLRFAYEM  193

Query  185  LLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQEL  244
            +L S  L   ++ GE+Q LI W++L+  AR +LN +       +    ++P  D  + + 
Sbjct  194  ILTSPYLDFADEDGEYQSLIMWEQLTDAARAALNDSS------NFEEREIPFSDEHYMDH  247

Query  245  LDKAWPF  251
            L+ AWP 
Sbjct  248  LEMAWPL  254

>PPTG_13004
Length=255

 Score = 162 bits (410),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/249 (37%), Positives = 138/249 (55%), Gaps = 34/249 (14%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            +  D V+PF QP+PVTV +K A+KFKP L I  GC  +PAV + G+I+ GL+     DG 
Sbjct  22   VDCDFVKPFAQPEPVTVLEKVALKFKPTLLIDGGCVSFPAVNEAGAISSGLRPLNGNDG-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWIDN  141
            C  +  GSQ+Y RS    D WAIM+AWYFPKG         + +   RH+W  ++VWID+
Sbjct  81   CIKAPQGSQVYGRSTQFQDKWAIMFAWYFPKG-------FWSGMPSRRHDWASMVVWIDD  133

Query  142  PKSKNSTILGVSMSAAVG-YASQTPPEA----------------MYVDGD--SVKLEYYY  182
            P  +   +LGVS+S +   Y   T P +                 YV+G   S+++ +  
Sbjct  134  PDFETPKLLGVSLSKSKKRYTKATAPLSEVYFAGFQEYGRRGYKTYVNGSSTSIRISHSS  193

Query  183  NHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQ  242
                G  SL L+   G++QDLI W +L++ AR +LN  ++ +++       +P  D  F+
Sbjct  194  GFFFGPASLDLSTRDGDYQDLIMWKQLTEEARKALNSANFGKSV-------VPFNDDNFE  246

Query  243  ELLDKAWPF  251
            ++L+KAWPF
Sbjct  247  DMLEKAWPF  255

>PHYRA_52296
Length=237

 Score = 161 bits (407),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 126/232 (54%), Gaps = 20/232 (9%)

Query  22   IGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGE  81
            I HD+V+PFPQP PVT+S+KA VKFK  L I +GC  YPAV   G  +GGLK SG   G 
Sbjct  22   IAHDEVQPFPQPDPVTISEKAGVKFKIPLNIQEGCASYPAVNAAGETSGGLKGSGGISG-  80

Query  82   CTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGR-GAVPLPLITRLFGHRHNWEYVIVWID  140
            C  S LGSQ+Y R+ W NDVWAIMYAWYFPKG   + P          RH+W   I+WID
Sbjct  81   CELSLLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDSTPW--------WRHDWSNAILWID  132

Query  141  NPKSKNSTILGVSMSAA---VGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDT  197
            NP  +N  ILG+S+S +    G  +  PP           +       +    +  T   
Sbjct  133  NPAHENPKILGLSLSTSENKYGNKNTYPPAENSTXSPLSPIAVRRKCCISDLHVCGTPPP  192

Query  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAW  249
             E QDLI W +L+  AR +LN  D      +    ++P+ D  F + L++AW
Sbjct  193  -ENQDLIMWSQLTDAARAALNDQD------NFGRTEVPISDDHFPKHLEEAW  237

Lambda      K        H        a         alpha
   0.319    0.137    0.442    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13725911664

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40