Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_129425147522041799821e-136
PPTG_17122147522041798641e-118
PHYSO_284086147522041798572e-117
PHYKE_8389147522041808391e-114
PITG_18450147522031778032e-109
PHYRA_81106147522021807782e-105
PPTG_17121568762021807382e-99
PHYSO_477820568762021797217e-97
PHYCA_511409568762041807201e-96
PHYRA_81107568762021807173e-96
PHYKE_8388568762051797027e-94
PYVX_18176568762011787011e-93
PHYRA_82864231281931656963e-93
PHYCA_14369109792481656938e-92
PPTG_15264231281941716871e-91
PPTG_17366239131941716871e-91
PHYSO_341599109791851716842e-91
PPTG_10635528561991716827e-91
PHYRA_85631109792281806803e-90
PHYKE_3446231281991656741e-89
PPTG_10636109792461666772e-89
PYVX_18174854042041796672e-88
PHYRA_84190720132061716662e-88
PHYSO_536424606911971706653e-88
PHYSO_507031586531971706653e-88
PPTG_10634720132081616646e-88
PHYCA_102852242061951686618e-88
PHYKE_7718109792201656603e-87
PPTG_10643457052501786591e-86
PHYCA_102550457052681646557e-86
PHYCA_102624720131951686427e-85
PPTG_10048213141901656341e-83
PHALS_00498109791991656202e-81
PYU1_G001741854041991706053e-79
PYU1_G001742932042131805995e-78
PYIR_25089854042621706035e-78
PYVX_18173449665001616201e-77
PYIR_26626147522121695917e-77
PYU1_G001744568762131805812e-75
PYU1_G001740147522061615803e-75
PHALS_03284309411881655566e-72
PHYSO_499978231281741405452e-70
PHYSO_501575820771741405452e-70
PPTG_0882086622501695411e-68
PYU1_G001739932032661665333e-67
PITG_13520109791711315165e-66
PHYCA_510817445761881665114e-65
PPTG_14254445761881665098e-65
PHYSO_254168462841701565052e-64
PHYSO_343376532371721315035e-64
PPTG_14255469372681695081e-63
PITG_1049986623231615088e-63
PHYSO_417649445761851664881e-61
PYAP_22278932042891724935e-61
PHYKE_9185445762811664882e-60
PYAR_24096932032271654754e-59
PYAP_22279854042231714712e-58
PHYCA_53693413059831664984e-57
PYIW_18791854041941644586e-57
PHYSO_341596528562311234608e-57
PYAP_22273932032681654577e-56
PHYSO_262732469371881704446e-55
PHYCA_14368528562191644433e-54
PYIR_26546866052391644192e-50
PHYSO_527908600641741524081e-49
PYU1_G001738534612261614086e-49
PHYSO_246676457051871654048e-49
PHYRA_81105534612011634004e-48
PPTG_17123147532011623928e-47
PHYCA_537323449662001633882e-46
PHYSO_340369526762001653762e-44
PITG_18452147538561604024e-44
HYAP_07096534612511603751e-43
PHYSO_353401534611461423616e-43
PYIW_18788932032441633411e-38
PYAP_18131991722261162955e-32
PYIW_18792932041251012813e-31
PYIR_1644442341821662785e-30
PYU1_G007476539131951392796e-30
PYIR_1643542333041272787e-29
PHYSO_342364529831941392692e-28
PYAP_246891014392521872714e-28
PHYKE_10578778802391952642e-27
PYIW_19151831912481362643e-27
PHYRA_78625541464341692733e-27
PHYRA_78626578954731692734e-27
PYIR_16443823992751792639e-27
PYAP_18709943552351672572e-26
PYAP_18711943562101812527e-26
PHYRA_7358242353261912581e-25
PYU1_G005324845341911372491e-25
PYU1_G005326463491911372491e-25
PYU1_G00532842331911372491e-25
PHYCA_13036542352661332541e-25
PITG_0494942353371802563e-25
PYVX_1817514752147632433e-25
PPTG_0461842353261802544e-25
PHYKE_81047713586602367e-25
PYAR_14260845342121372451e-24
PHYSO_48395542353201362511e-24
PPTG_04622696962731382481e-24
PITG_0494842342321322451e-24
PHYSO_533903604652081382413e-24
PYU1_G005325943562071312404e-24
PHYRA_74651699693441342476e-24
PYIW_27477823991801812377e-24
PHYRA_73607194343431372459e-24
PHALS_0317644782071532381e-23
PYU1_G01469042342951322421e-23
PPTG_0461942342761322411e-23
PHYCA_12942213313531722432e-23
H310_0636217301971302352e-23
PHYSO_48552442342781322393e-23
PYU1_G005323943552511322364e-23
PHYSO_438103557212381762355e-23
SDRG_165351259803131892387e-23
PYU1_G007364851643161382388e-23
PYAR_14256943551991362319e-23
PHYRA_7868968382961372361e-22
PHYCA_12727044782791372341e-22
PYIW_242891643031961802291e-22
PPTG_0462042333421312362e-22
PYAR_2411397811921742282e-22
PHYRA_73606571983661332372e-22
PHYRA_7358442332871372332e-22
PHYSO_533682604462781362332e-22
PYIR_23585845342401302302e-22
PHYKE_2809752822911292323e-22
PHYCA_531163194343141372333e-22
PITG_1193697753331762334e-22
PYIW_187905687686782184e-22
PPTG_04647194343271332334e-22
PITG_0494742332981302315e-22
H257_1355017302661422305e-22
PHYSO_484051571982851342305e-22
PHYSO_459106194342231332266e-22
PITG_1981815643147582217e-22
PHYRA_77971705552301312268e-22
PHYRA_85794726192301312268e-22
PPTG_1422144782751372288e-22
PHYCA_534296526713091362309e-22
PYVX_1817953461147682191e-21
PPTG_03153597733141792282e-21
CCI4738117292111432222e-21
SPRG_077961259803221902282e-21
PHYKE_6002526711971672212e-21
PHYRA_7358342346301332322e-21
PHYRA_8615172836170742192e-21
PHYRA_8794174106157742183e-21
PHYSO_340333526712841362253e-21
PHYKE_2937571983661322283e-21
PHYSO_34033244782951362253e-21
PHYRA_86016727462361242215e-21
PHYKE_391342343211312246e-21
PHYKE_600144782891412237e-21
PHALS_0539242353671362257e-21
PHYRA_7914038074241352277e-21
PYIR_19612831912601432218e-21
PITG_0527144782781402228e-21
PHALS_03177526712591372201e-20
PHYCA_534473423310501332271e-20
PHYRA_86752732363001242211e-20
PPTG_0313997753201762221e-20
PYIW_254631650392161842162e-20
PHYRA_83494464352241242162e-20
SPRG_19916161733051862202e-20
PYIR_24421899032131322153e-20
PPTG_07509718142991612193e-20
SPRG_2216117303001542193e-20
PPTG_0750738072991612193e-20
PHYRA_83500718143941352213e-20
PYAP_222571003612471022164e-20
SDRG_17317161731221102065e-20
CCA1717917291851442116e-20
PHYKE_771752856568452217e-20
PYIR_2213497753001812167e-20
PHYCA_12943369712871432167e-20
PHYCA_97965401872881432167e-20
PHYSO_533747604512061362117e-20
PHALS_03179308833721412188e-20
SDRG_154261258855231442209e-20
PYIW_1552617302561842139e-20
PHYKE_6077188563221322169e-20
SDRG_075651244122781962131e-19
PHYCA_1961197755311322191e-19
PYVX_14662510865401362182e-19
PHYRA_78176597733121822142e-19
PYAP_1871342341841372054e-19
PHYRA_78161375713731852134e-19
PYU1_G005871944962841942105e-19
SDRG_081371363342821862105e-19
PYAR_206171040482541662085e-19
PYU1_G005872161732971942105e-19
PYAP_22462820772101942056e-19
SDRG_173181339462411832076e-19
PHALS_0539442342881392096e-19
PYU1_G001514188574691222137e-19
PHALS_04411944962621772087e-19
SPRG_199171339462411372068e-19
SDRG_081291363312181862058e-19
PHYRA_83499204334731242129e-19
PYIW_242881643022011832031e-18
PHYCA_19598375713901262111e-18
PHYCA_98479819502761102062e-18
PYU1_G005873510322141922022e-18
PHYKE_839053461130971962e-18
PPTG_03138188562941842052e-18
PPTG_0315697874451792092e-18
PYAP_18221944962261352022e-18
PYIR_2048117292771262043e-18
PYAP_24691101441145821963e-18
PYU1_G005985820772001922003e-18
PYAP_18226840622262002013e-18
SDRG_0878217304501852074e-18
PHYSO_324715696932741512034e-18
PHYKE_607897753171852044e-18
PYIR_25999861323441802054e-18
PYIW_168101650732161901996e-18
PHYCA_69583463492241201997e-18
PYIR_24743851643571782038e-18
PHYSO_255056463492691002009e-18
PHYRA_7358169693293862011e-17
PPTG_18166242064451122041e-17
PPTG_0316097913791352031e-17
PHYCA_1865738072951142001e-17
PHYRA_78175764333191322001e-17
PYU1_G00586817292671281982e-17
PHYRA_84947539132651311972e-17
PHYKE_1913732362801801982e-17
PHYCA_103479510323141391992e-17
PYAP_18138991732681161973e-17
PYVX_16138786195591502023e-17
PPTG_0752038142941431973e-17
PPTG_07516464352941431973e-17
PYU1_G00151997822651761963e-17
PHYSO_488921574612961911973e-17
PHYSO_329293510323101911974e-17
SDRG_165341259793201781975e-17
PYU1_G001528861322741801955e-17
PYVX_21297798802631001946e-17
SPRG_076271258855361781996e-17
PYVX_20783375052761721956e-17
PHYKE_1029517292921261957e-17
PYAP_19707995792411001927e-17
PHYKE_2454751493741791978e-17
PYAR_18165995792611071938e-17
SPRG_077971259813181781958e-17
PYU1_G00152797792781231948e-17
PYU1_G00152397762781231948e-17
SPRG_078251259983371811959e-17
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_129425

Length=204
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_129425                                                          382        1e-136
PPTG_17122                                                            337        1e-118
PHYSO_284086                                                          334        2e-117
PHYKE_8389                                                            327        1e-114
PITG_18450                                                            313        2e-109
PHYRA_81106                                                           304        2e-105
PPTG_17121                                                            288        2e-99 
PHYSO_477820                                                          282        7e-97 
PHYCA_511409                                                          281        1e-96 
PHYRA_81107                                                           280        3e-96 
PHYKE_8388                                                            275        7e-94 
PYVX_18176                                                            274        1e-93 
PHYRA_82864                                                           272        3e-93 
PHYCA_14369                                                           271        8e-92 
PPTG_15264                                                            269        1e-91 
PPTG_17366                                                            269        1e-91 
PHYSO_341599                                                          268        2e-91 
PPTG_10635                                                            267        7e-91 
PHYRA_85631                                                           266        3e-90 
PHYKE_3446                                                            264        1e-89 
PPTG_10636                                                            265        2e-89 
PYVX_18174                                                            261        2e-88 
PHYRA_84190                                                           261        2e-88 
PHYSO_536424                                                          260        3e-88 
PHYSO_507031                                                          260        3e-88 
PPTG_10634                                                            260        6e-88 
PHYCA_102852                                                          259        8e-88 
PHYKE_7718                                                            258        3e-87 
PPTG_10643                                                            258        1e-86 
PHYCA_102550                                                          256        7e-86 
PHYCA_102624                                                          251        7e-85 
PPTG_10048                                                            248        1e-83 
PHALS_00498                                                           243        2e-81 
PYU1_G001741                                                          237        3e-79 
PYU1_G001742                                                          235        5e-78 
PYIR_25089                                                            236        5e-78 
PYVX_18173                                                            243        1e-77 
PYIR_26626                                                            232        7e-77 
PYU1_G001744                                                          228        2e-75 
PYU1_G001740                                                          228        3e-75 
PHALS_03284                                                           218        6e-72 
PHYSO_499978                                                          214        2e-70 
PHYSO_501575                                                          214        2e-70 
PPTG_08820                                                            213        1e-68 
PYU1_G001739                                                          209        3e-67 
PITG_13520                                                            203        5e-66 
PHYCA_510817                                                          201        4e-65 
PPTG_14254                                                            200        8e-65 
PHYSO_254168                                                          199        2e-64 
PHYSO_343376                                                          198        5e-64 
PPTG_14255                                                            200        1e-63 
PITG_10499                                                            200        8e-63 
PHYSO_417649                                                          192        1e-61 
PYAP_22278                                                            194        5e-61 
PHYKE_9185                                                            192        2e-60 
PYAR_24096                                                            187        4e-59 
PYAP_22279                                                            186        2e-58 
PHYCA_536934                                                          196        4e-57 
PYIW_18791                                                            181        6e-57 
PHYSO_341596                                                          181        8e-57 
PYAP_22273                                                            180        7e-56 
PHYSO_262732                                                          175        6e-55 
PHYCA_14368                                                           175        3e-54 
PYIR_26546                                                            166        2e-50 
PHYSO_527908                                                          161        1e-49 
PYU1_G001738                                                          161        6e-49 
PHYSO_246676                                                          160        8e-49 
PHYRA_81105                                                           158        4e-48 
PPTG_17123                                                            155        8e-47 
PHYCA_537323                                                          154        2e-46 
PHYSO_340369                                                          149        2e-44 
PITG_18452                                                            159        4e-44 
HYAP_07096                                                            149        1e-43 
PHYSO_353401                                                          143        6e-43 
PYIW_18788                                                            135        1e-38 
PYAP_18131                                                            118        5e-32 
PYIW_18792                                                            112        3e-31 
PYIR_16444                                                            111        5e-30 
PYU1_G007476                                                          112        6e-30 
PYIR_16435                                                            111        7e-29 
PHYSO_342364                                                          108        2e-28 
PYAP_24689                                                            108        4e-28 
PHYKE_10578                                                           106        2e-27 
PYIW_19151                                                            106        3e-27 
PHYRA_78625                                                           109        3e-27 
PHYRA_78626                                                           109        4e-27 
PYIR_16443                                                            105        9e-27 
PYAP_18709                                                            103        2e-26 
PYAP_18711                                                            101        7e-26 
PHYRA_73582                                                           103        1e-25 
PYU1_G005324                                                          100        1e-25 
PYU1_G005326                                                          100        1e-25 
PYU1_G005328                                                          100        1e-25 
PHYCA_130365                                                          102        1e-25 
PITG_04949                                                            103        3e-25 
PYVX_18175                                                            98.2       3e-25 
PPTG_04618                                                            102        4e-25 
PHYKE_8104                                                            95.5       7e-25 
PYAR_14260                                                            99.0       1e-24 
PHYSO_483955                                                          101        1e-24 
PPTG_04622                                                            100        1e-24 
PITG_04948                                                            99.0       1e-24 
PHYSO_533903                                                          97.4       3e-24 
PYU1_G005325                                                          97.1       4e-24 
PHYRA_74651                                                           99.8       6e-24 
PYIW_27477                                                            95.9       7e-24 
PHYRA_73607                                                           99.0       9e-24 
PHALS_03176                                                           96.3       1e-23 
PYU1_G014690                                                          97.8       1e-23 
PPTG_04619                                                            97.4       1e-23 
PHYCA_12942                                                           98.2       2e-23 
H310_06362                                                            95.1       2e-23 
PHYSO_485524                                                          96.7       3e-23 
PYU1_G005323                                                          95.5       4e-23 
PHYSO_438103                                                          95.1       5e-23 
SDRG_16535                                                            96.3       7e-23 
PYU1_G007364                                                          96.3       8e-23 
PYAR_14256                                                            93.6       9e-23 
PHYRA_78689                                                           95.5       1e-22 
PHYCA_127270                                                          94.7       1e-22 
PYIW_24289                                                            92.8       1e-22 
PPTG_04620                                                            95.5       2e-22 
PYAR_24113                                                            92.4       2e-22 
PHYRA_73606                                                           95.9       2e-22 
PHYRA_73584                                                           94.4       2e-22 
PHYSO_533682                                                          94.4       2e-22 
PYIR_23585                                                            93.2       2e-22 
PHYKE_2809                                                            94.0       3e-22 
PHYCA_531163                                                          94.4       3e-22 
PITG_11936                                                            94.4       4e-22 
PYIW_18790                                                            88.6       4e-22 
PPTG_04647                                                            94.4       4e-22 
PITG_04947                                                            93.6       5e-22 
H257_13550                                                            93.2       5e-22 
PHYSO_484051                                                          93.2       5e-22 
PHYSO_459106                                                          91.7       6e-22 
PITG_19818                                                            89.7       7e-22 
PHYRA_77971                                                           91.7       8e-22 
PHYRA_85794                                                           91.7       8e-22 
PPTG_14221                                                            92.4       8e-22 
PHYCA_534296                                                          93.2       9e-22 
PYVX_18179                                                            89.0       1e-21 
PPTG_03153                                                            92.4       2e-21 
CCI47381                                                              90.1       2e-21 
SPRG_07796                                                            92.4       2e-21 
PHYKE_6002                                                            89.7       2e-21 
PHYRA_73583                                                           94.0       2e-21 
PHYRA_86151                                                           89.0       2e-21 
PHYRA_87941                                                           88.6       3e-21 
PHYSO_340333                                                          91.3       3e-21 
PHYKE_2937                                                            92.4       3e-21 
PHYSO_340332                                                          91.3       3e-21 
PHYRA_86016                                                           89.7       5e-21 
PHYKE_3913                                                            90.9       6e-21 
PHYKE_6001                                                            90.5       7e-21 
PHALS_05392                                                           91.3       7e-21 
PHYRA_79140                                                           92.0       7e-21 
PYIR_19612                                                            89.7       8e-21 
PITG_05271                                                            90.1       8e-21 
PHALS_03177                                                           89.4       1e-20 
PHYCA_534473                                                          92.0       1e-20 
PHYRA_86752                                                           89.7       1e-20 
PPTG_03139                                                            90.1       1e-20 
PYIW_25463                                                            87.8       2e-20 
PHYRA_83494                                                           87.8       2e-20 
SPRG_19916                                                            89.4       2e-20 
PYIR_24421                                                            87.4       3e-20 
PPTG_07509                                                            89.0       3e-20 
SPRG_22161                                                            89.0       3e-20 
PPTG_07507                                                            89.0       3e-20 
PHYRA_83500                                                           89.7       3e-20 
PYAP_22257                                                            87.8       4e-20 
SDRG_17317                                                            84.0       5e-20 
CCA17179                                                              85.9       6e-20 
PHYKE_7717                                                            89.7       7e-20 
PYIR_22134                                                            87.8       7e-20 
PHYCA_12943                                                           87.8       7e-20 
PHYCA_97965                                                           87.8       7e-20 
PHYSO_533747                                                          85.9       7e-20 
PHALS_03179                                                           88.6       8e-20 
SDRG_15426                                                            89.4       9e-20 
PYIW_15526                                                            86.7       9e-20 
PHYKE_6077                                                            87.8       9e-20 
SDRG_07565                                                            86.7       1e-19 
PHYCA_19611                                                           89.0       1e-19 
PYVX_14662                                                            88.6       2e-19 
PHYRA_78176                                                           87.0       2e-19 
PYAP_18713                                                            83.6       4e-19 
PHYRA_78161                                                           86.7       4e-19 
PYU1_G005871                                                          85.5       5e-19 
SDRG_08137                                                            85.5       5e-19 
PYAR_20617                                                            84.7       5e-19 
PYU1_G005872                                                          85.5       5e-19 
PYAP_22462                                                            83.6       6e-19 
SDRG_17318                                                            84.3       6e-19 
PHALS_05394                                                           85.1       6e-19 
PYU1_G001514                                                          86.7       7e-19 
PHALS_04411                                                           84.7       7e-19 
SPRG_19917                                                            84.0       8e-19 
SDRG_08129                                                            83.6       8e-19 
PHYRA_83499                                                           86.3       9e-19 
PYIW_24288                                                            82.8       1e-18 
PHYCA_19598                                                           85.9       1e-18 
PHYCA_98479                                                           84.0       2e-18 
PYU1_G005873                                                          82.4       2e-18 
PHYKE_8390                                                            80.1       2e-18 
PPTG_03138                                                            83.6       2e-18 
PPTG_03156                                                            85.1       2e-18 
PYAP_18221                                                            82.4       2e-18 
PYIR_20481                                                            83.2       3e-18 
PYAP_24691                                                            80.1       3e-18 
PYU1_G005985                                                          81.6       3e-18 
PYAP_18226                                                            82.0       3e-18 
SDRG_08782                                                            84.3       4e-18 
PHYSO_324715                                                          82.8       4e-18 
PHYKE_6078                                                            83.2       4e-18 
PYIR_25999                                                            83.6       4e-18 
PYIW_16810                                                            81.3       6e-18 
PHYCA_69583                                                           81.3       7e-18 
PYIR_24743                                                            82.8       8e-18 
PHYSO_255056                                                          81.6       9e-18 
PHYRA_73581                                                           82.0       1e-17 
PPTG_18166                                                            83.2       1e-17 
PPTG_03160                                                            82.8       1e-17 
PHYCA_18657                                                           81.6       1e-17 
PHYRA_78175                                                           81.6       1e-17 
PYU1_G005868                                                          80.9       2e-17 
PHYRA_84947                                                           80.5       2e-17 
PHYKE_1913                                                            80.9       2e-17 
PHYCA_103479                                                          81.3       2e-17 
PYAP_18138                                                            80.5       3e-17 
PYVX_16138                                                            82.4       3e-17 
PPTG_07520                                                            80.5       3e-17 
PPTG_07516                                                            80.5       3e-17 
PYU1_G001519                                                          80.1       3e-17 
PHYSO_488921                                                          80.5       3e-17 
PHYSO_329293                                                          80.5       4e-17 
SDRG_16534                                                            80.5       5e-17 
PYU1_G001528                                                          79.7       5e-17 
PYVX_21297                                                            79.3       6e-17 
SPRG_07627                                                            81.3       6e-17 
PYVX_20783                                                            79.7       6e-17 
PHYKE_10295                                                           79.7       7e-17 
PYAP_19707                                                            78.6       7e-17 
PHYKE_2454                                                            80.5       8e-17 
PYAR_18165                                                            79.0       8e-17 
SPRG_07797                                                            79.7       8e-17 
PYU1_G001527                                                          79.3       8e-17 
PYU1_G001523                                                          79.3       8e-17 
SPRG_07825                                                            79.7       9e-17 
PHYSO_524101                                                          79.3       9e-17 
PHYRA_80750                                                           78.6       1e-16 
PPTG_04617                                                            80.1       1e-16 
HYAP_01683                                                            79.3       1e-16 
PYAP_23672                                                            78.2       1e-16 
SPRG_07826                                                            79.3       2e-16 
SDRG_00972                                                            79.0       2e-16 
PYVX_22511                                                            78.6       2e-16 
PYAR_24818                                                            76.6       2e-16 
PYU1_G001525                                                          78.6       2e-16 
H310_05432                                                            78.6       2e-16 
PYAR_16493                                                            77.8       2e-16 
SPRG_07795                                                            78.6       2e-16 
PYIR_15187                                                            76.6       2e-16 
PYU1_G001526                                                          78.6       2e-16 
PPTG_07521                                                            77.8       3e-16 
PYIW_25573                                                            77.8       3e-16 
PHYCA_132255                                                          74.3       3e-16 
PYAR_25093                                                            75.9       4e-16 
PITG_11937                                                            77.8       4e-16 
SPRG_04679                                                            76.6       4e-16 
PHYKE_5749                                                            77.8       4e-16 
PITG_08202                                                            75.9       4e-16 
PYVX_24563                                                            77.0       4e-16 
H257_11264                                                            77.0       5e-16 
PHYCA_14560                                                           77.4       5e-16 
PYIW_24287                                                            77.4       7e-16 
PHYRA_78172                                                           77.8       7e-16 
PHYKE_7445                                                            77.8       7e-16 
PYAP_14265                                                            77.0       7e-16 
H257_11265                                                            76.6       8e-16 
PHYKE_3912                                                            75.9       8e-16 
PYU1_G005866                                                          74.7       9e-16 
PHYSO_476077                                                          76.3       1e-15 
PHYSO_472009                                                          76.3       1e-15 
PHYSO_318683                                                          77.0       1e-15 
SDRG_17448                                                            75.9       1e-15 
PHYCA_120062                                                          74.3       2e-15 
PHYSO_262844                                                          75.5       2e-15 
PHYCA_19612                                                           76.6       2e-15 
PYIW_21964                                                            75.1       2e-15 
PPTG_04803                                                            75.1       3e-15 
PHYRA_86241                                                           73.6       3e-15 
PYU1_G001520                                                          75.9       3e-15 
PHYRA_84732                                                           74.7       3e-15 
PYAR_15391                                                            73.2       3e-15 
PYAP_18584                                                            73.6       4e-15 
PHYCA_122958                                                          73.9       5e-15 
PYIR_22133                                                            75.5       6e-15 
PYAP_23455                                                            75.1       6e-15 
PHYSO_246481                                                          74.3       6e-15 
PHYRA_77293                                                           74.3       6e-15 
PYIW_19601                                                            73.6       7e-15 
PHYRA_86751                                                           71.6       7e-15 
PHALS_05110                                                           72.4       8e-15 
PYVX_19277                                                            74.3       8e-15 
PHYKE_2539                                                            73.2       1e-14 
PYIR_22549                                                            73.2       1e-14 
PHYRA_77290                                                           73.6       1e-14 
PYIR_14463                                                            74.3       1e-14 
PPTG_01148                                                            73.6       1e-14 
PYAR_22058                                                            71.6       1e-14 
PHALS_10635                                                           73.6       1e-14 
PYU1_G001524                                                          73.6       1e-14 
PHYSO_374518                                                          69.7       1e-14 
PYIW_18065                                                            73.2       2e-14 
PHYKE_6076                                                            72.8       2e-14 
PPTG_10073                                                            70.9       2e-14 
PHYCA_112615                                                          71.2       2e-14 
PPTG_03140                                                            73.2       2e-14 
PYVX_22510                                                            73.6       2e-14 
PITG_01966                                                            72.8       2e-14 
HYAP_14170                                                            72.0       3e-14 
PYAP_16338                                                            72.4       3e-14 
PYAP_19712                                                            72.0       3e-14 
PYIR_25334                                                            72.0       3e-14 
PYIW_18794                                                            71.6       4e-14 
PHYCA_123316                                                          72.4       4e-14 
PYVX_21174                                                            67.8       4e-14 
PPTG_01153                                                            72.4       4e-14 
PHYRA_80632                                                           72.4       4e-14 
PYVX_21643                                                            71.6       4e-14 
PPTG_07511                                                            70.1       5e-14 
PHYSO_318693                                                          72.8       5e-14 
PYU1_G005867                                                          70.5       5e-14 
H257_11271                                                            72.4       5e-14 
PPTG_10186                                                            71.6       5e-14 
PYIW_16208                                                            71.2       5e-14 
PHYRA_78162                                                           72.4       6e-14 
PHALS_02044                                                           70.9       6e-14 
PYIR_25571                                                            71.2       7e-14 
PHYCA_15126                                                           71.6       7e-14 
PHYKE_6079                                                            71.2       8e-14 
PYVX_20789                                                            71.2       8e-14 
PHYKE_6066                                                            70.9       9e-14 
HYAP_11923                                                            72.0       1e-13 
PYU1_G005869                                                          70.5       1e-13 
PHYRA_93650                                                           70.1       1e-13 
PHYSO_375794                                                          67.4       1e-13 
PHYRA_77292                                                           69.3       1e-13 
PYAR_21940                                                            70.5       1e-13 
PYVX_22508                                                            70.5       1e-13 
PYAR_17166                                                            67.0       1e-13 
PHYSO_256017                                                          67.8       1e-13 
PYIR_26867                                                            68.2       2e-13 
PYAP_23673                                                            70.5       2e-13 
PYAR_17163                                                            66.6       2e-13 
PHYCA_18729                                                           70.9       2e-13 
PHYSO_255975                                                          68.2       2e-13 
PHALS_08575                                                           69.7       3e-13 
PHYKE_10296                                                           70.5       3e-13 
PYVX_21438                                                            69.3       3e-13 
PYU1_G001517                                                          69.7       4e-13 
PYIR_20482                                                            67.0       4e-13 
PPTG_03143                                                            69.7       4e-13 
PHYSO_374025                                                          69.3       5e-13 
PYIR_20483                                                            68.9       5e-13 
PHYCA_12944                                                           67.0       5e-13 
PYAP_16994                                                            68.6       5e-13 
PYU1_G007254                                                          67.0       6e-13 
PYIR_16375                                                            68.2       7e-13 
PHYKE_2379                                                            68.6       7e-13 
PHYSO_525076                                                          68.9       7e-13 
PYIR_17978                                                            68.2       7e-13 
PHALS_01293                                                           68.9       7e-13 
PHYSO_426658                                                          67.4       7e-13 
PHYKE_9024                                                            68.6       7e-13 
PYU1_G006672                                                          63.5       8e-13 
PHYCA_552912                                                          68.9       8e-13 
PHYCA_562062                                                          67.8       8e-13 
PHYKE_7443                                                            68.6       8e-13 
PPTG_03148                                                            68.2       9e-13 
PHYCA_558591                                                          64.7       9e-13 
PPTG_03161                                                            68.9       9e-13 
PITG_20312                                                            67.8       1e-12 
PPTG_04801                                                            67.8       1e-12 
PITG_20631                                                            67.8       1e-12 
PHYCA_6388                                                            68.2       1e-12 
PPTG_06256                                                            68.2       1e-12 
PYAP_16347                                                            66.2       1e-12 
PPTG_18176                                                            67.4       1e-12 
PHYKE_9023                                                            67.4       1e-12 
PHYRA_78174                                                           67.4       1e-12 
PITG_11942                                                            67.4       1e-12 
PPTG_09880                                                            66.2       2e-12 
PHYSO_488139                                                          67.0       2e-12 
H257_11258                                                            67.8       2e-12 
PPTG_20376                                                            65.9       2e-12 
PITG_08892                                                            67.4       2e-12 
PYAR_14261                                                            64.7       2e-12 
PHYSO_454780                                                          65.1       3e-12 
SDRG_00948                                                            67.4       3e-12 
PYU1_G006405                                                          66.6       4e-12 
PPTG_06253                                                            66.6       4e-12 
PPTG_06249                                                            66.2       4e-12 
PYU1_G005878                                                          62.0       4e-12 
PHYCA_15125                                                           66.6       4e-12 
PPTG_01147                                                            65.9       4e-12 
H310_05433                                                            66.6       5e-12 
PHYCA_10471                                                           66.2       5e-12 
PHYRA_86201                                                           65.9       5e-12 
PHYRA_78177                                                           66.2       6e-12 
PYVX_23997                                                            64.3       6e-12 
PHYRA_77291                                                           65.5       7e-12 
SPRG_07799                                                            65.9       7e-12 
PHALS_02041                                                           65.5       7e-12 
PHYCA_15124                                                           65.9       7e-12 
PHYSO_337515                                                          65.9       8e-12 
PYVX_16673                                                            66.2       9e-12 
PYU1_G007242                                                          65.1       1e-11 
PHYRA_80631                                                           65.5       1e-11 
PYU1_G003057                                                          63.9       1e-11 
PHYCA_14559                                                           64.3       1e-11 
PYAP_25026                                                            63.9       2e-11 
PYAR_21271                                                            63.9       2e-11 
PHYRA_78169                                                           65.1       2e-11 
PYU1_G007250                                                          63.2       2e-11 
PHYRA_78164                                                           64.7       2e-11 
PITG_11951                                                            62.8       2e-11 
H257_11306                                                            64.7       2e-11 
PPTG_01152                                                            63.9       2e-11 
PPTG_06106                                                            63.9       2e-11 
PYU1_G006404                                                          64.3       2e-11 
PHYKE_7446                                                            64.7       2e-11 
PYVX_21644                                                            63.2       2e-11 
PYIR_23622                                                            63.9       2e-11 
PHYSO_525490                                                          64.3       3e-11 
PITG_11944                                                            63.9       3e-11 
HYAP_01682                                                            63.9       3e-11 
PYIW_14247                                                            63.2       4e-11 
PYU1_G001475                                                          63.2       5e-11 
PHYCA_19608                                                           63.5       5e-11 
PYAR_15390                                                            61.6       6e-11 
PYAR_15784                                                            61.2       7e-11 
PITG_01969                                                            62.8       7e-11 
PHYRA_78165                                                           62.8       7e-11 
PYIW_26655                                                            62.4       8e-11 
PHYCA_10470                                                           62.8       8e-11 
PYU1_G006403                                                          62.4       9e-11 
PYIW_15528                                                            62.8       1e-10 
PHYRA_78167                                                           62.4       1e-10 
PYAP_20077                                                            62.0       1e-10 
PPTG_03145                                                            62.4       1e-10 
PYAP_16337                                                            61.6       1e-10 
PYIR_23689                                                            61.2       1e-10 
PYIR_22136                                                            62.0       2e-10 
PITG_04404                                                            60.8       2e-10 
PHYKE_6069                                                            61.6       2e-10 
PYVX_22512                                                            60.8       2e-10 
PHYRA_79881                                                           61.2       2e-10 
PYIW_21963                                                            61.6       2e-10 
PYIR_22634                                                            61.2       3e-10 
PYIW_20715                                                            60.8       3e-10 
PYIR_24935                                                            60.8       3e-10 
PITG_08895                                                            60.1       3e-10 
PPTG_03144                                                            60.8       4e-10 
PYIR_25001                                                            59.7       4e-10 
PPTG_13879                                                            60.8       4e-10 
PHYCA_123476                                                          60.5       5e-10 
PYAP_16351                                                            60.1       5e-10 
PHYSO_489485                                                          58.5       5e-10 
PYAR_25949                                                            58.9       6e-10 
PHALS_01460                                                           60.1       7e-10 
PPTG_00483                                                            59.7       7e-10 
PHYRA_75781                                                           59.7       7e-10 
PITG_11957                                                            60.1       8e-10 
PPTG_03147                                                            59.7       9e-10 
PITG_21641                                                            60.1       9e-10 
PHYCA_97699                                                           59.3       1e-09 
PYIR_24867                                                            59.7       1e-09 
PYU1_G001516                                                          59.7       1e-09 
H310_05438                                                            59.7       1e-09 
PHALS_02037                                                           59.3       1e-09 
PYVX_24274                                                            58.5       1e-09 
PYIR_26519                                                            58.9       1e-09 
PHYCA_19606                                                           58.9       2e-09 
PITG_11943                                                            57.4       2e-09 
PYIW_23030                                                            58.2       2e-09 
PHYRA_95184                                                           59.3       2e-09 
PHYKE_9025                                                            58.9       2e-09 
PYAP_24338                                                            58.5       2e-09 
PPTG_22744                                                            56.6       3e-09 
PHYRA_78168                                                           58.2       3e-09 
PHYCA_559281                                                          55.8       4e-09 
PYAR_24939                                                            56.6       4e-09 
PHALS_02295                                                           57.4       6e-09 
PYIR_16437                                                            57.4       6e-09 
PYIR_26312                                                            55.1       7e-09 
PYAR_23090                                                            55.5       7e-09 
PHYSO_525121                                                          56.6       7e-09 

>PHYCA_129425
Length=204

 Score = 382 bits (982),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY
Sbjct  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK
Sbjct  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
            TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF
Sbjct  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204

>PPTG_17122
Length=204

 Score = 337 bits (864),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            +AHQVVLLPAPTYTTDNKDTKYAPLAFLE+QG++TVEDFNGWRR+NGYKTLR FMD AKY
Sbjct  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            TVTDGADYYCGFTN  AAPQPIPDGTMRSTGYTHDGPCEVWLD+ RVLQSDNCHET  GK
Sbjct  86   TVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGK  145

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
            TYNLDYSSC G+C LRWYWLG R+LKN +SWQ+YKACIPLS+SARRLE AANES A+E 
Sbjct  146  TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASARRLESAANESVALEV  204

>PHYSO_284086
Length=204

 Score = 334 bits (857),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 0/179 (0%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQVVLLPAPTYTTD+K TKYAPLAFLE+QG++TVEDFN WRR  GYKTLRAFMDGA Y
Sbjct  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            TV DGADYYCGFT+ K   QPIPDGTMRSTGYTHDGPCEVWLD+TRVLQSDNCHETF GK
Sbjct  86   TVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGK  145

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
            TY+LDYSSCKGSC LRWYWLG RFLKNE+SWQVYKAC+PLS+SARRLE AANESAA+EF
Sbjct  146  TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSARRLEAAANESAALEF  204

>PHYKE_8389
Length=204

 Score = 327 bits (839),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 164/180 (91%), Gaps = 1/180 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQVVLLPAPTYTTD+KDTKYAPLAFLE+QGF+TV+DFN WRR+NGYKTLRAFMDGAKY
Sbjct  25   DAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKY  84

Query  86   TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TVTDGADY+CGFTNA AAPQ IP G  MRSTGYTHDGPCEVWLD+TRVL  DNCHE   G
Sbjct  85   TVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  144

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
            K Y +DYSSC G+C LRWYWLG RFLKNE+SWQVYKAC+PLS+SARRL+GAANESAAIEF
Sbjct  145  KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIEF  204

>PITG_18450
Length=203

 Score = 313 bits (803),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 157/177 (89%), Gaps = 3/177 (2%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
            AHQVVLLP+PTYTTD+KDTKYAPL FLE QG++TVEDFNGWRR+NGYKTLR FM+   YT
Sbjct  27   AHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---YT  83

Query  87   VTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
            V DGADYYCGFTN  AAPQP PDG MRSTGYTHDGPCEVWLDSTRVLQSDNCHET  GKT
Sbjct  84   VADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143

Query  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203
            YNLDYSSCKG+C LRWYWLG RFLKN +SWQ+YKACIPLS+SARRLE AAN+S   +
Sbjct  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFD  200

>PHYRA_81106
Length=202

 Score = 304 bits (778),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 155/180 (86%), Gaps = 4/180 (2%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQVVLLPAPTYTTD+KDTKYAPLAFLE+QGF+TV DFN WRRSNGYKTLRAFMDGAKY
Sbjct  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TV DGADYYCGFTNA A PQ IPDG  MRSTGYTHDGPCEVWLD+TRVL  DNCHE   G
Sbjct  86   TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
            K Y +DYSSC G+C L WYW+G R+LKN +SWQVYKAC+PLS+SARRL    NESA I+F
Sbjct  146  KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAVIDF  202

>PPTG_17121
Length=202

 Score = 288 bits (738),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 147/180 (82%), Gaps = 1/180 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            +AHQVVLL APTYTTD+KDTKYAPLAFLE QGF T EDF  WR+ NGY +LRAF DGA Y
Sbjct  23   NAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGASY  82

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TV+DGAD  CGFTN     QPIPDG  MRSTGYTHDGPCEVWLD T V+Q DNCHE   G
Sbjct  83   TVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISG  142

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
            K Y +DYSSC  +C L W+WLG R+LKNE+SWQ+YKAC+PLS+SARRLEGAANESA I+F
Sbjct  143  KYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGAANESAIIDF  202

>PHYSO_477820
Length=202

 Score = 282 bits (721),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 144/179 (80%), Gaps = 1/179 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
            AHQVVLLPAPTYTTD+K TKYAPLAFLE QGF T EDF  WR  NGY +LRAF DGA YT
Sbjct  24   AHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGASYT  83

Query  87   VTDGADYYCGFTNAKAAPQPIPD-GTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            V DGAD+ CGFTN     QPIPD   MRSTGYTHDGPCEVWLD T V+Q DNCHE+  GK
Sbjct  84   VADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISGK  143

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
             Y +DYSSC  +C L W+WLG R+LKNE+SWQ+YKAC+PLS+SARRLEGA NESA ++F
Sbjct  144  DYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGATNESARLDF  202

>PHYCA_511409
Length=204

 Score = 281 bits (720),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 145/180 (81%), Gaps = 1/180 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQVVLLPAPTYTTD+K TKYAPLAFLE QGF T EDF  WR+ NGY +LRAF DGA Y
Sbjct  25   DAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGASY  84

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TV+DGAD+ CGFTN     Q IPD   MRSTGYTHDGPCEVWLD T V+Q DNCHE   G
Sbjct  85   TVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISG  144

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
            K Y +DYSSC  +C L W+WLG R+LKNE+SWQ+YKAC+PLS+SARRLEGAANESA  +F
Sbjct  145  KDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASARRLEGAANESAIADF  204

>PHYRA_81107
Length=202

 Score = 280 bits (717),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 144/180 (80%), Gaps = 1/180 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQVVLLPAPTYTTD+K TKYAPLAFLE QGF T EDF  WR  NGY +LRAF DGA Y
Sbjct  23   DAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDDGASY  82

Query  86   TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TV+DGAD+ CGFT+     Q IPDG  MRSTGYTHDGPCEVWLD T V+Q DNCHE   G
Sbjct  83   TVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISG  142

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
            K Y +DYSSC  +C L W+W+G R+L N +SWQVYKAC+PLS+SARRLEGAANESA ++F
Sbjct  143  KDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASARRLEGAANESAILDF  202

>PHYKE_8388
Length=205

 Score = 275 bits (702),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 143/179 (80%), Gaps = 1/179 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            +AHQVVLLP+PTYTTD+K TKYAPLAFLE QGF T EDF  WR  NGY +LRAF D A Y
Sbjct  26   NAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDASY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPD-GTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TV+DGAD+ CGFT+   A QPIPD   MRSTGYTHDGPCEVWLD T V+Q +NCH++  G
Sbjct  86   TVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203
            K Y +DYSSC  +C L W+W+G R+LKNE+SWQVYKAC+PLS+SARRLEGA NES   E
Sbjct  146  KDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASARRLEGAVNESVIFE  204

>PYVX_18176
Length=201

 Score = 274 bits (701),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 141/178 (79%), Gaps = 0/178 (0%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ V+LPAPT+ TD+KD  YAPLAFLE QGF T EDF  WR  NGY +LRAFMDGA Y
Sbjct  23   DAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGASY  82

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            TVTDGAD  CG+TN     Q +PDG MRSTGYTH GPCEVWLD T VLQ DNCH++  GK
Sbjct  83   TVTDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGK  142

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203
            TY+LDYSSC  +C L W+W+G R+L NE+SWQVYK C+PLS+SARRLEGAAN SA ++
Sbjct  143  TYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASARRLEGAANASAVVD  200

>PHYRA_82864
Length=193

 Score = 272 bits (696),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 135/165 (82%), Gaps = 0/165 (0%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQVVLLP P +TTDNKDTKY PLAFLE QGF T  DFN WRR NGYKTLR FMD AKY
Sbjct  26   DAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDRAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            TVT+GADY+CG+T+    PQPIP G MRSTGYTHDGPCEVWLD+TRVLQ DNCHE FP K
Sbjct  86   TVTEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDK  145

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
             Y +DYSSCKG+C L WYW+G RFLKN +SWQVYK CI L+S  R
Sbjct  146  DYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQR  190

>PHYCA_14369
Length=248

 Score = 271 bits (693),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 136/165 (82%), Gaps = 1/165 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TT++KDTKY PLAFLE+QGFKT +DF  WR  NGYK+LR FMD AKY
Sbjct  26   DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDRAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TVT+GAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  86   TVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            K Y +DYSSCKG+C LRWYWLG RFLKN +SWQVYKACIPL+ S 
Sbjct  146  KDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSG  190

>PPTG_15264
Length=194

 Score = 269 bits (687),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 139/171 (81%), Gaps = 3/171 (2%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VL P P +TTDNKD KY PLAFLE QGF+T EDFN WRR NGYKTLR FMD AKY
Sbjct  23   DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKY  82

Query  86   TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TVT+GADY+CG+T+ K  PQPIP  G MRSTGYTHDGPCEVWLD  RVL+  NCHE+ PG
Sbjct  83   TVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPG  142

Query  145  KTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLE  193
            K Y +DYSSC  KG C+LRWYWLG RFLKN +SWQVYK CIPL+++ +RL 
Sbjct  143  KDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRLR  193

>PPTG_17366
Length=194

 Score = 269 bits (687),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 139/171 (81%), Gaps = 3/171 (2%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VL P P +TTDNKD KY PLAFLE QGF+T EDFN WRR NGYKTLR FMD AKY
Sbjct  23   DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKY  82

Query  86   TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TVT+GADY+CG+T+ K  PQPIP  G MRSTGYTHDGPCEVWLD  RVL+  NCHE+ PG
Sbjct  83   TVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPG  142

Query  145  KTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLE  193
            K Y +DYSSC  KG C+LRWYWLG RFLKN +SWQVYK CIPL+++ +RL 
Sbjct  143  KDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRLR  193

>PHYSO_341599
Length=185

 Score = 268 bits (684),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 140/171 (82%), Gaps = 1/171 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TT++K+TKY PLAFLE+QGFKT EDF  WR+ NGYK+LR FMD AKY
Sbjct  9    DAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDRAKY  68

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VT GAD+ CGFT+ K  PQPIP+G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  69   DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  128

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
            K Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYKACIPL+S +    G+
Sbjct  129  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  179

>PPTG_10635
Length=199

 Score = 267 bits (682),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 136/171 (80%), Gaps = 1/171 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TT++KDTKY PLAFLE+QGFKT EDF  WR  NGYK+LR FMD AKY
Sbjct  9    DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDRAKY  68

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VT GAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  69   EVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  128

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
            K Y +DYSSCKGSC LRWYWLG RFLKN +SWQVYKACIPL+  A    G+
Sbjct  129  KDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGAGAPAGS  179

>PHYRA_85631
Length=228

 Score = 266 bits (680),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 140/180 (78%), Gaps = 2/180 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQVVLLP P +TTD+KDTKY PLAFLE++GF T EDF  WR  NGYK+LR FMD AKY
Sbjct  26   DAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDNAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             V DGAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  86   NVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA-ANESAAIE  203
            K Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYK CIPL+  +   E A A E+ + E
Sbjct  146  KDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGSGTSESAPATEAPSTE  205

>PHYKE_3446
Length=199

 Score = 264 bits (674),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 138/165 (84%), Gaps = 1/165 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P + TD+K+ KY PLAFLE+QGF T ED N WRR NGYKTLRAFMD AKY
Sbjct  26   DAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDMAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VT+GADY+CG+T+     QPIP+G  MRSTGYTHDGPCEVW+D+TRVL+S NCHET  G
Sbjct  86   QVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            K Y +DYS+C+G+CMLRWYWLG RFLKN +SWQVYKACIPL+S +
Sbjct  146  KDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLTSGS  190

>PPTG_10636
Length=246

 Score = 265 bits (677),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 134/166 (81%), Gaps = 1/166 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TT++KDTKY PLAFLE+QGFKT EDF  WR  N YK+LR FMD AKY
Sbjct  26   DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDNAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VT GAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  +NCHE FPG
Sbjct  86   EVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
            K Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYKACIPLS S  
Sbjct  146  KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGE  191

>PYVX_18174
Length=204

 Score = 261 bits (667),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 138/179 (77%), Gaps = 2/179 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ V+LP PT+TT ++D  YAPLAFLE QGF+TVEDFN WRRSNGYKTLRAFMD A Y
Sbjct  26   DAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQASY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            TVTDGAD  CGFT     PQPIP    RSTGYTHDGPCE+WLDSTRV  +DNCHE   GK
Sbjct  86   TVTDGADQTCGFTEIDGTPQPIP-ANFRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGK  144

Query  146  TYNLDYS-SCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203
               +DYS    G+C L WYW+G R+L N +SWQVYK C+PLS+SAR LEGAAN SA IE
Sbjct  145  DTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSARMLEGAANASAIIE  203

>PHYRA_84190
Length=206

 Score = 261 bits (666),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 135/171 (79%), Gaps = 1/171 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TTD+KDTKY PLAFLE++GF T EDF  WR  NGYK+LR FMD AKY
Sbjct  9    DAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNAKY  68

Query  86   TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            +VT+GAD+ CGFT+ K  PQPIP D  MRSTGYTHDGPCEVWLD T VL  +NCHE FPG
Sbjct  69   SVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  128

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
            K Y +DYSSCKG+C LRWYW+G RFLK  +SWQVYK CIPL+  +   E A
Sbjct  129  KDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGSGTSESA  179

>PHYSO_536424
Length=197

 Score = 260 bits (665),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 1/170 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
             HQ+VLLP P +TT++K+TKY PLAFLE++GF T EDF  WR+ NGYK+LR FMD AKY 
Sbjct  22   THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYD  81

Query  87   VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            VT GAD+ CGFT+ K  PQPIP+G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPGK
Sbjct  82   VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  141

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
             Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYKACIPL+S +    G+
Sbjct  142  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  191

>PHYSO_507031
Length=197

 Score = 260 bits (665),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 1/170 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
             HQ+VLLP P +TT++K+TKY PLAFLE++GF T EDF  WR+ NGYK+LR FMD AKY 
Sbjct  22   THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYD  81

Query  87   VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            VT GAD+ CGFT+ K  PQPIP+G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPGK
Sbjct  82   VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  141

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
             Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYKACIPL+S +    G+
Sbjct  142  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  191

>PPTG_10634
Length=208

 Score = 260 bits (664),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 133/161 (83%), Gaps = 1/161 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TT++K+TKY PLAFLE++GF T EDF  WR+ NGYK+LR F+D AKY
Sbjct  26   DAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VTDGAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  86   PVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            K Y +DYSSCKG+C L WYWLG RFLKN++SWQVYKACIPL
Sbjct  146  KDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PHYCA_102852
Length=195

 Score = 259 bits (661),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 135/168 (80%), Gaps = 1/168 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TT++KDTKY PLAFLE++GF T EDF  WR  NGYK+LR FMD AKY
Sbjct  26   DAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDRAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VT+GAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVWLD T VL  +NCHE FPG
Sbjct  86   PVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
            K Y +DYSSCKG+C L W+WLG RFLKN++SWQVYKACIPL++  R L
Sbjct  146  KGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLTAGQRNL  193

>PHYKE_7718
Length=220

 Score = 258 bits (660),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 132/165 (80%), Gaps = 1/165 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP PT+TTD+KDTKY PLAFLE +GF   EDF  WR  NGYK+LR FMD AKY
Sbjct  30   DAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAKY  89

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            +VT GAD  CGFT+    PQPIP+G  MRSTGYTHDGPCEVW+D T  + +DNCHE FPG
Sbjct  90   SVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPG  149

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            K Y +DYS+CKG+C LRWYWLG RFLKN +SWQVYKACIPL+ S 
Sbjct  150  KDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGSG  194

>PPTG_10643
Length=250

 Score = 258 bits (659),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 137/178 (77%), Gaps = 6/178 (3%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TT++KDTKY PLAFLE+QGFK  EDF  W + NGYK+LR FMD AKY
Sbjct  26   DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDRAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VT GAD+ CGFTN K  PQPIP  G MRSTGYTHDGPCEV+LD T VLQ DNCHE FPG
Sbjct  86   EVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAI  202
            K   +DYSSCKG+C LRWYWLG RFLKN +SWQVYK CIPL  S     G  +++A +
Sbjct  146  KDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGS-----GGVSQTAPV  198

>PHYCA_102550
Length=268

 Score = 256 bits (655),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 130/164 (79%), Gaps = 1/164 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
            AHQVVLLPAP + TDN+DT++ PLAFLESQGFKT +DF  WR  NGYK+LR FMD AKYT
Sbjct  27   AHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDRAKYT  86

Query  87   VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            V +GAD+ CG+T+    PQPIP G  MRSTGYTHDGPCEVW+D T V++ DNCHE FPGK
Sbjct  87   VRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGK  146

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
             Y +DYS CKG C L WYWLG RFLKN +SWQVYK CIPL+ S 
Sbjct  147  GYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSG  190

>PHYCA_102624
Length=195

 Score = 251 bits (642),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 128/168 (76%), Gaps = 1/168 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
            AHQVVLLP P + TDN+DT++ PL FLE  GFKT  DF  WR+ NGYK+LR FMD AKY 
Sbjct  27   AHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAKYP  86

Query  87   VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            V++GAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVW+D T V++ DNCHE FPGK
Sbjct  87   VSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGK  146

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLE  193
             Y +DYS CKG C L WYWLG RFLKN +SWQVYK CIPL+S  R L 
Sbjct  147  DYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTSEQRSLR  194

>PPTG_10048
Length=190

 Score = 248 bits (634),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 135/165 (82%), Gaps = 1/165 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            +AHQVVL PAP + TDN+DT++ PLAFLESQGFKT EDF  WR  NGYKTLR FM+ AKY
Sbjct  23   EAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEHAKY  82

Query  86   TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TVT+GAD+ CG+TN K  PQPIP  G MRSTGYTH+GPCE+W+  T+V Q+DNCH + PG
Sbjct  83   TVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPG  142

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            K Y +DYS CKG+C+L WYWLG RFLKN +SWQVYK CIPL++++
Sbjct  143  KEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNS  187

>PHALS_00498
Length=199

 Score = 243 bits (620),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 130/165 (79%), Gaps = 1/165 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
            AHQ+VLLP P + T++KDT+Y PLAFLE+Q FKT  D   + + N +KTLR FMD AKYT
Sbjct  27   AHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAKYT  86

Query  87   VTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            V  GAD  CGFT+    PQPIP +  MRSTGYTHDGPCEVWL++TRVL + NCHE FPGK
Sbjct  87   VVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGK  146

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
             Y +DYSSCK +C+LRWYWLG RFLK ++SWQVYKACIPLS SA+
Sbjct  147  DYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSAK  191

>PYU1_G001741
Length=199

 Score = 237 bits (605),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 130/170 (76%), Gaps = 1/170 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
            DAHQ V+LPAPT+T   +  ++ PLAFLE+QGF+T  DFN + ++ GYKTLRAFMD  K 
Sbjct  25   DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKA  84

Query  85   YTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            YTV  GAD+ CG+T      Q IP GT+RSTGYTHDGPCEVWLDSTRV++ +NCH  F G
Sbjct  85   YTVASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTG  144

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEG  194
             T+ +DYSSCKGSC LRWYW+G RFLK E+SWQVYK C+P+ SS R  +G
Sbjct  145  TTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGSSRRLGDG  194

>PYU1_G001742
Length=213

 Score = 235 bits (599),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 132/180 (73%), Gaps = 2/180 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
            DAHQ V+LPAPT+T   +  ++ PLAFLE+QG+KT  DFN + ++ GYKTLRAFMD  K 
Sbjct  26   DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKA  85

Query  85   YTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            Y V  GAD+ CG+T      QPIP GT+RSTGYTHDGPCEVWLDSTRV++ +NCH  FPG
Sbjct  86   YKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
             T+ +DYSSCKGSC LRWYW+G RFLK ++SWQVYK C+P+    R LE    E  + E 
Sbjct  146  TTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK-RLLEEQFAEGNSTEL  204

>PYIR_25089
Length=262

 Score = 236 bits (603),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 131/170 (77%), Gaps = 3/170 (2%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AK  84
            DAHQ V+LPAPT+T   +  ++ PLAFLE+QGFKT  DF+ + ++ GYKTLRAFMD  + 
Sbjct  26   DAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSA  85

Query  85   YTVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
            Y V DGAD+ CG+T     PQPIP   T+RSTGYTHDGPCEVWLD TRVL+  NCH  FP
Sbjct  86   YKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFP  145

Query  144  GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLE  193
            G T+ +DYSSCKGSC+LRWYW+G RFLK ++SWQVYK C+P++ S R L+
Sbjct  146  GTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVTGS-RSLD  194

>PYVX_18173
Length=500

 Score = 243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 128/161 (80%), Gaps = 1/161 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKY  85
            AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T +DF G+  +NG+ +LRAFMD  + Y
Sbjct  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            +V   AD+ CGFT+  AAPQPIPDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE   GK
Sbjct  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
            TY+LDYS+C GSC L WYWLG R+LK  +SWQVYKAC+P+S
Sbjct  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

 Score = 153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 2/163 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
            QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
            T+   + CG T      QPIP +G+  ++GYT DGPCE+W+D+T  L   NCH  FP   
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            + +DYS C  SC + W+WLG ++    +SWQV+K CI LS+SA
Sbjct  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200

>PYIR_26626
Length=212

 Score = 232 bits (591),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 132/169 (78%), Gaps = 3/169 (2%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ V+LPAPT+T  +K+  + PLAFLE+QG+KT  DFNG+ +S GYKTLRAFMD  K 
Sbjct  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85

Query  86   TVTD--GADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
               D  GA++ CG+TN     QPIP GT+RSTGYTHDGPCEVWLD+T+V+   NC++ FP
Sbjct  86   YKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFP  145

Query  144  GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
            GKT+++ Y+SCKGSC LRWYW+G RFLKN+ SWQVYK C+P+  S RRL
Sbjct  146  GKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI-GSGRRL  193

>PYU1_G001744
Length=213

 Score = 228 bits (581),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 130/180 (72%), Gaps = 2/180 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
            DAHQ V+LPAPT+T   +  ++ PLAFLE+QGFKT  DFN + ++ GYK+LRAFMD  K 
Sbjct  26   DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKA  85

Query  85   YTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            Y V  GAD+ CG+T      QPIP GT+RSTGYTHDGPCEVWLD+T V++ +NCH  FPG
Sbjct  86   YKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
             T+ + Y+SCKGSC LRWYW+G RFLK ++SWQVYK C+P+    R LE    E  + E 
Sbjct  146  TTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK-RLLEEQFAEGNSTEL  204

>PYU1_G001740
Length=206

 Score = 228 bits (580),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 125/161 (78%), Gaps = 2/161 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
            DAHQ+V+LP PT+T   KD +++PLAFLE+QG+KT  DFN + +S GYK+LRAFMD  K 
Sbjct  26   DAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKA  85

Query  85   YTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            Y V   AD+ CG+TN   A QPIP    R+TGYTHDGPCEVWLD+T+VL   NCH+ FPG
Sbjct  86   YKVNSNADFECGYTNKNGARQPIP-ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPG  144

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            KT+ + Y++CKGSC LRWYW+G RFLK +HSWQVYK C+PL
Sbjct  145  KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PHALS_03284
Length=188

 Score = 218 bits (556),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 121/165 (73%), Gaps = 1/165 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
            AHQ++LLP P + T++KDTKY PLAFLE+Q F T  DF G+ + N Y +LR F+  A YT
Sbjct  13   AHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRANYT  72

Query  87   VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            VT+GAD  CGFT+    PQPIP G  MR TGYTHDG CE+WLD T+VL   NCH  FPGK
Sbjct  73   VTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGK  132

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
               +DYSSCK +C++ WYWL  R LKNE+SWQVYKACIPL+ S +
Sbjct  133  DCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRSGK  177

>PHYSO_499978
Length=174

 Score = 214 bits (545),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 112/140 (80%), Gaps = 1/140 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VL P P +TT++K+TKY PLAFLE+QGF T +DF  WR  NGYKTLR FMD  KY
Sbjct  26   DAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TVT GAD+ CG+T+ K  PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE    
Sbjct  86   TVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIAD  145

Query  145  KTYNLDYSSCKGSCMLRWYW  164
            K Y +DYS+CKG+C LRWYW
Sbjct  146  KGYTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 214 bits (545),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 112/140 (80%), Gaps = 1/140 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VL P P +TT++K+TKY PLAFLE+QGF T +DF  WR  NGYKTLR FMD  KY
Sbjct  26   DAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TVT GAD+ CG+T+ K  PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE    
Sbjct  86   TVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIAD  145

Query  145  KTYNLDYSSCKGSCMLRWYW  164
            K Y +DYS+CKG+C LRWYW
Sbjct  146  KGYTIDYSACKGTCTLRWYW  165

>PPTG_08820
Length=250

 Score = 213 bits (541),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 123/169 (73%), Gaps = 7/169 (4%)

Query  26   DAHQVVLLPAPTYT--TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGA  83
            DAHQ++L P P +    +++DT++ PLAFLESQGF    DFNGWR  +GYK LR FMD A
Sbjct  26   DAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRA  85

Query  84   KYT--VTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  140
            KYT  VT GAD  CG T  K  P+PIP DG M+STGYTHDGPC V+LD   VL+ DNCHE
Sbjct  86   KYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHE  145

Query  141  TFPGKTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
              PGK+Y +DYSSC  KG C L W+WLG RF+K+  SWQVYK C+PL++
Sbjct  146  KLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLTA  194

>PYU1_G001739
Length=266

 Score = 209 bits (533),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 117/166 (70%), Gaps = 2/166 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
            DAHQ+++ P P +  D KD ++ PLAFLE+QG  T  D  G+ +  GY  LRA MD  K 
Sbjct  22   DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKL  81

Query  85   YTVTDGADYYCGFTNAKAAPQPIPD-GTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
            Y V   A + CG+T+     QPIP  GT+RSTGYTHDGPCEVWLD  +V+  DNCH+ FP
Sbjct  82   YEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFP  141

Query  144  GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            GKT+ LDYSSCKGSC LRWYWLG R+LK  +SWQ+YK C+ LS +A
Sbjct  142  GKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNA  187

>PITG_13520
Length=171

 Score = 203 bits (516),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 103/131 (79%), Gaps = 1/131 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TT +KDTKY PLAFLE+QGFKT +DF  WR  NGYK+LR FMD AKY
Sbjct  26   DAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDRAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VT GAD+ CGFT+ K  PQPIP  G MRSTGYTHDGPCEVWLD   VL  DNCHE FPG
Sbjct  86   DVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPG  145

Query  145  KTYNLDYSSCK  155
            K Y +DYSSCK
Sbjct  146  KDYTVDYSSCK  156

>PHYCA_510817
Length=188

 Score = 201 bits (511),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 120/166 (72%), Gaps = 6/166 (4%)

Query  26   DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T  N  +K     + PL+FLE +GFKT E+F  ++  NGYK+LR FM
Sbjct  21   EAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFM  80

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
            + AKY V+DGAD  CG+++ K  PQ IP DGTMR++GYTHDGPCE+W+     L   NCH
Sbjct  81   EKAKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  140

Query  140  ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            E+ P +T+ LDYS C  SC+L WYWLG R LK ++SWQVYK CIPL
Sbjct  141  ESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PPTG_14254
Length=188

 Score = 200 bits (509),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 120/166 (72%), Gaps = 6/166 (4%)

Query  26   DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AHQVV +PAPT+T  N  +K     + PL+FLE +GFKT E+F  ++  NGYK+LR FM
Sbjct  21   EAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFM  80

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
            D AKY VT+GAD  CG+T+ K  PQ IP DGTMR+TGYTHDGPCE+++     L   NCH
Sbjct  81   DRAKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCH  140

Query  140  ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            E+ P +T+ LDYS C  SC+L WYWLG R LK ++SWQVYK CIP+
Sbjct  141  ESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

>PHYSO_254168
Length=170

 Score = 199 bits (505),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 112/156 (72%), Gaps = 16/156 (10%)

Query  40   TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN  99
             ++KDTKY PLAFLE QGF T E F+  RR NGYKTLR FMD  KYTVT GADY+CG+TN
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGKYTVTQGADYFCGWTN  87

Query  100  AKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSC--KGS  157
             K  PQPIP    RSTGYTHDGPCE+WLD  RVL+          ++  +DYSSC  KG 
Sbjct  88   PKGTPQPIP----RSTGYTHDGPCEIWLDDVRVLE----------RSPTIDYSSCEKKGG  133

Query  158  CMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLE  193
            C + WYWLG RFLKN +SWQVYK CIPL+++ +RL 
Sbjct  134  CTMHWYWLGVRFLKNSYSWQVYKECIPLTAAPKRLR  169

>PHYSO_343376
Length=172

 Score = 198 bits (503),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 104/131 (79%), Gaps = 1/131 (1%)

Query  35   APTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYY  94
            A  +TT++K+TKY PLAFLE+QGF T +DF  WR  NGYKTLR FMD  KYTVT GAD+ 
Sbjct  33   AAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGKYTVTKGADFS  92

Query  95   CGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSS  153
            CG+T+ K  PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE    K Y +DYS+
Sbjct  93   CGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSA  152

Query  154  CKGSCMLRWYW  164
            CKG+C LRWYW
Sbjct  153  CKGTCTLRWYW  163

>PPTG_14255
Length=268

 Score = 200 bits (508),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 122/169 (72%), Gaps = 6/169 (4%)

Query  27   AHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD  81
            AHQVV +P+PT+T  N  +      + PL+FLE +G+ T E+F  ++  NGYK+LR FMD
Sbjct  21   AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMD  80

Query  82   GAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  140
             AKY+VTDGAD  CG+T+ K  PQ IP DGTMR++GYTHDGPCE+++  T  L   NCHE
Sbjct  81   NAKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHE  140

Query  141  TFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            +   +T+ LDYS+C  SC+L WYWLG R+LK ++SWQVYK CIPL S +
Sbjct  141  SITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPLYSGS  189

>PITG_10499
Length=323

 Score = 200 bits (508),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 117/161 (73%), Gaps = 7/161 (4%)

Query  34   PAPTYT--TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY--TVTD  89
            P P +    +++DT++ PLAFLESQGF   EDFNGWR  NGYK LR FMD AKY  +VT 
Sbjct  4    PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTP  63

Query  90   GADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN  148
            GAD  CG T  K  P+PIP DG MRSTGYTHDGPC ++LD   V++ DNCHE+ PG+TY 
Sbjct  64   GADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYK  123

Query  149  LDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
            +D+SSC  KG C L W+WLG RF+K+  SWQVYK CI L++
Sbjct  124  IDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLTA  164

>PHYSO_417649
Length=185

 Score = 192 bits (488),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 117/166 (70%), Gaps = 6/166 (4%)

Query  26   DAHQVVLLPAPTYTTDN-----KDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T  N     +   + PL+FLE +GFKT E+F  ++  NGYK+LR FM
Sbjct  19   EAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFM  78

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
            + AKY +TDGAD  CG+T+ K  PQ IP DGTMR++GYTHDGPCE+++     L   NCH
Sbjct  79   ERAKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  138

Query  140  ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            E+   +T+ LDYS C  SC+L WYWLG R LK + SWQVYK CIPL
Sbjct  139  ESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PYAP_22278
Length=289

 Score = 194 bits (493),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 120/172 (70%), Gaps = 8/172 (5%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AK  84
            DAHQ V +PAPT+T ++++  + PLAFLE+QG K  +D  G+ RS G KTLR +MD  A 
Sbjct  23   DAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKAN  82

Query  85   YTV-TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQS--DNCHE  140
            Y +   GA + CG+TN   A QPIP +G MRSTGYTHDGPCEVWLD+TRVL S   NCH 
Sbjct  83   YKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHR  142

Query  141  TFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEH-SWQVYKACIPLSSSA  189
                K  +Y +D+S CKG+CMLRWYWLG R +  +  SWQ+YKAC+PL  S 
Sbjct  143  DVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSG  194

>PHYKE_9185
Length=281

 Score = 192 bits (488),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 116/166 (70%), Gaps = 6/166 (4%)

Query  26   DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T  N  +K     + PL+FLE +G KT E+F  ++  N Y +LR FM
Sbjct  23   EAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDFM  82

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
            D AKY V+DGAD  CG+T+ K  PQ IP DGTMR++GYTHDGPCE+++     L   NCH
Sbjct  83   DKAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  142

Query  140  ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            E+   +T+ LDYS+C  SC+L WYWLG R LK  +SWQ+YK CIPL
Sbjct  143  ESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PYAR_24096
Length=227

 Score = 187 bits (475),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 110/165 (67%), Gaps = 4/165 (2%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AK  84
            +AHQ V LP   YT  N++T + P A LE QG+KT  DFN + ++N YKTLR FMD    
Sbjct  25   EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  84

Query  85   YTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
            Y    GA + CGFT+ KA  QPIP DG  R++GYTH+GPCE+W+D  RV   DNCH    
Sbjct  85   YKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS  144

Query  144  GKTY--NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               +   +DYS+CKG+CML+WYWLG R     +SWQ+YKACIPLS
Sbjct  145  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PYAP_22279
Length=223

 Score = 186 bits (471),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 8/171 (5%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYT  86
            HQ + +PAPT TTD ++T   PLAFLE+QG K  +D  G+ R  G KTLR FMD  A Y 
Sbjct  22   HQRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  87   V-TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVL--QSDNCHETF  142
            V   GA + CG+T+   A QPIP +G MRSTGYTHDGPCEVWLD+TRVL   S +CH+  
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  143  PGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARR  191
                 +Y +D+S CKG+CMLRWYWL  R + ++ SWQVYK C+PL  SA R
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSAAR  191

>PHYCA_536934
Length=983

 Score = 196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (70%), Gaps = 6/166 (4%)

Query  26   DAHQVVLLPAPTYTTDN-----KDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T  N     +   + PL+FLE +G+ T E+F  ++  NGYK LR FM
Sbjct  37   EAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFM  96

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
            D AKY VTDGAD  CG+++    PQ IP DGTMR++GYTHDGPCE+W+     L   NCH
Sbjct  97   DNAKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  156

Query  140  ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            E+   +T+ LDYS C  SC+L WYWLG R+LK ++SWQVYK CIPL
Sbjct  157  ESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PYIW_18791
Length=194

 Score = 181 bits (458),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 4/164 (2%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
            DAHQ V +P P +T   K T +APL+FLE  G KT E  +G+ +  GY TLRA MD +K 
Sbjct  20   DAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKL  79

Query  85   YTVTDGAD-YYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETF  142
            Y     AD + CG+T+     Q IP D TMR+TGYTH GPCEVW+D  RV+  DNCHE  
Sbjct  80   YKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQV  139

Query  143  PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               T  +DYS+CKG C +RWYWLG R+LK + SWQVYK CI L+
Sbjct  140  SNTT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALT  182

>PHYSO_341596
Length=231

 Score = 181 bits (460),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 95/123 (77%), Gaps = 9/123 (7%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLL        +KDTKY PLAFLE+QGF+T EDF  WR  NGYK+LR FMD AKY
Sbjct  26   DAHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDKAKY  77

Query  86   TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            TVT GAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T+VL+ DNCHE FPG
Sbjct  78   TVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPG  137

Query  145  KTY  147
            K Y
Sbjct  138  KDY  140

>PYAP_22273
Length=268

 Score = 180 bits (457),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 109/165 (66%), Gaps = 4/165 (2%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AK  84
            +AHQ V  P   YT  ++ T + P A LE+QG+KT +DFN +  +NGYKTLR FMD    
Sbjct  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  83

Query  85   YTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
            Y    GA   CG+T+  A PQPIP +G  R++GYTH+GPCE+W+D   V    NCH    
Sbjct  84   YKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDIS  143

Query  144  GKTY--NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
             K +   +DYS+CKG CML+WYWLG R +  ++SWQ+YKACIPL+
Sbjct  144  EKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188

>PHYSO_262732
Length=188

 Score = 175 bits (444),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 111/170 (65%), Gaps = 20/170 (12%)

Query  26   DAHQVVLLPAPTYTTDN-----KDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T  N     +   + PLAFLE+QGF+T               LR FM
Sbjct  20   EAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT--------------HLRDFM  65

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
            D AKYTVT+GAD  CG+T+ K   Q IP DGTMR++GYTHDGPCE+++     L   NCH
Sbjct  66   DNAKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  125

Query  140  ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            E+   +T+ LDYS C  SC L WYWLG RFL N++SWQVYK CIP+ S +
Sbjct  126  ESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPIYSGS  175

>PHYCA_14368
Length=219

 Score = 175 bits (443),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 101/164 (62%), Gaps = 44/164 (27%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            +AHQ+VLLP P +TT++KDTKY PLAFLE+QGFKT +DF  WR  N YK+LR FMD AKY
Sbjct  26   EAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNAKY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            TVTDGAD+ CGFT+ K                                            
Sbjct  86   TVTDGADFSCGFTDPKD-------------------------------------------  102

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
             Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYKACIPLS S 
Sbjct  103  -YTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSG  145

>PYIR_26546
Length=239

 Score = 166 bits (419),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 105/164 (64%), Gaps = 5/164 (3%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQ-GFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
            AHQ+V+LP PT+T + K  ++ P+A+LE Q GF    DFNG+  S G+KT+R FMD  K 
Sbjct  27   AHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKL  86

Query  85   YTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH-ETF  142
            Y     AD+ CG+T     PQPIP +  +R+TGYTH+GPCE+WLD  +V    NCH +  
Sbjct  87   YRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVA  146

Query  143  PGKTYN-LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             G  +  LD+SSC G C + WYW+G R      SWQ+YK CIPL
Sbjct  147  SGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHYSO_527908
Length=174

 Score = 161 bits (408),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 6/152 (4%)

Query  26   DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            DAHQVV +P PT+T  N  +      + PLAFLE QGF T  +F  +   NGYK+LR FM
Sbjct  20   DAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRDFM  79

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
            D   Y+VT GAD  CG+T+    PQ IP DGTMR++G+THD PCE+++     L   NCH
Sbjct  80   DNGNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCH  139

Query  140  ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLK  171
            E+   + + LDYS+C  SC+L WYWLG RF+K
Sbjct  140  ESITSQPFKLDYSACGDSCVLYWYWLGVRFIK  171

>PYU1_G001738
Length=226

 Score = 161 bits (408),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 96/161 (60%), Gaps = 2/161 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-Y  85
            A   VL P P Y  D  + + AP+A LE QG KT  D + + +  GY  LRA +D  K Y
Sbjct  21   AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  80

Query  86   TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             V   A   CG+T+     QPIP      STGY  +GPCEVWLD  +V+   NCH  +PG
Sbjct  81   NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  140

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              + LDYSSCKGSCMLRWYWLG + +   +SWQVYK C+ L
Sbjct  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PHYSO_246676
Length=187

 Score = 160 bits (404),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 101/165 (61%), Gaps = 39/165 (24%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P +TT++K TKY PLAFLE+QGFKT EDF  WR+ NGY+TLR FMD AKY
Sbjct  9    DAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDKAKY  68

Query  86   TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VT GAD+ CGFT+ K  PQPIP+G  MRSTGYTHDG     + ++ VL           
Sbjct  69   DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG----LVHASLVLDG---------  115

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
                                     +KN +SW+VYKACIPLS S 
Sbjct  116  -------------------------MKNSYSWKVYKACIPLSGSG  135

>PHYRA_81105
Length=201

 Score = 158 bits (400),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 102/163 (63%), Gaps = 2/163 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
            Q+VL P P +  D  D +   LA+L+ QG  T  +  GW + +GY +LR+ +D  + Y V
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
            T+ A + CG T+ K   Q IP + + +S+GYT DGPCEVWLD T+     NCH  FP   
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156

Query  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            + +DYS+C  +CMLRWYWLG ++++  +SWQVYK CI L   A
Sbjct  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199

>PPTG_17123
Length=201

 Score = 155 bits (392),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 103/162 (64%), Gaps = 2/162 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
            QVVL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LRA +D  + Y V
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
            T+ A + CG T+ +   QPIP + + +++GYT DGPCEVWLD T+V    NCH  FP   
Sbjct  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156

Query  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
            + +DYSSC  +C L WYWLG ++++  +SWQVYK C+ LS++
Sbjct  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198

>PHYCA_537323
Length=200

 Score = 154 bits (388),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 2/163 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
            QVV  P P +  D  D +   LA+L+ QG  T  +   W   +GY +LRA +D  + Y V
Sbjct  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95

Query  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
            T+ A + CG T+ K   QPIP + + +++GYT DGPCEVWLD T+V    NCH  FP   
Sbjct  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155

Query  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            + +DYSSC  SC L WYWLG ++++  +SWQVYK C+ L ++A
Sbjct  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198

>PHYSO_340369
Length=200

 Score = 149 bits (376),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 98/165 (59%), Gaps = 20/165 (12%)

Query  27   AHQVVLLPAPTYT-----TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD  81
            A+QVV +PAPT+T     TD +   + PLA+ E QGF T  +F  W+ +NG+KTLR FMD
Sbjct  24   ANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMD  83

Query  82   GAKYTVTDGADYYCGFTNAKAAPQPIPD-GTMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  140
               Y+VT              +PQ IPD   MR+ GYT DGPCE+WLD+T    S +C  
Sbjct  84   NGNYSVT--------------SPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLV  129

Query  141  TFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            + P  TY LDYS C  SC++ WY LG       +SW+VYK CIPL
Sbjct  130  SLPNMTYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

>PITG_18452
Length=856

 Score = 159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 2/160 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W +  GY +LRA +D  + Y V
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
            T+ A + CG T+ +   QPIP + + +++GYT DGPCE+WLD T+V    NCH  FP   
Sbjct  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811

Query  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
            + +DYSSC GSC L WYWLG ++++  +SWQVYK C+ LS
Sbjct  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851

>HYAP_07096
Length=251

 Score = 149 bits (375),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 100/160 (63%), Gaps = 3/160 (2%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
            QVVL P+P +  D+   +   LA+L+ QG  T  +   W++ +GY +LRA +D  + Y V
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  88   TDGADYYCGFTNAKAAP-QPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            +  A + CGFT+  +   Q IP +GT+ S+GYT DGPCEVW D T+V    NC   FP  
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             + +DYSSC  SC LRWYWLG +++   +SWQVYK CI L
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245

>PHYSO_353401
Length=146

 Score = 143 bits (361),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 93/142 (65%), Gaps = 2/142 (1%)

Query  50   LAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIP  108
            LA+L+ QG  T  +   W + +GY +LRA +D  + Y VT+ A + CG T+ K   QPIP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  109  -DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGT  167
             + + +++GYT DGPCEVWLD T+V    NCH  FP   + +DYS+C  SC L WYWLG 
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  168  RFLKNEHSWQVYKACIPLSSSA  189
            ++++  +SWQVYK C+ LS +A
Sbjct  123  KYVEGAYSWQVYKNCVALSKTA  144

>PYIW_18788
Length=244

 Score = 135 bits (341),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 93/163 (57%), Gaps = 3/163 (2%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-Y  85
            A+  V  P P +  D      A +A LE Q   T  D  G+ +  GY +LRA +D    Y
Sbjct  26   ANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLY  85

Query  86   TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             V   + + CG+T+     QPIP +G +R TGY  DGPCE+W+D  ++L S NC + FPG
Sbjct  86   DVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG  145

Query  145  KTYNLDYSSCKGSCMLRWYWLG-TRFLKNEHSWQVYKACIPLS  186
             +  LDYSSCKG C LRWY L  ++     +SW+VYK C+ LS
Sbjct  146  TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  188

>PYAP_18131
Length=226

 Score = 118 bits (295),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 10/116 (9%)

Query  81   DGAKYTV-TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSD--  136
            D A Y V   GA + CG T+     QPIP +G MRSTG+THDG   VW+D+TRVL S   
Sbjct  3    DKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSKLG  60

Query  137  NCHETFPGK---TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            NCH++  G+   +Y +D+S CKG CM+RWYWLG R L  + SWQVYKACIP+ +S 
Sbjct  61   NCHKSI-GQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASG  115

>PYIW_18792
Length=125

 Score = 112 bits (281),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 67/101 (66%), Gaps = 1/101 (1%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ V LPAPT+T   +  ++ PLAFLE QG+K   DF  + +S GYK LR FMD  K 
Sbjct  22   DAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKA  81

Query  86   TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEV  125
               DG ++ CG+++ K  PQPIP  G +RSTGYTHDGP  +
Sbjct  82   YKVDGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PYIR_16444
Length=182

 Score = 111 bits (278),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 91/166 (55%), Gaps = 16/166 (10%)

Query  26   DAHQVVLLPAPTYT--TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGA  83
            DAH  V +P   +   T N            S  +K  ++F    +  G+ TLR++++  
Sbjct  24   DAHGFVQVPKSEFVKGTSNPSEWIVEFPPPWSGNWKDPKNFAKVAKQKGFPTLRSYIE--  81

Query  84   KYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHET  141
                  GA   CG TNAKA P+PIP DG +  S    H GPCE+WLD+ RV Q+DNC   
Sbjct  82   ----NKGA--ICGKTNAKATPKPIPSDGKVHFSRAIVHPGPCELWLDNKRVYQNDNCEGV  135

Query  142  FPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            F  K   + +D+SSCKG+CMLR++WLG +       WQVYK C+P+
Sbjct  136  FGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCVPV  179

>PYU1_G007476
Length=195

 Score = 112 bits (279),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 78/139 (56%), Gaps = 17/139 (12%)

Query  61   VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTM----RST  115
            + DF    +  GYKTLR+F++        GA   CG+T     P+ IP DG +     + 
Sbjct  63   MNDFARISKQKGYKTLRSFLE------NKGAS--CGYTEPNTTPRAIPRDGKVIFAHSNV  114

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNE  173
            G+ H GPCE+WLD+  +L  DNC + FPG      +D+SSCKG+CMLR YWLG  F    
Sbjct  115  GFVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLG--FQDQG  172

Query  174  HSWQVYKACIPLSSSARRL  192
              WQ YK C+P+    +RL
Sbjct  173  QRWQTYKYCVPVKKGGKRL  191

>PYIR_16435
Length=304

 Score = 111 bits (278),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 14/127 (11%)

Query  63   DFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHD  120
            +F    +  GY TLR++++  K T+       CG TN  A P+ IP D T++ S    H 
Sbjct  66   NFATVSKEKGYSTLRSYIED-KGTL-------CGRTNPDATPKAIPSDNTVKFSRAIVHP  117

Query  121  GPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
            GPCE+WLD  RV+Q DNC  TF  K  T+ +D+SSCKGSCMLRW+WLG +   +   WQV
Sbjct  118  GPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQV  175

Query  179  YKACIPL  185
            YK C+PL
Sbjct  176  YKNCVPL  182

>PHYSO_342364
Length=194

 Score = 108 bits (269),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 78/139 (56%), Gaps = 15/139 (11%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDG--TMRSTG  116
            K+V+ FN  + S+ YK LR  +D    T   G +  CG+TN    PQPIP     + S G
Sbjct  61   KSVQVFNSLKTSHNYKDLRTLLDN---TAVYGPN--CGYTNPNGTPQPIPTNGKAIFSRG  115

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNL------DYSSCK--GSCMLRWYWLGTR  168
              H GPCE+WLD  +V+ +D+C+  +     N+      DYS CK  G CM+R+YWLG +
Sbjct  116  LIHTGPCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQ  175

Query  169  FLKNEHSWQVYKACIPLSS  187
             L  +  WQ YK CIPL +
Sbjct  176  ALGKKTVWQTYKNCIPLKA  194

>PYAP_24689
Length=252

 Score = 108 bits (271),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 99/187 (53%), Gaps = 23/187 (12%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQG------FKTVEDFNGWRRSNGYKTLRAF  79
            DAH  V  P   +      TKY P +++   G       +T   ++  R+ +G KTLRAF
Sbjct  24   DAHTYVSQPRAEF---KPGTKY-PSSWVAEFGPPWPGTIRTGAQYDAVRKKHGVKTLRAF  79

Query  80   MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
            ++ +K  V       CG TN  A  +PIP DG ++  +   H GPCE+W D+TRV    +
Sbjct  80   LE-SKGPV-------CGSTNPNAKRKPIPRDGLIKFGSSMEHPGPCEIWFDNTRVFVDAD  131

Query  138  CHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAA  196
            C++ F   T + +DYS C+G C+LR+YWLG +       WQ YK C+PL +  R LE   
Sbjct  132  CNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGGKRWQSYKNCVPLGNDKRMLEEGG  189

Query  197  NESAAIE  203
            +E A  E
Sbjct  190  DEVAETE  196

>PHYKE_10578
Length=239

 Score = 106 bits (264),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 89/195 (46%), Gaps = 28/195 (14%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLA---FLESQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
            DAH  + +P PT+      + +  L    +    G   V  F       G       +D 
Sbjct  21   DAHGALKVPEPTFEQGASHSNWVTLVDNYWDIGSGGDQVGKFKTMATEKGMSVKDVILDM  80

Query  83   AKYTVTDGADYYCGFTNAKAAPQPIP-DGTM-----RSTGYTHDGPCEVWLDSTRVLQSD  136
             K       D  CGFT A A PQP+P DG +      + G+TH GPCEV++D   VL  D
Sbjct  81   VK-------DKKCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGD  133

Query  137  NCHETFPG--------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
            NC + +PG            +DYSSC G CML +YWLG    +NE  WQ Y  C+PL+ S
Sbjct  134  NCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLG---FQNEQ-WQSYVNCVPLTGS  189

Query  189  ARRLEGAANESAAIE  203
             +      + + A E
Sbjct  190  GKSTGAQPSGNQATE  204

>PYIW_19151
Length=248

 Score = 106 bits (264),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 86/136 (63%), Gaps = 14/136 (10%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            +K  ++F    +  G+ TLR++++        GA   CGFT+ K +P+ IP D T+R S 
Sbjct  55   WKDPKNFAAAAKEKGFSTLRSYLE------DKGA--VCGFTDPKVSPRAIPADRTIRFSR  106

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNE  173
               H GPCE+++D TRV Q+D+C   F G   ++++D+S CKG CM+R+YWLG     + 
Sbjct  107  DIPHPGPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLG--LQASG  164

Query  174  HSWQVYKACIPLSSSA  189
              WQVYK+C+P+SSSA
Sbjct  165  TRWQVYKSCVPVSSSA  180

>PHYRA_78625
Length=434

 Score = 109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 84/169 (50%), Gaps = 49/169 (29%)

Query  26   DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T  N  +      + PL+FLE +GF+T E+F  ++  NGY +LR F+
Sbjct  239  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  298

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  140
            D AKY +                                             L   NCHE
Sbjct  299  DKAKYKLA--------------------------------------------LSYLNCHE  314

Query  141  TFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            +   +T+ LDYS C  SC+L WYWLG R+LK  +SWQVYK CI L S +
Sbjct  315  SITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGS  363

>PHYRA_78626
Length=473

 Score = 109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 84/169 (50%), Gaps = 49/169 (29%)

Query  26   DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T  N  +      + PL+FLE +GF+T E+F  ++  NGY +LR F+
Sbjct  278  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  337

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  140
            D AKY +                                             L   NCHE
Sbjct  338  DKAKYKLA--------------------------------------------LSYLNCHE  353

Query  141  TFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            +   +T+ LDYS C  SC+L WYWLG R+LK  +SWQVYK CI L S +
Sbjct  354  SITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGS  402

>PYIR_16443
Length=275

 Score = 105 bits (263),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 97/179 (54%), Gaps = 30/179 (17%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLE-----SQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AH  + +P   +    K TKY     +E        +K  ++F    +  G++TLR+++
Sbjct  24   NAHGFIEVPKSEFV---KGTKYPSEWIVEFPPPWEGNWKDPKNFATVSKQKGFETLRSYI  80

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR--STGYTHDGPCEVWLDSTRVLQSDNC  138
            +        GA   CG TN  A+P+ IP  ++   S    H GPCE+WLD  RV+Q DNC
Sbjct  81   EDK------GA--LCGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEIWLDDKRVMQDDNC  132

Query  139  HETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY-KAC-------IPLSS  187
              TF  K  T+ +D+SSCKGSCMLRW+WLG +   +   WQVY K+C       IP++S
Sbjct  133  EGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSCDSSPLCIIPIAS  189

>PYAP_18709
Length=235

 Score = 103 bits (257),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 90/167 (54%), Gaps = 16/167 (10%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLE---SQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
            D H  V L  P        +K + +A  +   S  FKT   +       G+K LR+F++ 
Sbjct  19   DVHAHVYLTQPLAEFKAGASKSSWVAEFQPPWSGEFKTGAQYAAVAPGKGFKDLRSFLED  78

Query  83   AKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHE  140
               T        CG +   A+P+PIP DGT++ ++   H GPCEVWLD+TR   +D+C +
Sbjct  79   KGPT--------CGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLDNTRAFHNDDCEK  130

Query  141  TFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
             F   T + +D+ +CKGSCMLR+YWLG +       WQ YK CIPL+
Sbjct  131  AFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLN  175

>PYAP_18711
Length=210

 Score = 101 bits (252),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 91/181 (50%), Gaps = 21/181 (12%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLE-----SQGFKTVEDFNGWRRSNGYKTLRAFM  80
            DAH  V  P   +      TKY      E     S  F+T   ++  R+  G K LRAF+
Sbjct  21   DAHTYVKSPLAEFKAG---TKYPSEWVAEFGPPWSGTFRTGAQYDAERKKRGIKNLRAFL  77

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNC  138
            +      + G +  CG TN  A  +PIP DG ++  +   H GPCEVW D+T V    +C
Sbjct  78   E------SKGPE--CGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEVWFDNTLVFSEVDC  129

Query  139  HETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAAN  197
             + F   T + +DYS CKG+CMLR+YWLG +       WQ YK C+P+ S+ +     A 
Sbjct  130  EKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPIGSATKSRSIDAE  187

Query  198  E  198
            E
Sbjct  188  E  188

>PHYRA_73582
Length=326

 Score = 103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 97/191 (51%), Gaps = 26/191 (14%)

Query  27   AHQVVLLPAPTYTTDNKD---TKYAPL---AFLESQGFKTV-EDFNGWRRSNGYKTLRAF  79
            AH  +  PAPT+  +  +    + APL    + ES+G   +   F     +N YK L+  
Sbjct  23   AHGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVFKELSATNNYKDLKTL  82

Query  80   MDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
            MDG ++    G D  CGFT+    P  P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  83   MDGPEF----GED--CGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  136

Query  138  CHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            C   +   T         +DYS C  G C+LR+YWL  + L  +  WQ YK CIPL+  A
Sbjct  137  CQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIPLTGPA  196

Query  190  RRLEGAANESA  200
                G A+++A
Sbjct  197  G---GGASQTA  204

>PYU1_G005324
Length=191

 Score = 100 bits (249),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 78/137 (57%), Gaps = 13/137 (9%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            F+T   +       GYK L++F+D    T        CG T + A  + IP DG ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
               H GPCE+WL +TR   +D+C +TF   T + +D+S+CKG+CMLR+YWLG +      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACIPLSSSARR  191
             WQ YK C+PL SS  R
Sbjct  165  RWQSYKNCVPLKSSKLR  181

>PYU1_G005326
Length=191

 Score = 100 bits (249),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 78/137 (57%), Gaps = 13/137 (9%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            F+T   +       GYK L++F+D    T        CG T + A  + IP DG ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
               H GPCE+WL +TR   +D+C +TF   T + +D+S+CKG+CMLR+YWLG +      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACIPLSSSARR  191
             WQ YK C+PL SS  R
Sbjct  165  RWQSYKNCVPLKSSKLR  181

>PYU1_G005328
Length=191

 Score = 100 bits (249),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 78/137 (57%), Gaps = 13/137 (9%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            F+T   +       GYK L++F+D    T        CG T + A  + IP DG ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
               H GPCE+WL +TR   +D+C +TF   T + +D+S+CKG+CMLR+YWLG +      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACIPLSSSARR  191
             WQ YK C+PL SS  R
Sbjct  165  RWQSYKNCVPLKSSKLR  181

>PHYCA_130365
Length=266

 Score = 102 bits (254),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 71/133 (53%), Gaps = 15/133 (11%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDG  121
            F     SN YK +R+ MDG      D     CGFT+    P  P  DGT   S G  H G
Sbjct  66   FKELAASNNYKDVRSMMDGNSVYGED-----CGFTDPNGTPVDPPTDGTATFSRGIVHAG  120

Query  122  PCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNE  173
            PCE+WLD   VLQ+D+C   +   T +       +DYSSC  G CMLR+YWLG + L  +
Sbjct  121  PCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGK  180

Query  174  HSWQVYKACIPLS  186
              WQ YK CIPL+
Sbjct  181  TVWQAYKNCIPLT  193

>PITG_04949
Length=337

 Score = 103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 92/180 (51%), Gaps = 22/180 (12%)

Query  27   AHQVVLLPAPTYT---TDNKDTKYAPL---AFLESQGFKTV-EDFNGWRRSNGYKTLRAF  79
            AH  +  PAP++    T+N   +  P     + ES+G + +   F      N +K +R+ 
Sbjct  23   AHGYIAKPAPSWKASKTNNWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNFKDVRSL  82

Query  80   MDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
            MDG      +     CGFT+ K  P +P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  83   MDGNPVFGEE-----CGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  137

Query  138  CHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            C   +   T         +DYSSC  G CMLR+YWL  + LK +  WQ YK CIPL+  A
Sbjct  138  CQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIPLTGPA  197

>PYVX_18175
Length=147

 Score = 98.2 bits (243),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 53/63 (84%), Gaps = 0/63 (0%)

Query  26  DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
           DAHQ V+LP P++TT ++D  Y+PLAFLE+QGFKT EDF+ WRR+NGYKTLR+FMD  KY
Sbjct  26  DAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGKY  85

Query  86  TVT  88
           T T
Sbjct  86  TDT  88

 Score = 88.2 bits (217),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)

Query  149  LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAI  202
            +DYSSCKGSC L WYW+G R+LK  +SWQVYK C+PLS+SAR LE A+NESA I
Sbjct  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESALI  143

>PPTG_04618
Length=326

 Score = 102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 91/180 (51%), Gaps = 22/180 (12%)

Query  27   AHQVVLLPAPTYT---TDNKDTKYAPL---AFLESQGFKTV-EDFNGWRRSNGYKTLRAF  79
            AH  +  PAP++    T++   +  P     + ES+G + +   F      N YK +R+ 
Sbjct  23   AHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNYKDVRSL  82

Query  80   MDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
            MDG      D     CGFT+ K  P +P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  83   MDGNPVYGED-----CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  137

Query  138  CHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            C   +   T         +DYSSC  G CMLR+YWL  + L  +  WQ YK CIPL+  A
Sbjct  138  CQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPLTGPA  197

>PHYKE_8104
Length=86

 Score = 95.5 bits (236),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)

Query  26  DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
           DAHQ+VLLP PT+TT++KDTKY PLAFLE +GF   EDF  WR  NGYK+LR FMD AKY
Sbjct  26  DAHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDNAKY  85

>PYAR_14260
Length=212

 Score = 99.0 bits (245),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 76/137 (55%), Gaps = 13/137 (9%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            FKT   +       G+K LR+F++    T        CG + + A P+PIP DG ++ ++
Sbjct  31   FKTGAQYAAVAPGKGFKNLRSFLESKGPT--------CGNSLSSAKPKPIPSDGMVKFAS  82

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
               H GPCE+WLD T    SD+C + F   T   +++S+CKGSCMLR+YWLG +   +  
Sbjct  83   TLEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGT  140

Query  175  SWQVYKACIPLSSSARR  191
             WQ YK C+PL     R
Sbjct  141  RWQSYKNCVPLGGGKSR  157

>PHYSO_483955
Length=320

 Score = 101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 71/136 (52%), Gaps = 15/136 (11%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDG  121
            F     +N YK +R+ MDG      D     CGFT+ K  P  P  DGT   S G  H G
Sbjct  67   FKELSAANNYKDVRSLMDGNPVYGED-----CGFTDPKGKPVAPPTDGTATFSRGIVHAG  121

Query  122  PCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNE  173
            PCE+WLD   VLQ+D+C   +   T         +DYSSC  G CMLR+YWL  + L  +
Sbjct  122  PCEIWLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGK  181

Query  174  HSWQVYKACIPLSSSA  189
              WQ YK CIPL+  A
Sbjct  182  TVWQAYKNCIPLTGPA  197

>PPTG_04622
Length=273

 Score = 100 bits (248),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 75/138 (54%), Gaps = 16/138 (12%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
            +   + SNGY  +RA +D      TD     CGFT+  A P+  P   D T  S G  H 
Sbjct  69   YTSLKESNGYSDIRALLDSD----TDLYGANCGFTDPDATPKDPPTTGDATF-SRGMVHA  123

Query  121  GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKN  172
            GPCE+WLD T VL +D+C   +   T +       +DYSSC  G CMLR+YWL  + + +
Sbjct  124  GPCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDS  183

Query  173  EHSWQVYKACIPLSSSAR  190
            +  WQVYK C+PL+  A 
Sbjct  184  KMVWQVYKDCVPLTGPAE  201

>PITG_04948
Length=232

 Score = 99.0 bits (245),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 73/132 (55%), Gaps = 14/132 (11%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
            + SN  K +R  +D    T   GAD  CG+TN   +P+ P  DGT   S G  H GPCE+
Sbjct  71   KASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEI  126

Query  126  WLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQ  177
            WLD   VLQ+D+C   +   T         +DYSSC  G CMLR+YWL  + L  +  WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQ  186

Query  178  VYKACIPLSSSA  189
            VYK CIPLS  A
Sbjct  187  VYKNCIPLSGPA  198

>PHYSO_533903
Length=208

 Score = 97.4 bits (241),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 78/138 (57%), Gaps = 16/138 (12%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DG-TMRSTG  116
            K+VE F   + +N +K L+  +D       D     CGFT+    PQPIP DG  + S G
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  116

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSCK-GSC-MLRWYWLGTR  168
              H GPCE WLD  +VL +D+C+  +     N      +DYSSC+ G C M+R+YWLG +
Sbjct  117  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  176

Query  169  FLKNEHS-WQVYKACIPL  185
             L ++ + WQ YK CIPL
Sbjct  177  ALDDKKTVWQTYKDCIPL  194

>PYU1_G005325
Length=207

 Score = 97.1 bits (240),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 75/131 (57%), Gaps = 13/131 (10%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            F+T   +       GYK L++F+D    T        CG T + A  + IP DG ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
               H GPCE+WL +TR   +D+C +TF   T + +D+S+CKG+CMLR+YWLG +      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACIPL  185
             WQ YK CIPL
Sbjct  165  RWQSYKNCIPL  175

>PHYRA_74651
Length=344

 Score = 99.8 bits (247),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 73/134 (54%), Gaps = 16/134 (12%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
            +   + SNGY  +R  +D    T   GAD  CGFT+  A P+  P   D T  S G  H 
Sbjct  69   YTSLKESNGYSDIRTLLDSD--TSLYGAD--CGFTDPNATPKDPPSTGDATF-SRGMVHA  123

Query  121  GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKN  172
            GPCE+WLD T+VL +DNC   +   T         +DYSSC  G C LR+YWL  + L +
Sbjct  124  GPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDS  183

Query  173  EHSWQVYKACIPLS  186
               WQVYK C+PL+
Sbjct  184  STVWQVYKNCVPLT  197

>PYIW_27477
Length=180

 Score = 95.9 bits (237),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 89/181 (49%), Gaps = 22/181 (12%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLE-----SQGFKTVEDFNGWRRSNGYKTLRAFM  80
            +AH  V +P   + +    T Y     +E        +K   +F    +  G++TLR+++
Sbjct  1    NAHGFVEVPKSEFPSG---TSYPSEWIVEFAPPWEGSWKDPANFAKVSKEKGFETLRSYI  57

Query  81   D--GAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNC  138
            +  GAK   TD         NAKA   P  +    S    H GPCE+W+D TRV+Q DNC
Sbjct  58   EDKGAKCGKTD--------PNAKAKAIPSDNVVKFSRAIVHPGPCELWIDDTRVMQDDNC  109

Query  139  HETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAA  196
             +TF  K  T+ +D+S+CKG CMLRW+WLG +   +   WQVY          R  EG+ 
Sbjct  110  EKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVYIPGHDHQGPGRHHEGSG  167

Query  197  N  197
             
Sbjct  168  Q  168

>PHYRA_73607
Length=343

 Score = 99.0 bits (245),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 76/137 (55%), Gaps = 16/137 (12%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
            ++  + SNGY  +R  +D    T   GAD  CGFTN  A  +  P   D T  S G  H 
Sbjct  69   YSSLKSSNGYSDIRTLLDSD--TSLYGAD--CGFTNPDATAKDPPTTGDATF-SRGMVHV  123

Query  121  GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKN  172
            GPCE+WLD T+VL +DNC   +   T +       +DYSSC  S CMLR+YWL  + + +
Sbjct  124  GPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  173  EHSWQVYKACIPLSSSA  189
               WQVYK C+PL+  A
Sbjct  184  SMVWQVYKNCVPLTGPA  200

>PHALS_03176
Length=207

 Score = 96.3 bits (238),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 82/153 (54%), Gaps = 16/153 (10%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
            K+V+ F   + +N +K L+  MD + +    GA   CGF++ K  PQPIP DG    S  
Sbjct  61   KSVKTFQKLKAANKFKDLKTLMDTSAF----GAK--CGFSDPKGKPQPIPKDGKATFSRA  114

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNL------DYSSC-KGSCM-LRWYWLGTR  168
              H GPCE+WLD+ +VL  D+C+  +     N+      DYSSC  G C  +R+YWL  +
Sbjct  115  IVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQ  174

Query  169  FLKNEHSWQVYKACIPLSSSARRLEGAANESAA  201
             +  +  WQ YK CIPL  S+ +  G     ++
Sbjct  175  GVNGKTVWQSYKNCIPLQGSSGKNGGTIRRGSS  207

>PYU1_G014690
Length=295

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 76/132 (58%), Gaps = 14/132 (11%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            +K   +F    +  G+ TLR++++        GA   CG T+  A P+ IP D  +  S 
Sbjct  57   WKDPANFAKVSKEKGFDTLRSYIEDK------GA--LCGKTDPNATPKAIPSDNKVHFSR  108

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNE  173
               H GPCE+WLD  RV+Q D+C  TF  +   +N+D+SSCK +CMLR++WLG     + 
Sbjct  109  PIVHPGPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLG--LQDSG  166

Query  174  HSWQVYKACIPL  185
              WQVYK C+PL
Sbjct  167  TRWQVYKNCVPL  178

>PPTG_04619
Length=276

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 71/132 (54%), Gaps = 14/132 (11%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
            + SN  K +R  +D    T   GAD  CG+TN    P+ P  DGT   S G  H GPCE+
Sbjct  71   KASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  126

Query  126  WLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQ  177
            WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  + L  +  WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  186

Query  178  VYKACIPLSSSA  189
            VYK CIPLS  A
Sbjct  187  VYKNCIPLSGPA  198

>PHYCA_12942
Length=353

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 80/172 (47%), Gaps = 25/172 (15%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLA---FLESQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
            DAH  +  P PT+  D    ++  +    +    G   V  F       G       +D 
Sbjct  21   DAHGSLKQPKPTF--DGSSAEWVTMIDNYWDIGSGGDQVGKFKTMAAERGMSVKDVILDM  78

Query  83   AKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSD  136
             K       D  CG+T A A PQPIP DG ++       G+TH GPCE+++D   VL  D
Sbjct  79   VK-------DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGD  131

Query  137  NCHETFPG---KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            NC E F G       +DYSSC G+CML  YWLG +  +    WQ Y  C+PL
Sbjct  132  NCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>H310_06362
Length=197

 Score = 95.1 bits (235),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 24/130 (18%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTM------RSTGY--T  118
            + + G+KTLRA +D        G D  CG+T      +PIP DG +         G+  +
Sbjct  47   QMATGFKTLRAMLD------PHGPD--CGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPS  98

Query  119  HDGPCEVWLDSTRVLQSDNCHETFPGK---TYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
            H GPCE+WLD+TRV Q++NC   FP K      +D+SSC GSC +R+YWL      +E  
Sbjct  99   HTGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDL  154

Query  176  WQVYKACIPL  185
            WQVYK C PL
Sbjct  155  WQVYKNCAPL  164

>PHYSO_485524
Length=278

 Score = 96.7 bits (239),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 72/132 (55%), Gaps = 14/132 (11%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
            + SN  K +R  +D    T   GA+  CG+TN  A P+ P  DGT   S G  H GPCE+
Sbjct  71   KDSNNAKDIRTLLDSD--TKLYGAN--CGYTNPDATPEDPPTDGTATFSRGIVHAGPCEI  126

Query  126  WLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQ  177
            WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  + L  +  WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  186

Query  178  VYKACIPLSSSA  189
            VYK CIPLS  A
Sbjct  187  VYKNCIPLSGPA  198

>PYU1_G005323
Length=251

 Score = 95.5 bits (236),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 72/132 (55%), Gaps = 13/132 (10%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            F+T   +       GYK L++F++             CG +   A  +PIP DG ++ ++
Sbjct  54   FRTGAQYAAVAPGKGYKDLKSFLEDKGPV--------CGNSLPDAKAKPIPSDGVIKLAS  105

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
               H GPCEVW D  R    D+C +TF   T + +D+S+CKGSCMLR+YWLG +      
Sbjct  106  TIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGK  163

Query  175  SWQVYKACIPLS  186
             WQ YK CIPL+
Sbjct  164  RWQSYKNCIPLT  175

>PHYSO_438103
Length=238

 Score = 95.1 bits (235),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 85/176 (48%), Gaps = 21/176 (12%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFL------ESQGFKTVEDFNGWRRSNGYKTLRAF  79
            DAH  +L+P   +T          +  +      +     +VE F   + +N +K L+  
Sbjct  21   DAHGYMLIPESQFTGGANSAWVVQIDPVWASDKWDGNNAGSVEVFKSLKSANNFKDLKTL  80

Query  80   MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
            MD       D     CGFT+    PQPIP DG    S    H GPCE+WLD+T+VL  D+
Sbjct  81   MDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLYEDD  135

Query  138  CHETFPGK------TYNLDYSSCK-GSCM-LRWYWLGTRFLKNEHSWQVYKACIPL  185
            C   +  +       + +DYSSC  G C  +R+YWL  + L ++  WQ YK CIPL
Sbjct  136  CFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

>SDRG_16535
Length=313

 Score = 96.3 bits (238),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 90/189 (48%), Gaps = 23/189 (12%)

Query  26   DAHQVVLLPAPTYTTDNKD-TKY-----APLAFLESQGFK----TVEDFNGWRRSNGYKT  75
            + H  ++ P PT+   N D TKY      P+    S   +        F    R++ ++T
Sbjct  16   NGHGFLINPTPTFNELNGDRTKYCGTIDGPVVLPGSSYNQDPAWNTRQFTMQFRASKFQT  75

Query  76   LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----THDGPCEVWLDST  130
            L +F+D   +         CG TNA  APQP+P     + G      +H+GPCEVW DST
Sbjct  76   LASFVDDPSFAPCG----TCGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVWCDST  131

Query  131  RVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
            RV Q+DNC         ++D + C G+  LR  WL      +  SWQVY  C+PLS S  
Sbjct  132  RVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCVPLSGSTI  187

Query  191  RLEGAANES  199
             +  A++ S
Sbjct  188  EIPPASSPS  196

>PYU1_G007364
Length=316

 Score = 96.3 bits (238),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (53%), Gaps = 19/138 (14%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYT----VTDGADYYCGFTNAKAAPQPIPDGTMRS-----  114
            FN   ++N     +AF    KY     +  G    CG T   A P+PIP   M S     
Sbjct  68   FNDNPQANVDTFTKAFQASGKYASLRDLLQGHGEDCGNTKLDATPKPIPSDGMVSWQNPD  127

Query  115  --TGY--THDGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTR  168
               G+  +H GPCE+WLD T VL+ +NC   FPG    +  D+SSC G C++R+YWL  +
Sbjct  128  TNEGFVPSHTGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ  187

Query  169  FLKNEHSWQVYKACIPLS  186
                E +WQ+YK CIPL+
Sbjct  188  ----EPAWQIYKNCIPLA  201

>PYAR_14256
Length=199

 Score = 93.6 bits (231),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 12/136 (9%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-STG  116
            F+T   +       G+K LRAF++    T        CG T   A P+P     ++ ++ 
Sbjct  51   FRTGAQYAAVAPDKGFKNLRAFLEDKGPT--------CGNTLPNAKPKPXXXXLIKLAST  102

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
              H GPCE+WLD +     D+C + F   T + +D+S+CKGSCMLR+YWLG +   +   
Sbjct  103  IEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKR  160

Query  176  WQVYKACIPLSSSARR  191
            WQ YK CIPL  +  R
Sbjct  161  WQSYKNCIPLGGAQSR  176

>PHYRA_78689
Length=296

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 76/137 (55%), Gaps = 15/137 (11%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
            ++V+ F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S  
Sbjct  61   QSVDTFKSLKTANNFKDLKTLMDD---TSVYGAD--CGFTDPDGTPQPIPTDGKATFSRA  115

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSCK-GSC-MLRWYWLGTR  168
              H GPCE+WLD T+VL  D+C   +  +       + +DYSSC  G C  +R+YWL  +
Sbjct  116  LVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQ  175

Query  169  FLKNEHSWQVYKACIPL  185
             L ++  WQ YK CIPL
Sbjct  176  GLDSKTVWQSYKDCIPL  192

>PHYCA_127270
Length=279

 Score = 94.7 bits (234),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 74/137 (54%), Gaps = 15/137 (11%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
            ++V+ F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S  
Sbjct  61   QSVDTFKSLKAANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRA  115

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSC-MLRWYWLGTR  168
              H GPCE+WLD  +VL  D+C   +  K       + +DYSSC  G C  +R+YWL  +
Sbjct  116  LVHVGPCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQ  175

Query  169  FLKNEHSWQVYKACIPL  185
             L  +  WQ YK CIPL
Sbjct  176  GLSKKTVWQSYKDCIPL  192

>PYIW_24289
Length=196

 Score = 92.8 bits (229),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 80/180 (44%), Gaps = 27/180 (15%)

Query  26   DAHQVVLLPAPTYTTDNKD-----TKYAPLAFLESQG-------------FKTVEDFNGW  67
            D H  + +P PT+TT   +     T   P      +G             FKT   F+  
Sbjct  24   DGHGAMSVPQPTFTTGIVNEGFCATMLGPEVLPVPEGMSYSGSPEMNALAFKTA--FSSQ  81

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWL  127
              S  Y+ LR  +D  K   + G D  CGFTN  +A QP+          TH GPCE+W 
Sbjct  82   TDSIKYRNLRDLID-TKAVFSAGTDKECGFTNVTSAKQPLSAHATGGFTPTHQGPCEIWC  140

Query  128  DSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            D   V Q+DNC + +P     L Y  S C G+ ML++YWL    +K    W+ Y  C PL
Sbjct  141  DRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINCAPL  196

>PPTG_04620
Length=342

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 72/131 (55%), Gaps = 18/131 (14%)

Query  68   RRSNGYKTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPC  123
            ++SN  K +R  +DG AK    D     CG T+ KA P+  P   D T  S G  H GPC
Sbjct  73   KKSNNVKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPSTGDATF-SRGIVHAGPC  126

Query  124  EVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHS  175
            E+WLD   VLQ+D+C   +   T         +DYSSCK G CM R+YWL  +   ++  
Sbjct  127  EIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTL  186

Query  176  WQVYKACIPLS  186
            WQVYK CIPLS
Sbjct  187  WQVYKNCIPLS  197

>PYAR_24113
Length=192

 Score = 92.4 bits (228),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 86/174 (49%), Gaps = 19/174 (11%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKT--------VEDFNGWRRSNGYKTLR  77
            DAH  ++ PAP YTT+  ++    +  L++   KT           FN   +++ YK+L+
Sbjct  20   DAHSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLK  79

Query  78   AFMDGAKYTVTDGADYYCGF-TNAKAAPQPIPDGTM--RSTGYTHDGPCEVWLDSTRVLQ  134
              +      V+ GA   CGF T + A PQP+PD       TG +H GPCEVW D+    Q
Sbjct  80   ELVL-QNQKVSAGATAECGFATLSGATPQPLPDVVEWDEFTG-SHTGPCEVWCDNNLAFQ  137

Query  135  SDNCHETFPGKTYNLDYS--SCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
             DNC +   G    L+Y   +C G+ +L  YW+     +    WQVY  C PLS
Sbjct  138  DDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQVYTGCAPLS  187

>PHYRA_73606
Length=366

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 73/133 (55%), Gaps = 14/133 (11%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN--AKAAPQPIPDGTMRSTGYTHDG  121
            + G + SNGY  +R  +D    T   GAD  CG+TN  A A   P       S G  H G
Sbjct  69   YTGLKSSNGYSDIRTLLD--SDTSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVG  124

Query  122  PCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNE  173
            PCE+WLD T VL +D+C   +   T +       +DYSSC  S CMLR+YWL  + + +E
Sbjct  125  PCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSE  184

Query  174  HSWQVYKACIPLS  186
              WQVYK C+PL+
Sbjct  185  IVWQVYKDCVPLT  197

>PHYRA_73584
Length=287

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 76/137 (55%), Gaps = 16/137 (12%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
            ++  ++SNGY  +R  +D    T   GA+  CGFTN  A  +  P   D T  S G  H 
Sbjct  66   YSSLKKSNGYSDIRTLLDSD--TTLYGAN--CGFTNPDATAKDPPTTGDATF-SRGMVHA  120

Query  121  GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKN  172
            GPCE+WLD T VL +D+C   +   +         +DYSSC  S CMLR+YWL  + + +
Sbjct  121  GPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  180

Query  173  EHSWQVYKACIPLSSSA  189
            +  WQVYK C+PL+  A
Sbjct  181  KTVWQVYKDCVPLTGPA  197

>PHYSO_533682
Length=278

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 74/136 (54%), Gaps = 15/136 (11%)

Query  60   TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
            +VE F  ++  N +K L+  MD       D     CGFT+    PQPIP DG    S G 
Sbjct  62   SVEVFTSFKSVNNFKDLKTLMDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRGL  116

Query  118  THDGPCEVWLDSTRVLQSDNCHETF--PGK----TYNLDYSSC-KGSCM-LRWYWLGTRF  169
             H GPCE+WLD  +VL  D+C+  +  P +    T+ +DYSSC  G C  +R Y LG + 
Sbjct  117  IHVGPCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQG  176

Query  170  LKNEHSWQVYKACIPL  185
            L ++  WQ YK CIPL
Sbjct  177  LVDKTVWQSYKNCIPL  192

>PYIR_23585
Length=240

 Score = 93.2 bits (230),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 73/130 (56%), Gaps = 14/130 (11%)

Query  60   TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
            +  DF       G+ T RAF++    T        CG T A A+P+PIP D T++ S   
Sbjct  58   SAADFAKTAPGKGFATTRAFLESRGPT--------CGNTLANASPKPIPSDNTVKFSRAI  109

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
             H GPCE+W+D+TRV  +D+C   F     T+ +D+S+CKGSCMLR+YWLG +       
Sbjct  110  VHPGPCELWIDNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGAR  167

Query  176  WQVYKACIPL  185
            +Q Y  C+ L
Sbjct  168  FQSYSKCLAL  177

>PHYKE_2809
Length=291

 Score = 94.0 bits (232),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 70/129 (54%), Gaps = 14/129 (11%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
            + +N  K +R  +D    T   G D  CGFT+ KA P+ P  DG    S G  H GPCE+
Sbjct  58   KAANNVKDIRTMLDSD--TKLYGQD--CGFTDPKATPKDPPTDGAATFSRGIVHAGPCEI  113

Query  126  WLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHSWQ  177
            WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  + L  +  WQ
Sbjct  114  WLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQ  173

Query  178  VYKACIPLS  186
            VYK C+PLS
Sbjct  174  VYKNCVPLS  182

>PHYCA_531163
Length=314

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 75/137 (55%), Gaps = 16/137 (12%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
            +   + SNGY  +R  +D    T   GAD  CG+TNA A  +  P   D T  S G  H 
Sbjct  69   YTSLKSSNGYSDIRTLLD--SDTSLYGAD--CGYTNADATAKDPPSTGDATF-SRGMVHV  123

Query  121  GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKN  172
            GPCE+WLD T VL +D+C   +   T +       +DYSSC  S CMLR+YWL  + + +
Sbjct  124  GPCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  173  EHSWQVYKACIPLSSSA  189
               WQVYK C+PL+  A
Sbjct  184  AIVWQVYKDCVPLTGPA  200

>PITG_11936
Length=333

 Score = 94.4 bits (233),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 80/176 (45%), Gaps = 22/176 (13%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTV---------EDFNGWRRSNGYKTLRA  78
            H  +  P   +T +  +T+Y         GF  +          +FN    ++ YK+L+ 
Sbjct  24   HGYMTAPKVEFTFNGDNTQYMATIDASKSGFSGIFGGSPTDNTANFNKGFAASKYKSLKE  83

Query  79   FMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-------GTMRSTGYTHDGPCEVWLDSTR  131
            FM+     V +     CG+TN  A PQP+P        G       +H+GPCEV+ D TR
Sbjct  84   FMNDNMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCEVYCDETR  143

Query  132  VLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            V Q DNC + FP     L  D+ +C GS  L  YW+      +  SWQVY  C PL
Sbjct  144  VFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIAL----HSPSWQVYINCAPL  195

>PYIW_18790
Length=86

 Score = 88.6 bits (218),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 50/78 (64%), Gaps = 0/78 (0%)

Query  31   VLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDG  90
            VLLP PT+T   +  ++ PLAFLE+QGFKT  DF  + R  GYKTLR FMD       DG
Sbjct  5    VLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKVDG  64

Query  91   ADYYCGFTNAKAAPQPIP  108
             D+ CG++  K  PQPIP
Sbjct  65   GDFECGWSTLKGTPQPIP  82

>PPTG_04647
Length=327

 Score = 94.4 bits (233),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 72/133 (54%), Gaps = 14/133 (11%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN--AKAAPQPIPDGTMRSTGYTHDGPCEV  125
            + SNGY  +R  +D    T   GAD  CG+TN  A A   P       S G  H GPCE+
Sbjct  72   KSSNGYSDIRTLLD--SDTDLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEI  127

Query  126  WLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSWQ  177
            WLD T VL +DNC   +   T +       +DYSSC  S CMLR+YWL  + + ++  WQ
Sbjct  128  WLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  187

Query  178  VYKACIPLSSSAR  190
            VYK C+PL+  A 
Sbjct  188  VYKDCVPLTGPAS  200

>PITG_04947
Length=298

 Score = 93.6 bits (231),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 70/130 (54%), Gaps = 18/130 (14%)

Query  68   RRSNGYKTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPC  123
            ++SN  K +R  +DG AK    D     CG T+ KA P+  P   D T  S G  H GPC
Sbjct  46   KKSNNIKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPTTGDATF-SRGIVHAGPC  99

Query  124  EVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHS  175
            E+WLD   VLQ+D+C   +   T         +DYSSCK G CM R+YWL  +    +  
Sbjct  100  EIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTL  159

Query  176  WQVYKACIPL  185
            WQVYK CIPL
Sbjct  160  WQVYKNCIPL  169

>H257_13550
Length=266

 Score = 93.2 bits (230),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 77/142 (54%), Gaps = 27/142 (19%)

Query  59   KTVEDFNGWRR---SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTM--  112
            K V  FN   R   + G+KTLRA +D        G D  CG++      +PIP DG +  
Sbjct  90   KNVAAFNKAFRDQQATGFKTLRAMLD------PQGPD--CGYSKLDVPAKPIPSDGNVVW  141

Query  113  ----RSTGY--THDGPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKGSCMLRWY  163
                   G+  +H GPCE+WLD+TRV Q+D+C   FP K      +D++SC GSC +R+Y
Sbjct  142  QNPDSGEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFY  201

Query  164  WLGTRFLKNEHSWQVYKACIPL  185
            W+      ++  WQVYK C PL
Sbjct  202  WIAL----HQDLWQVYKNCAPL  219

>PHYSO_484051
Length=285

 Score = 93.2 bits (230),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 73/134 (54%), Gaps = 16/134 (12%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
            + SNGY  +R  +D    T   GAD  CGFTN  A+P+  P   D T  S    H  PCE
Sbjct  73   KESNGYSDIRTLLDSD--TSLYGAD--CGFTNPDASPKDPPTTGDPTF-SRCMVHASPCE  127

Query  125  VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSW  176
            +WLD T VL +D+C   +   T         +DYSSC  S CMLR+YWL  + + ++  W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  177  QVYKACIPLSSSAR  190
            QVYK C+PL+  A 
Sbjct  188  QVYKDCVPLTGPAE  201

>PHYSO_459106
Length=223

 Score = 91.7 bits (226),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 71/133 (53%), Gaps = 16/133 (12%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
            +++N  K +R  +D    T   G D  CGFT+ K  PQ  P   D T  S G  H GPCE
Sbjct  71   KKANNVKDIRTMIDSD--TKLYGED--CGFTDPKGKPQDPPTTGDATF-SRGIVHAGPCE  125

Query  125  VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSW  176
            +WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  +   ++  W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYW  185

Query  177  QVYKACIPLSSSA  189
            QVYK CIPL+  A
Sbjct  186  QVYKNCIPLTGPA  198

>PITG_19818
Length=147

 Score = 89.7 bits (221),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 0/58 (0%)

Query  26  DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGA  83
           DAHQ+VLLP P +TT +KDTKY PLAFLE+QGFK  +DF  WR  NGYK+LR FMD A
Sbjct  24  DAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81

>PHYRA_77971
Length=230

 Score = 91.7 bits (226),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 65/131 (50%), Gaps = 20/131 (15%)

Query  90   GADYYCGFTNAKAAPQPIPDGTMR------STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
            GAD  CGFT     PQP+P             GYTH GPCE+++D   VL SDNC   +P
Sbjct  82   GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYP  141

Query  144  GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR--RLE  193
            G   +        +DYSSC G C    YWLG +       WQ Y  C+PLS +    + +
Sbjct  142  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAYINCVPLSGTGETTQTQ  197

Query  194  GAANESAAIEF  204
             + + SA++E 
Sbjct  198  ASGSRSASVEV  208

>PHYRA_85794
Length=230

 Score = 91.7 bits (226),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 65/131 (50%), Gaps = 20/131 (15%)

Query  90   GADYYCGFTNAKAAPQPIPDGTMR------STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
            GAD  CGFT     PQP+P             GYTH GPCE+++D   VL SDNC   +P
Sbjct  82   GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYP  141

Query  144  GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR--RLE  193
            G   +        +DYSSC G C    YWLG +       WQ Y  C+PLS +    + +
Sbjct  142  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAYINCVPLSGTGETTQTQ  197

Query  194  GAANESAAIEF  204
             + + SA++E 
Sbjct  198  ASGSRSASVEV  208

>PPTG_14221
Length=275

 Score = 92.4 bits (228),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 72/137 (53%), Gaps = 15/137 (11%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
            K+V+ F   + +N +K L+  MD    T   GAD  CGFTN    PQPIP DG    S  
Sbjct  61   KSVDTFKSLKAANNFKDLKTLMDD---TSVYGAD--CGFTNPNGTPQPIPTDGKATFSRA  115

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGKT------YNLDYSSC-KGSC-MLRWYWLGTR  168
              H GPC +WLD   VL  D+C   +  +       + +DYSSC  G C  +R+YWL  +
Sbjct  116  LVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQ  175

Query  169  FLKNEHSWQVYKACIPL  185
             L  +  WQ YK CIPL
Sbjct  176  GLNKKTVWQSYKDCIPL  192

>PHYCA_534296
Length=309

 Score = 93.2 bits (230),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 74/136 (54%), Gaps = 15/136 (11%)

Query  60   TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
            +VE F   + +N +K L+  MD    T   GAD  CGFTN     QPIP DG    S   
Sbjct  36   SVETFKSLKSANNFKDLKTLMDD---TSVYGAD--CGFTNPSGTAQPIPTDGKATFSRAL  90

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPGKTYNL------DYSSC-KGSCM-LRWYWLGTRF  169
             H GPCE+WLD T+VL  D+C+  +  +  ++      DYSSC  G C  +R+YWL  + 
Sbjct  91   VHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQG  150

Query  170  LKNEHSWQVYKACIPL  185
            +  +  WQ YK CIPL
Sbjct  151  VDGKTVWQSYKDCIPL  166

>PYVX_18179
Length=147

 Score = 89.0 bits (219),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 48/68 (71%), Gaps = 0/68 (0%)

Query  26  DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
           DAHQ V+LP PT+T+++ D  Y+PLAFLE QGF T EDFN WR +NGY TLRAFMD A  
Sbjct  26  DAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAVS  85

Query  86  TVTDGADY  93
                 DY
Sbjct  86  GKDTAVDY  93

 Score = 87.4 bits (215),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)

Query  140  ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANES  199
            +   GK   +DYSSC GSC L W+W+G R+LK  +SWQVYK C+PLS+SAR LEGAAN S
Sbjct  82   QAVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANAS  141

Query  200  A  200
            A
Sbjct  142  A  142

>PPTG_03153
Length=314

 Score = 92.4 bits (228),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 81/179 (45%), Gaps = 25/179 (14%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLES--QGFK---------TVEDFNGWRRSNGYK  74
            +AH  +  PA  Y T    ++Y  +  +ES   GFK          V  F     S+ YK
Sbjct  19   NAHGWLTKPAAVYDTQMDKSQY--IGTIESTTSGFKGTFTGAPADNVAAFTKAFESSKYK  76

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
            +L+A +D     +  GA   CG  + KA PQP+P         S G+T  H+GPCEVW D
Sbjct  77   SLKAVIDDKAKIIVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHEGPCEVWCD  136

Query  129  STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              RV   DNC   +      L Y  S C G+  L  YW+      +  SWQVY  C PL
Sbjct  137  KERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVA----MHGPSWQVYVNCAPL  191

>CCI47381
Length=211

 Score = 90.1 bits (222),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 71/143 (50%), Gaps = 18/143 (13%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTD---GADYYCGFTNAKAAPQPIP---------DGT  111
            F+G  + N    L AF      T+ D       YCG TN  A+P+PIP           T
Sbjct  52   FDGSPKDNTATFLTAFASSPFRTLRDFLKDKGPYCGSTNPNASPKPIPADNAIVWENPDT  111

Query  112  MRSTGYTHDGPCEVWLDSTRVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWLGTRF  169
                  +H GPCEVWL  TRV   DNC  H T       +++SSC G C+L+++WL    
Sbjct  112  REGFVASHMGPCEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLAL--  169

Query  170  LKNEHSWQVYKACIPLSSSARRL  192
              +E  WQVYK CIP++ +  RL
Sbjct  170  --HEPQWQVYKNCIPIAPNGIRL  190

>SPRG_07796
Length=322

 Score = 92.4 bits (228),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 91/190 (48%), Gaps = 25/190 (13%)

Query  26   DAHQVVLLPAPTYTTDNKD-TKYAPL----------AFLESQGFKTVEDFNGWRRSNGYK  74
            D H  ++ P PT+   N D TKY             ++ +   + T++ F    +++ ++
Sbjct  17   DGHGFLINPTPTFNELNGDRTKYCGTIDGPTTLPGSSYNQDPAWNTLQ-FTTQFKASPFR  75

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----THDGPCEVWLDS  129
            TL AF+D             CG TNA  A QP+P     + G      +H+GPCEVW DS
Sbjct  76   TLAAFVDSQNVASCG----RCGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWCDS  131

Query  130  TRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            TRV Q+DNC         ++D + C G+  LR  WL      +  SWQVY  C+PLS S 
Sbjct  132  TRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQVYINCVPLSGST  187

Query  190  RRLEGAANES  199
              +  AA+ S
Sbjct  188  VVIPPAASPS  197

>PHYKE_6002
Length=197

 Score = 89.7 bits (221),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 22/167 (13%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFL------ESQGFKTVEDFNGWRRSNGYKTLRAF  79
            +AH  +L+P   +  D        +A +      +    ++V  F+  +++N +  L+  
Sbjct  22   NAHGYMLIPESQFKGDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSLKKANNFVDLKTL  81

Query  80   MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
            MD    T   GAD  CGFT+    PQPIP DG    S    H GPCE+WLDST+    DN
Sbjct  82   MDD---TSVYGAD--CGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWLDSTKAFSKDN  136

Query  138  C--HETFPGKTYNLDYSSCK-GSCM-LRWYWLGTRFLKNEHSWQVYK  180
            C   ETFP     +DYSSC  G C  +R+YWL  + L ++  WQ Y+
Sbjct  137  CADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PHYRA_73583
Length=630

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 72/133 (54%), Gaps = 16/133 (12%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
            + SN  K +R  +D    T   GA+  CG+TN  A+P+  P   D T  S G  H GPCE
Sbjct  71   KASNNAKDIRTLLDSD--TTLYGAN--CGYTNPDASPKDPPSTGDATF-SRGIVHAGPCE  125

Query  125  VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSW  176
            +WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  + L  +  W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWW  185

Query  177  QVYKACIPLSSSA  189
            QVYK CIPLS  A
Sbjct  186  QVYKNCIPLSGPA  198

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 72/133 (54%), Gaps = 16/133 (12%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
            + SN  K +R  +D    T   GAD  CGFT+ KA P+  P   D T  S G  H GPCE
Sbjct  372  KASNNIKDIRTMIDSD--TKLYGAD--CGFTDPKATPKDPPSTGDATF-SRGMVHAGPCE  426

Query  125  VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHSW  176
            VWLD   VLQ+D+C   +   T         +DYSSC  G CM R++WL  +   ++  W
Sbjct  427  VWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWW  486

Query  177  QVYKACIPLSSSA  189
            QVYK C+PLS  A
Sbjct  487  QVYKNCVPLSGPA  499

>PHYRA_86151
Length=170

 Score = 89.0 bits (219),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 1/74 (1%)

Query  50   LAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-  108
            L+FLE +GF+T E+F  ++  NGY +LR F+D AKY V+DGAD  CG+++ K  PQ IP 
Sbjct  29   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  88

Query  109  DGTMRSTGYTHDGP  122
            DGTM  +GYTHD P
Sbjct  89   DGTMSPSGYTHDAP  102

>PHYRA_87941
Length=157

 Score = 88.6 bits (218),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 1/74 (1%)

Query  50   LAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-  108
            L+FLE +GF+T E+F  ++  NGY +LR F+D AKY V+DGAD  CG+++ K  PQ IP 
Sbjct  16   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  75

Query  109  DGTMRSTGYTHDGP  122
            DGTM  +GYTHD P
Sbjct  76   DGTMSPSGYTHDAP  89

>PHYSO_340333
Length=284

 Score = 91.3 bits (225),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 73/136 (54%), Gaps = 15/136 (11%)

Query  60   TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
            +V+ F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S   
Sbjct  62   SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAI  116

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSCM-LRWYWLGTRF  169
             H GPCE+WLD  +VL  D+C   +  +       + +DYSSC  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  176

Query  170  LKNEHSWQVYKACIPL  185
            +  +  WQ YK CIPL
Sbjct  177  VDGKTVWQSYKDCIPL  192

>PHYKE_2937
Length=366

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 71/132 (54%), Gaps = 14/132 (11%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN--AKAAPQPIPDGTMRSTGYTHDGPCEV  125
            + SNGY  +R  +D    T   GAD  CG+TN  A A   P       S G  H GPCE+
Sbjct  77   KSSNGYSDIRTLLD--SDTSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEI  132

Query  126  WLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSWQ  177
            WLD T VL +D+C   +   T +       +DYSSC  S CMLR+YWL  + + +   WQ
Sbjct  133  WLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVWQ  192

Query  178  VYKACIPLSSSA  189
            VYK C+PL+  A
Sbjct  193  VYKDCVPLTGPA  204

>PHYSO_340332
Length=295

 Score = 91.3 bits (225),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 73/136 (54%), Gaps = 15/136 (11%)

Query  60   TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
            +V+ F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S   
Sbjct  62   SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAI  116

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSCM-LRWYWLGTRF  169
             H GPCE+WLD  +VL  D+C   +  +       + +DYSSC  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  176

Query  170  LKNEHSWQVYKACIPL  185
            +  +  WQ YK CIPL
Sbjct  177  VDGKTVWQSYKDCIPL  192

>PHYRA_86016
Length=236

 Score = 89.7 bits (221),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 62/124 (50%), Gaps = 18/124 (15%)

Query  92   DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG-  144
            D  CG+T     PQPIP DG ++       G+TH GPCE+++D T VL  D+C E +PG 
Sbjct  19   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  78

Query  145  -------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAAN  197
                       +DYSSC G C L  YWL     +N   WQ Y  C+PL  S    +    
Sbjct  79   PDGSNKMSEMPVDYSSCNGECTLTIYWLA---FQNAQ-WQAYVNCVPLKGSGSATQTQTQ  134

Query  198  ESAA  201
             S+A
Sbjct  135  TSSA  138

>PHYKE_3913
Length=321

 Score = 90.9 bits (224),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 70/131 (53%), Gaps = 18/131 (14%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADY--YCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPC  123
            + +N  K +R   D      +D + Y   CGFTN  A P+ P  DGT   S G  H GPC
Sbjct  98   KVANNAKDIRTLFD------SDTSLYGENCGFTNPDATPKDPPTDGTATFSRGIVHAGPC  151

Query  124  EVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHS  175
            E+WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YW+  + L  +  
Sbjct  152  EIWLDDKMVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTY  211

Query  176  WQVYKACIPLS  186
            WQVYK C+PL+
Sbjct  212  WQVYKNCVPLT  222

>PHYKE_6001
Length=289

 Score = 90.5 bits (223),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 74/141 (52%), Gaps = 15/141 (11%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
            ++V  FN  +++N Y  L+  MD    T   GAD  CGFT+    PQPIP DG    S  
Sbjct  61   QSVTAFNALKKANNYVDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPSDGKATYSRA  115

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSCK-GSCM-LRWYWLGTR  168
              H GPCE+WLD   V   ++C+  +  +       + +DYSSC  G C  +R+YWL  +
Sbjct  116  IQHVGPCEIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQ  175

Query  169  FLKNEHSWQVYKACIPLSSSA  189
             +  +  WQ YK CIPL  S 
Sbjct  176  GVDGKTVWQSYKNCIPLEGSG  196

>PHALS_05392
Length=367

 Score = 91.3 bits (225),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 66/136 (49%), Gaps = 15/136 (11%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDG--TMRSTGYTHDG  121
            F     +N +K +R+ MDG      D     CG+T+    P   P       S G  H G
Sbjct  150  FKELATANNFKDVRSLMDGNPVYGED-----CGYTDPNGTPVAPPSNGEATFSRGIVHAG  204

Query  122  PCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNE  173
            PCE+WLD   VLQ+D+C   +   T         +DYSSC    CMLR+YWL  + L  +
Sbjct  205  PCEIWLDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGK  264

Query  174  HSWQVYKACIPLSSSA  189
              WQ YK CIPL+  A
Sbjct  265  TVWQAYKNCIPLNGPA  280

>PHYRA_79140
Length=424

 Score = 92.0 bits (227),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 72/135 (53%), Gaps = 26/135 (19%)

Query  73   YKTLRAFMDGAKYTVTDGA-----DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDG  121
            YKT+ A     K TV D          CG T+  A+PQPIP DG  +       G+TH G
Sbjct  62   YKTMAAEK---KMTVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVG  118

Query  122  PCEVWLDSTRVLQSDNCHETFPG------KTYNL--DYSSCKGSCMLRWYWLGTRFLKNE  173
            PCE++LD T VL SDNC + +PG      +T ++  DYSSC G C L  YWL  +  +  
Sbjct  119  PCEIYLDDTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ--  176

Query  174  HSWQVYKACIPLSSS  188
              WQ Y  C+PLS S
Sbjct  177  --WQAYVNCVPLSGS  189

>PYIR_19612
Length=260

 Score = 89.7 bits (221),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 81/143 (57%), Gaps = 20/143 (14%)

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            +K  ++F    +  G+ TLR++++    T        CGFT+   AP+ IP D  +R S 
Sbjct  57   WKDPKNFATAAKEKGFATLRSYLEDKGAT--------CGFTDPNVAPRAIPADRKVRFSR  108

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNE  173
              +H GPCE+W+D  RV Q+D+C   F G   ++++D++ C G CM+R+YWL  +   + 
Sbjct  109  DISHPGPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQ--ASG  166

Query  174  HSWQVYKA------CIPLSSSAR  190
              WQVY++      C+P+S S +
Sbjct  167  TRWQVYRSELTRDLCVPVSGSGK  189

>PITG_05271
Length=278

 Score = 90.1 bits (222),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 73/140 (52%), Gaps = 15/140 (11%)

Query  60   TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
            +V  F   + +N +K L+  MD    T   GAD  CGFT+     QPIP DG    S   
Sbjct  62   SVNAFKALKTANKFKDLKTLMDD---TSVYGAD--CGFTDPNGKAQPIPKDGKATFSRAL  116

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSCM-LRWYWLGTRF  169
             H GPCE+WLD T+VL  D+C   +  +       + +DYSSC  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  176

Query  170  LKNEHSWQVYKACIPLSSSA  189
            +  +  WQ YK CIPL  S 
Sbjct  177  VDGKTVWQSYKDCIPLEGSG  196

>PHALS_03177
Length=259

 Score = 89.4 bits (220),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 73/137 (53%), Gaps = 16/137 (12%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
            K+V+ F   + +N +K L+  MD        G D  CG+++    PQPIP DG    S  
Sbjct  61   KSVKAFQSLKAANNFKDLKTLMDNPVL----GRD--CGYSDPNGKPQPIPKDGKATFSRA  114

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNL------DYSSC-KGSC-MLRWYWLGTR  168
              H GPCE+WLD+ +VL  D+C+  +     N+      DYSSC  G C  +R+YWL  +
Sbjct  115  MVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQ  174

Query  169  FLKNEHSWQVYKACIPL  185
             +  +  WQ YK CIPL
Sbjct  175  GINGKTFWQSYKMCIPL  191

>PHYCA_534473
Length=1050

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 72/133 (54%), Gaps = 16/133 (12%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
            + SNGY  +R  +D    + TD     CGFT+     +  P   D T  S G  H GPCE
Sbjct  845  KESNGYSDIRTLLD----SDTDLYGANCGFTDPDVTAKDPPTTGDATF-SRGMVHAGPCE  899

Query  125  VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSW  176
            +WLD T+VL +D+C   +   T         +DYSSC  S CMLR+YWL  + + ++  W
Sbjct  900  IWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKIVW  959

Query  177  QVYKACIPLSSSA  189
            QVYK C+PL+  A
Sbjct  960  QVYKDCVPLTGPA  972

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 69/130 (53%), Gaps = 16/130 (12%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
            ++SN  K +R  +D        G D  CG T+ KA P+  P   D T  S G  H GPCE
Sbjct  540  KKSNNVKDIRTMIDADPKLY--GED--CGNTDPKAKPKDPPSTGDATF-SRGIVHAGPCE  594

Query  125  VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHSW  176
            +WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  +   ++  W
Sbjct  595  IWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLW  654

Query  177  QVYKACIPLS  186
            QVYK CIPL+
Sbjct  655  QVYKNCIPLT  664

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 59/118 (50%), Gaps = 15/118 (13%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDG  121
            F      N YK +R  MDG      D     CGFT+ K  P  P  DGT   S G  H G
Sbjct  67   FKELAAKNNYKDVRTLMDGNPVYGED-----CGFTDPKGTPVDPPTDGTATFSRGIVHAG  121

Query  122  PCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLK  171
            PCE+WLD   VLQ+D+C   +   T         +DYSSC  G CMLR+YWL  + LK
Sbjct  122  PCEIWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLK  179

 Score = 72.8 bits (177),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 58/113 (51%), Gaps = 14/113 (12%)

Query  68   RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
            + SN  K +R  +D    T   GAD  CG+TN    P+ P  DGT   S G  H GPCE+
Sbjct  277  KASNNAKDIRTLLDSD--TKLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  332

Query  126  WLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFL  170
            WLD   VL +D+C   +   T         +DYSSC  G CM R+YWL  + L
Sbjct  333  WLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  385

>PHYRA_86752
Length=300

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 62/124 (50%), Gaps = 18/124 (15%)

Query  92   DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG-  144
            D  CG+T     PQPIP DG ++       G+TH GPCE+++D T VL  D+C E +PG 
Sbjct  83   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  142

Query  145  -------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAAN  197
                       +DYSSC G C L  YWL  +  +    WQ Y  C+PL  S    +    
Sbjct  143  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSATQTQTQ  198

Query  198  ESAA  201
             S+A
Sbjct  199  TSSA  202

>PPTG_03139
Length=320

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 78/176 (44%), Gaps = 22/176 (13%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKTLRA  78
            H  + +P   +T +   T+Y       S GF             +FN    ++ Y +L+ 
Sbjct  24   HGYMSVPKVEFTFNGDTTQYMATIEASSSGFSGNFGQSPTDNTANFNKGFAASKYSSLKE  83

Query  79   FMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-------GTMRSTGYTHDGPCEVWLDSTR  131
            FM      V+      CG+TN    PQP+P+       G+      +H+GPCEVW D TR
Sbjct  84   FMTDKMVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCEVWCDDTR  143

Query  132  VLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            V Q DNC + FP     L  D+ +C GS  L  YW+      +  SWQVY  C  L
Sbjct  144  VFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIAL----HSPSWQVYINCAAL  195

>PYIW_25463
Length=216

 Score = 87.8 bits (216),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 88/184 (48%), Gaps = 26/184 (14%)

Query  26   DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
            +AH  V  P   YT     T + A      ++GF          + V+ F       GYK
Sbjct  21   EAHGFVSQPKAQYTGGGSYTSFSAEFTASVNKGFSGYIFNRSPEQNVQQFTAAWSKTGYK  80

Query  75   TLRAFMD----GAKYTVTDGADY-YCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDS  129
            +L+  MD    G  ++ TD A     G ++ K       +G + S    H GPCE W+D+
Sbjct  81   SLKELMDKQVPGCGFSRTDIAAVDVSGMSSMKFQNNEYKEGFLGS----HHGPCEGWIDN  136

Query  130  TRVLQSDNCHETFPGKTYN--LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
            T+V  SD+C +++PG   N  + Y++CKG+C L +YWL     K    WQ YK C+P+ +
Sbjct  137  TKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLALHSQK----WQAYKHCVPIKA  192

Query  188  SARR  191
             A R
Sbjct  193  GAAR  196

>PHYRA_83494
Length=224

 Score = 87.8 bits (216),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 63/124 (51%), Gaps = 18/124 (15%)

Query  90   GADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
            G D  CG T+  AAPQ +P DG  +       G+TH GPCE+++D   VL  DNC + +P
Sbjct  18   GEDKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYP  77

Query  144  GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
            G            +DYSSC G C    YWL     +N   WQ Y  C+PL+ S    + A
Sbjct  78   GGDVGSTVTSDMPVDYSSCNGDCTFTIYWLA---FQNAQ-WQAYVNCVPLTGSGSTTQTA  133

Query  196  ANES  199
            A+ +
Sbjct  134  ASST  137

>SPRG_19916
Length=305

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 88/186 (47%), Gaps = 34/186 (18%)

Query  27   AHQVVLLPAPTYTTDNKDTKYA-------PLAFLESQGFKTVEDFN-GWRRSNGYKTLRA  78
             H ++  P   +T +   T Y        P  F +S     V +FN  ++    +KTLR 
Sbjct  20   GHGIISNPLAEFTPNVMRTTYVTRIQANFPGKFDDSPQ-TNVANFNKAFKAQTQFKTLRD  78

Query  79   FMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS-----TGY----THDGPCEVWLDS  129
             +D        G D  CG T    A + IP   M +     TG     +H GPCEVW+D 
Sbjct  79   MLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPDTGEGFVPSHTGPCEVWIDD  130

Query  130  TRVLQSDNCHETFPGK---TYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             RV Q+D+C   FP K      +DYSSC G  CMLR+YWL      +E  WQVYK C+PL
Sbjct  131  KRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLAL----HEPMWQVYKNCVPL  186

Query  186  SSSARR  191
              + ++
Sbjct  187  EGNGQK  192

>PYIR_24421
Length=213

 Score = 87.4 bits (215),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 14/132 (11%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT  118
            F    +S+ YK++R  ++ AK +   GA   CG +++  A QP+P   +      S G+T
Sbjct  42   FTAALKSSSYKSVRDLVN-AKASFISGASKECGISSSSGAKQPLPAQYVEWAHSSSEGFT  100

Query  119  --HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEH  174
              H+GPCEVW D+     +DNC + +P     L Y  S C G+ MLR+YW+      +  
Sbjct  101  PSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVAL----HSS  156

Query  175  SWQVYKACIPLS  186
            +WQVY  C PLS
Sbjct  157  TWQVYINCAPLS  168

>PPTG_07509
Length=299

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 73/161 (45%), Gaps = 27/161 (17%)

Query  57   GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
            G   V  F    +  G       +D  K       D  CG+T     P+PIP DG ++  
Sbjct  54   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWW  106

Query  114  ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                 G+TH GPCE+++D   VL  DNC E FPG            +D+SSC G C L  
Sbjct  107  GNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTI  166

Query  163  YWLGTRFLKNEHSWQVYKACIPL--SSSARRLEGAANESAA  201
            YWLG    +N   WQ Y  C+PL  S SA + + +   S A
Sbjct  167  YWLG---FQNAQ-WQAYVNCVPLQGSGSATQTQASTGGSGA  203

>SPRG_22161
Length=300

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 79/154 (51%), Gaps = 26/154 (17%)

Query  61   VEDFN-GWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS-----  114
            V +FN  ++    +KTLR  +D        G D  CG T    A + IP   M +     
Sbjct  60   VANFNKAFKAQTQFKTLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPD  111

Query  115  TGY----THDGPCEVWLDSTRVLQSDNCHETFPGK---TYNLDYSSCKGS-CMLRWYWLG  166
            TG     +H GPCEVW+D+ RV Q+D+C   FP K      +DYSSC  + CMLR+YWL 
Sbjct  112  TGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLA  171

Query  167  TRFLKNEHSWQVYKACIPLSSSARRLEGAANESA  200
                 +E  WQVYK C+PL  + ++   A   +A
Sbjct  172  L----HEPMWQVYKNCVPLKGNGQQPTSAPKPTA  201

>PPTG_07507
Length=299

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 73/161 (45%), Gaps = 27/161 (17%)

Query  57   GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
            G   V  F    +  G       +D  K       D  CG+T     P+PIP DG ++  
Sbjct  54   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWW  106

Query  114  ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                 G+TH GPCE+++D   VL  DNC E FPG            +D+SSC G C L  
Sbjct  107  GNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTI  166

Query  163  YWLGTRFLKNEHSWQVYKACIPL--SSSARRLEGAANESAA  201
            YWLG +  +    WQ Y  C+PL  S SA + + +   S A
Sbjct  167  YWLGFQNAQ----WQAYVNCVPLQGSGSATQTQASTGGSGA  203

>PHYRA_83500
Length=394

 Score = 89.7 bits (221),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 71/135 (53%), Gaps = 26/135 (19%)

Query  73   YKTLRAFMDGAKYTVTDGA-----DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDG  121
            YKT+ A     K TV D          CG T+  A+PQPIP DG  +       G+TH G
Sbjct  62   YKTMAAEK---KMTVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVG  118

Query  122  PCEVWLDSTRVLQSDNCHETFPG------KTYNL--DYSSCKGSCMLRWYWLGTRFLKNE  173
            PCE++LD T VL SDNC + +PG      +T ++  DYSSC G C L  YWL  +  +  
Sbjct  119  PCEIYLDDTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ--  176

Query  174  HSWQVYKACIPLSSS  188
              WQ Y  C PLS S
Sbjct  177  --WQAYVNCAPLSGS  189

>PYAP_22257
Length=247

 Score = 87.8 bits (216),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 58/102 (57%), Gaps = 15/102 (15%)

Query  95   CGFTNAKAAPQPIP-------DGTMRSTGY--THDGPCEVWLDSTRVLQSDNCHETFPG-  144
            CG ++ K  PQ +        + T   TG+  +H GPCE+W+D TRV+  DNC   F G 
Sbjct  86   CGKSSGKGKPQSVEGLSDVHWENTEEKTGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGY  145

Query  145  -KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                 ++YS CKG CMLR+YWL      +E  WQVYK C+P+
Sbjct  146  PAKMPVNYSVCKGECMLRFYWLAL----HEPEWQVYKNCVPI  183

>SDRG_17317
Length=122

 Score = 84.0 bits (206),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 61/110 (55%), Gaps = 17/110 (15%)

Query  95   CGFTNAKAAPQPIP-DGTMR----STGY----THDGPCEVWLDSTRVLQSDNCHETFPGK  145
            CG T    A + IP DGTM      TG     +H GPCEVWLD  RV Q+D+C   FP K
Sbjct  9    CGNTLTTGAKKSIPSDGTMTWQNPDTGEGFVPSHTGPCEVWLDDKRVFQNDDCATNFPAK  68

Query  146  T---YNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARR  191
                  +DYSSC G  CMLR+YWL      +E  WQVYK C+PL  +  +
Sbjct  69   PAAHLPIDYSSCSGDGCMLRFYWLAL----HEPMWQVYKNCVPLEGNGEK  114

>CCA17179
Length=185

 Score = 85.9 bits (211),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 68/144 (47%), Gaps = 20/144 (14%)

Query  64   FNGWRRSNGYKTLRAFMDGAKYTVTD---GADYYCGFTNAKAAPQPIP---------DGT  111
            F+G    N    L AF       + D       YCG TN  A P+PIP           T
Sbjct  26   FDGAPIDNTATFLNAFASSPFQNLRDFLKDKGPYCGSTNPNAQPKPIPADHAIVWENPDT  85

Query  112  MRSTGYTHDGPCEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSCKGSCMLRWYWLGTR  168
                  +H GPCEVWL+  RV   DNC E F   P +   +D+S+C   C+L+++WL   
Sbjct  86   KEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARIP-IDFSTCTNGCLLQFFWLALH  144

Query  169  FLKNEHSWQVYKACIPLSSSARRL  192
                E  WQVYK CIP++ +  +L
Sbjct  145  ----EPQWQVYKNCIPIAPNGIKL  164

>PHYKE_7717
Length=568

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)

Query  142  FPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
            FPGK Y +DYS+CKG+C LRWYWLG RFLKN +SWQVYKACIPL+
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  46

>PYIR_22134
Length=300

 Score = 87.8 bits (216),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 84/181 (46%), Gaps = 26/181 (14%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYA-----PLAFLESQGFKTVED-------FNGWRRSNGY  73
            DAH  + +P PT+T     T+++     P       G     D       F    +++ Y
Sbjct  27   DAHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKASTY  86

Query  74   KTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVW  126
             ++RA ++ AK     GA   CG T+A    QP+P   +      S G+T  H GPCEVW
Sbjct  87   DSVRALVE-AKGVFISGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCEVW  145

Query  127  LDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
             D+ +V   +NC + +P     L  D++ C G+ +L+  WL      +  +WQ+Y  C P
Sbjct  146  CDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLAL----HSSTWQIYINCAP  201

Query  185  L  185
            L
Sbjct  202  L  202

>PHYCA_12943
Length=287

 Score = 87.8 bits (216),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 66/143 (46%), Gaps = 25/143 (17%)

Query  57   GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
            G   V  F    +  G       +D  K       D  CG+T     PQPIP DG ++  
Sbjct  57   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWW  109

Query  114  ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                 G+TH GPCE+++D   VL  D+C + FPG           ++D+SSC G C L  
Sbjct  110  GNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTI  169

Query  163  YWLGTRFLKNEHSWQVYKACIPL  185
            YWL     +NE  WQ Y  C+PL
Sbjct  170  YWLA---FQNEQ-WQSYVNCVPL  188

>PHYCA_97965
Length=288

 Score = 87.8 bits (216),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 66/143 (46%), Gaps = 25/143 (17%)

Query  57   GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
            G   V  F    +  G       +D  K       D  CG+T     PQPIP DG ++  
Sbjct  57   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWW  109

Query  114  ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                 G+TH GPCE+++D   VL  D+C + FPG           ++D+SSC G C L  
Sbjct  110  GNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTI  169

Query  163  YWLGTRFLKNEHSWQVYKACIPL  185
            YWL     +NE  WQ Y  C+PL
Sbjct  170  YWLA---FQNEQ-WQSYVNCVPL  188

>PHYSO_533747
Length=206

 Score = 85.9 bits (211),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 16/136 (12%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DG-TMRSTG  116
            K+VE F   + +N +K L+  +D       D     CGFT+    PQPIP DG  + S G
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  116

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSCK-GSC-MLRWYWLGTR  168
              H GPCE WLD  +VL +D+C+  +     N      +DYSSC+ G C M+R+YWLG +
Sbjct  117  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  176

Query  169  FLKNEHS-WQVYKACI  183
             L ++ + WQ Y   +
Sbjct  177  ALDDKKTVWQTYSTLL  192

>PHALS_03179
Length=372

 Score = 88.6 bits (218),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 74/141 (52%), Gaps = 16/141 (11%)

Query  59   KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
            ++V+ +   + +N +K L+  M+      T      CGF++ K  PQPIP DG    S  
Sbjct  102  QSVKAYQSLKAANNFKDLKTLME------THALGPECGFSDPKGKPQPIPKDGKATLSRA  155

Query  117  YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNL------DYSSC-KGSCM-LRWYWLGTR  168
              H GPCE+WLD+ +VL  D+C+  +  +   +      DYSSC  G C  +R+YWL  +
Sbjct  156  IVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQ  215

Query  169  FLKNEHSWQVYKACIPLSSSA  189
             +K    WQ YK CIPL  S 
Sbjct  216  GIKGITFWQSYKNCIPLQGSG  236

>SDRG_15426
Length=523

 Score = 89.4 bits (220),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 74/144 (51%), Gaps = 26/144 (18%)

Query  61   VEDFN-GWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----S  114
            V +FN  +   + YKTLR  +D        G D  CG T    AP+PIP DG M      
Sbjct  33   VANFNKAFAAQSQYKTLRDLLD------LSGPD--CGNTRTNVAPKPIPSDGMMTWQNPD  84

Query  115  TGY----THDGPCEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSC-KGSCMLRWYWLG  166
            TG     +H GPCE+WLD+ RV Q+DNC   F   P     +DY+ C    CMLR+YWL 
Sbjct  85   TGEGFIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLA  144

Query  167  TRFLKNEHSWQVYKACIPLSSSAR  190
                  +  WQVYK C+PL  + +
Sbjct  145  LH----QPQWQVYKNCVPLQGNEQ  164

>PYIW_15526
Length=256

 Score = 86.7 bits (213),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 87/184 (47%), Gaps = 38/184 (21%)

Query  26   DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
            +AH  +  P  TYT     T + A +    ++GF          +   +F       GY 
Sbjct  19   EAHGFISEPKATYTGGGSYTSFSAEIGADVNKGFSGRIFNRSPEQNAAEFTAAWPKTGYT  78

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THDGPC  123
            +L+  +D +      G    CG+TN  AAP  +    ++S  Y           +H GPC
Sbjct  79   SLKEMLDKS----VSG----CGYTNPNAAPVDVSG--LKSMKYQNNEYKEGFLGSHRGPC  128

Query  124  EVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
            E W+D+T++  +D+C +T+PG   T  +DYS CKG+C L +YWL     K    WQVYK 
Sbjct  129  EAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVHSPK----WQVYKG  184

Query  182  CIPL  185
            C+ +
Sbjct  185  CVAI  188

>PHYKE_6077
Length=322

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 64/132 (48%), Gaps = 13/132 (10%)

Query  63   DFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-------GTMRST  115
            +FN    ++ Y +L+ FM       +      CG+TN K A QP+P+       G+    
Sbjct  68   NFNKGMAASKYTSLKEFMAAKAKVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGF  127

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNE  173
              +H+GPCEVW D TRV Q DNC   FP     L Y   +C GS +L  YW+      + 
Sbjct  128  TSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIAL----HS  183

Query  174  HSWQVYKACIPL  185
             SWQVY  C  L
Sbjct  184  PSWQVYINCAAL  195

>SDRG_07565
Length=278

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 90/196 (46%), Gaps = 32/196 (16%)

Query  27   AHQVVLLPAPTYTTDNKDTKYA-------PLAFLESQGFKTVEDFNGWRRSNGYKTLRAF  79
             H +V  PA  ++ +   T Y        P  F  S           ++  + +KTLR  
Sbjct  80   GHGIVSNPAAEFSPNVMRTTYVATIQANLPGKFDGSPQENVAAFTTAFKAQSQFKTLRDM  139

Query  80   MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STG----YTHDGPCEVWLDST  130
            ++             CG +   A+ + IP DGTM      TG     +H GPCEVWLD  
Sbjct  140  LEPQGPA--------CGNSLPNASKKTIPSDGTMTWLNPDTGEGFISSHTGPCEVWLDDK  191

Query  131  RVLQSDNCHETFPGKT---YNLDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
            RV Q D+C   FP K      +DYSSC GS CMLR+YWL      ++  WQVYK C+PL 
Sbjct  192  RVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWLAL----HQPQWQVYKNCVPLQ  247

Query  187  SSARRLEGAANESAAI  202
             + + ++     S ++
Sbjct  248  GNGQAVKAVGPSSPSM  263

>PHYCA_19611
Length=531

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 66/132 (50%), Gaps = 13/132 (10%)

Query  63   DFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGY  117
            +FN    ++ Y +L+ FM+     V       CG+TN K APQP+P   +        G+
Sbjct  275  NFNKGMAASKYTSLKEFMNDKMVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGF  334

Query  118  T--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNE  173
            T  H+GPCEVW D TRV Q DNC + FP     + Y   +C GS  L  YW+      + 
Sbjct  335  TQSHEGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIAL----HS  390

Query  174  HSWQVYKACIPL  185
             SWQVY  C  L
Sbjct  391  PSWQVYINCAAL  402

 Score = 36.2 bits (82),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 6/70 (9%)

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYS--SCKGSCMLRWYWLGTRFLKNEHS  175
            T +GP  V      + + DNC   +P     + Y   +C G+  L +YWL      +  +
Sbjct  75   TSNGPTVVAKALPPLTKDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLAL----HSST  130

Query  176  WQVYKACIPL  185
            WQVY  C  L
Sbjct  131  WQVYTNCAAL  140

>PYVX_14662
Length=540

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 69/136 (51%), Gaps = 15/136 (11%)

Query  60   TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
            +V+ +       G   +R+ +D       D     CGFT+     Q IP DG    S G 
Sbjct  63   SVDTYKSLAAEKGVTEIRSLLDDTSIYGQD-----CGFTDPDGTAQDIPTDGKATFSRGM  117

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPG------KTYNLDYSSCK-GSCM-LRWYWLGTRF  169
             H GPCE+WLD T VL  D+C+ T+ G        + +DYSSC  G C  +R+YWL  + 
Sbjct  118  VHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQG  177

Query  170  LKNEHSWQVYKACIPL  185
            +  +  WQVYK CIPL
Sbjct  178  VDGDTVWQVYKNCIPL  193

>PHYRA_78176
Length=312

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 85/182 (47%), Gaps = 28/182 (15%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWR-----------RSNGYKTL  76
            H  +  PA T+ T N  T++       + GF     FNG              S+ Y +L
Sbjct  25   HGYLSDPAVTFLTTNDPTQFIATIEATASGFSGT--FNGAPADNTAAFTTAFESSSYSSL  82

Query  77   RAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWLD  128
            + F+D  A  TVTD A   CG  +     QP+P+  +      S G+T  H+GPCEVW D
Sbjct  83   KEFIDDKATITVTD-ATLTCGACDPDETAQPLPETYVEWAHSDSEGFTASHEGPCEVWCD  141

Query  129  STRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
              RV Q D+C   F      L  D+ +C GS +L +YWL      +  +WQVY  C PL 
Sbjct  142  DVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLA----LHSSTWQVYVNCAPLE  197

Query  187  SS  188
            SS
Sbjct  198  SS  199

>PYAP_18713
Length=184

 Score = 83.6 bits (205),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 70/137 (51%), Gaps = 14/137 (10%)

Query  55   SQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT--M  112
            S  FKT   +    +  G+K LR+F++             CG TN  A P+ +P  +  +
Sbjct  54   SGTFKTGAQYAVVAKDKGFKDLRSFLEDKGPA--------CGKTNPNAKPRNVPSDSKVV  105

Query  113  RSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT--YNLDYSSCKGSCMLRWYWLGTRFL  170
             S    H GPCE+W+D T V  +D+C   F  K   + +D+SSCKG CMLR+YWLG +  
Sbjct  106  FSRPMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ--  163

Query  171  KNEHSWQVYKACIPLSS  187
             +   WQ Y   I  SS
Sbjct  164  DSGKRWQSYSTYIAESS  180

>PHYRA_78161
Length=373

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 86/185 (46%), Gaps = 29/185 (16%)

Query  26   DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWRRSN-----------GY  73
            + H  +  P  T+T    D T+Y  +A +ES        FNG    N            Y
Sbjct  19   NGHGYMTDPKVTFTAQAGDPTQY--IATIESTASGLTGTFNGAPSDNVAAFTKAFGSSKY  76

Query  74   KTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
             +L+ F+ D A  TVT GA   CG  + K   QP+P  TM      S G+T  H+GPCEV
Sbjct  77   SSLKEFINDKATVTVT-GATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCEV  135

Query  126  WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
            W D  R  Q D+C   +P     L  D  +C GS  L +YW+      +  +WQVY  C 
Sbjct  136  WCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMA----MHSSTWQVYVNCA  191

Query  184  PLSSS  188
            PL+S+
Sbjct  192  PLAST  196

>PYU1_G005871
Length=284

 Score = 85.5 bits (210),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 90/194 (46%), Gaps = 34/194 (18%)

Query  26   DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
            +AH  V  P  TY   +  T Y A +    ++GF          +  + F       GYK
Sbjct  22   EAHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  81

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT---MRSTGY------THDGPCEV  125
            +L+  MD A           CG++N  AAP  +   +    ++  Y      +H GPCE 
Sbjct  82   SLKQMMDKAVPG--------CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEG  133

Query  126  WLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
            W+D+TRV   D+C   FPG   T  + Y SCKG+C L +YWL     K    WQ YK+C+
Sbjct  134  WIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  189

Query  184  PLSSSARRLEGAAN  197
             + ++A   E +++
Sbjct  190  AIKNNAYSEERSSD  203

>SDRG_08137
Length=282

 Score = 85.5 bits (210),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 88/186 (47%), Gaps = 32/186 (17%)

Query  28   HQVVLLPAPTYTTDNKDTKYA-------PLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            H +V  PA  ++ +   T Y        P  F  S         + ++  + +KTLR  +
Sbjct  83   HGIVSNPAAEFSLNVMRTTYVATIQANLPGKFDGSPQENVAAFTSAFKAQSQFKTLRDML  142

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STG----YTHDGPCEVWLDSTR  131
            +             CG +   A+ + IP DGTM      TG     +H GPCEVWLD  R
Sbjct  143  EPQGPA--------CGNSLPNASKKTIPSDGTMTWRNPDTGEGFISSHTGPCEVWLDDKR  194

Query  132  VLQSDNCHETFPGKT---YNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
            V Q+D+C   FP K      +DYSSC G  CMLR+YWL      ++  WQVYK C+PL  
Sbjct  195  VFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLAL----HQPQWQVYKNCVPLQG  250

Query  188  SARRLE  193
            + + ++
Sbjct  251  NGQAVK  256

>PYAR_20617
Length=254

 Score = 84.7 bits (208),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 75/166 (45%), Gaps = 16/166 (10%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQ---GFKTVEDFNGWRRSNGYKTLRAFMDG  82
            DAH  V L  P        +K + +A  +      FKT   +    ++ G   LR F++ 
Sbjct  20   DAHAHVYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKTGAQYAAKAKAEGIPDLRTFLED  79

Query  83   AKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWLDSTRVLQSDNCHE  140
                        CG +   A P+ IP     S   T  H GPCEVW D       D+C +
Sbjct  80   KGPV--------CGNSLKDATPKAIPASGKISLASTIEHAGPCEVWFDDVLAFHDDDCEK  131

Query  141  TFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            TF   T + +D+S C GSC+LR+YWLG +       WQ YK C+PL
Sbjct  132  TFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PYU1_G005872
Length=297

 Score = 85.5 bits (210),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 90/194 (46%), Gaps = 34/194 (18%)

Query  26   DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
            +AH  V  P  TY   +  T Y A +    ++GF          +  + F       GYK
Sbjct  22   EAHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  81

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT---MRSTGY------THDGPCEV  125
            +L+  MD A           CG++N  AAP  +   +    ++  Y      +H GPCE 
Sbjct  82   SLKQMMDKAVPG--------CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEG  133

Query  126  WLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
            W+D+TRV   D+C   FPG   T  + Y SCKG+C L +YWL     K    WQ YK+C+
Sbjct  134  WIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  189

Query  184  PLSSSARRLEGAAN  197
             + ++A   E +++
Sbjct  190  AIKNNAYSEERSSD  203

>PYAP_22462
Length=210

 Score = 83.6 bits (205),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 92/194 (47%), Gaps = 38/194 (20%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPL----AFLESQGFK---TVED----FNGWRRSNGYK  74
            DAH  + LP  +Y      T Y  +    A+   QGFK   + ED    F    R+ G+ 
Sbjct  28   DAHGYISLPRASYANSYTKTGYNSILTASAYPAFQGFKWNGSPEDNTKAFTEGFRAGGFS  87

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-------RSTGY--THDGPCEV  125
            +LRA +D A           CG +    AP  +   ++          G+  +H GPCE 
Sbjct  88   SLRALLDPAAPG--------CGNSRTDVAPVDVSGLSVMQFQNDEEGKGFITSHHGPCEA  139

Query  126  WLDSTRVLQSDNCHETFPG--KTYNLDYSSCKG--SCMLRWYWLGTRFLKNEHSWQVYKA  181
            W+D+TRV   D+C   F G   T  ++Y++C    +C+L +YWL      +E +WQVYK 
Sbjct  140  WIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLAL----HEANWQVYKQ  195

Query  182  CIPL--SSSARRLE  193
            C+P+    SAR+L 
Sbjct  196  CVPIKRGGSARQLR  209

>SDRG_17318
Length=241

 Score = 84.3 bits (207),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 84/183 (46%), Gaps = 42/183 (23%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNG------------YKT  75
            H +V  P   +  D   T Y      E Q F   + FNG  R N             YKT
Sbjct  21   HGIVSNPFAEFKADVMHTTYV----AEIQAFLPGK-FNGSPRDNAVNFNKAFKAQSKYKT  75

Query  76   LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR------STGY--THDGPCEVW  126
            LRA +D        G D  CG T    A + IP +G M         G+  +H GPCEVW
Sbjct  76   LRAMLD------PHGPD--CGNTLTNVARKEIPSNGKMTFQNPDTGEGFIPSHTGPCEVW  127

Query  127  LDSTRVLQSDNCHETFPGK---TYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVYKAC  182
            LD+ RV Q+D+C   FP K      +DYSSC    CMLR+YW+      +   WQVYK C
Sbjct  128  LDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIAL----HSPRWQVYKNC  183

Query  183  IPL  185
            +PL
Sbjct  184  VPL  186

>PHALS_05394
Length=288

 Score = 85.1 bits (209),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 73/139 (53%), Gaps = 15/139 (11%)

Query  61   VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYT  118
            ++ F     +N +K+ R+ MDG       GAD  CG+T+    P  P  DGT   S    
Sbjct  66   LDTFKELGAANNFKSARSLMDGNPVY---GAD--CGYTDPNGTPVDPPSDGTATFSRPMK  120

Query  119  HDGPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKG-SCMLRWYWLGTRFL  170
            H G CE+W++   VLQ+D+C   +  K          +DYSSCKG  C+LR+YWL  + +
Sbjct  121  HAGLCEIWINKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRI  180

Query  171  KNEHSWQVYKACIPLSSSA  189
             ++  WQ YK CI +  S+
Sbjct  181  GDKTVWQAYKNCISIKGSS  199

>PYU1_G001514
Length=469

 Score = 86.7 bits (213),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 64/122 (52%), Gaps = 14/122 (11%)

Query  73   YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
            YK++RA +D AK     G D  CG T+A  A QP+P   +      S G+T  H GPCEV
Sbjct  83   YKSMRALVD-AKGVFQPGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPCEV  141

Query  126  WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
            W D+TRV Q DNC + +      L  D S C G+ ML+ YWL         +WQ Y  C 
Sbjct  142  WCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKIYWLALH----SSTWQAYINCA  197

Query  184  PL  185
            PL
Sbjct  198  PL  199

>PHALS_04411
Length=262

 Score = 84.7 bits (208),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 84/177 (47%), Gaps = 22/177 (12%)

Query  27   AHQVVLLPAPTYTTDNKD---TKYAPL---AFLESQGFK-TVEDFNGWRRSNGYKTLRAF  79
            AH  +  P PT+ +   +    +  PL    + +S+G +  +  F      N YK +R  
Sbjct  23   AHGYIAKPPPTWKSKETNKWVVEIKPLWDGPWDKSKGDEGLLSTFKELAAKNNYKNVRTL  82

Query  80   MDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
            MDG      D     CGFT+ K  P  P  DGT   S G  H GPCE+W +   +LQ+D+
Sbjct  83   MDGNPAFGED-----CGFTDPKGKPVDPPSDGTATFSRGIVHAGPCELWCNDKMILQNDD  137

Query  138  CHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
            C   +   T         + YS C  G  +LR+YWL  + L+ +  WQ YK CIPL+
Sbjct  138  CQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQAYKNCIPLT  194

>SPRG_19917
Length=241

 Score = 84.0 bits (206),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 73/137 (53%), Gaps = 26/137 (19%)

Query  63   DFN-GWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STG  116
            +FN  ++  + YKTLRA +D        G D  CG T    A + IP +G M      TG
Sbjct  62   NFNKAFKAQSKYKTLRALLD------QHGPD--CGNTLTNVARKEIPSNGKMTFQNPDTG  113

Query  117  ----YTHDGPCEVWLDSTRVLQSDNCHETFPGK---TYNLDYSSCKG-SCMLRWYWLGTR  168
                 +H GPCEVWLD+ RV Q+D+C   FP K      +DYSSC    CMLR+YW+   
Sbjct  114  EGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIAL-  172

Query  169  FLKNEHSWQVYKACIPL  185
               +   WQVYK C+PL
Sbjct  173  ---HSPRWQVYKNCVPL  186

>SDRG_08129
Length=218

 Score = 83.6 bits (205),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 87/186 (47%), Gaps = 32/186 (17%)

Query  28   HQVVLLPAPTYTTDNKDTKYA-------PLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
            H +V  PA  ++ +   T Y        P  F  S         + ++  + +KTLR  +
Sbjct  19   HGIVSNPAAEFSPNVMRTTYVATIQANLPGKFDGSPQENVAAFTSAFKVQSQFKTLRDML  78

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STG----YTHDGPCEVWLDSTR  131
            +             CG +   A+ + IP DG M      TG     +H GPCEVWLD  R
Sbjct  79   EPQGPA--------CGNSLPNASKKTIPSDGAMTWRNPDTGEGFISSHTGPCEVWLDDKR  130

Query  132  VLQSDNCHETFPGKT---YNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
            V Q+D+C   FP K      +DYSSC G  CMLR+YWL      ++  WQVYK C+PL  
Sbjct  131  VFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLAL----HQPQWQVYKNCVPLQG  186

Query  188  SARRLE  193
            + + ++
Sbjct  187  NGQAVK  192

>PHYRA_83499
Length=473

 Score = 86.3 bits (212),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 61/124 (49%), Gaps = 18/124 (15%)

Query  92   DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG-  144
            D  CG+T     PQPIP DG ++       G+TH GPCE+++D T VL  D+C E +PG 
Sbjct  83   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  142

Query  145  -------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAAN  197
                       +DYSSC G C L  YWL  +  +    WQ Y  C+ L  S    +    
Sbjct  143  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSATQTQTQ  198

Query  198  ESAA  201
             S+A
Sbjct  199  TSSA  202

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 12/67 (18%)

Query  121  GPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGSCMLRWYWLGTRFLKN  172
            GPCE++LD T +L  DNC + + G   +        +DYSSC G+C L  YWLG    +N
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLG---FQN  407

Query  173  EHSWQVY  179
            E  WQ Y
Sbjct  408  EQ-WQAY  413

>PYIW_24288
Length=201

 Score = 82.8 bits (203),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 77/183 (42%), Gaps = 28/183 (15%)

Query  26   DAHQVVLLPAPTYTTDNKDTKY------------APLAFL-ESQGFKTVEDFN-GWRRSN  71
            D H  + +P PT+        Y            AP      S G      +   +   N
Sbjct  24   DGHGAMTVPKPTFMNGTVKEAYCATIRGPPTGMGAPAGMTYSSNGANNARVYERAFGNQN  83

Query  72   GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-------DGTMRSTGYTHDGPCE  124
             Y+ LR  +D      + GAD  CGFT+A  A QP+P       +   +    TH+GPCE
Sbjct  84   RYRNLRELVDFTA-VFSAGADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHEGPCE  142

Query  125  VWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
            VW D     +  NC + F G    L Y  S C G+ ML++YWL      +   W+VY  C
Sbjct  143  VWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWEVYINC  198

Query  183  IPL  185
            +PL
Sbjct  199  VPL  201

>PHYCA_19598
Length=390

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 67/126 (53%), Gaps = 15/126 (12%)

Query  70   SNGYKTLR-AFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDG  121
            S+ YK+L+  F D AK TV+ GA   CG  + K  PQP+P+  +      S G+T  H+G
Sbjct  73   SSKYKSLKDLFTDKAKITVS-GATLTCGSCDPKEEPQPMPESIVEWSHSDSEGFTPSHEG  131

Query  122  PCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
            PCEVW D  R  Q DNC   FP     +  D  +C G+  L +YW+      +  +WQVY
Sbjct  132  PCEVWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMA----MHSDTWQVY  187

Query  180  KACIPL  185
              C PL
Sbjct  188  VNCAPL  193

>PHYCA_98479
Length=276

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 58/110 (53%), Gaps = 18/110 (16%)

Query  90   GADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
            G+   CG T A  + QP+P DG  +       G+TH GPCE+++D T VL  DNC + +P
Sbjct  81   GSGKECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYP  140

Query  144  GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            G            +DYSSCKG C L  YWLG +       WQ Y  C+PL
Sbjct  141  GGDVGSTVTSDMPVDYSSCKGDCTLTIYWLGFQ----NAQWQAYINCVPL  186

>PYU1_G005873
Length=214

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 85/192 (44%), Gaps = 38/192 (20%)

Query  26   DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
            +AH  +  P   YT  +  T Y A +    ++GF          +  + F       GYK
Sbjct  22   EAHGYISQPKAQYTGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  81

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THDGPC  123
            +L+  MD A      G    CG++    AP  +    M S  +           +H GPC
Sbjct  82   SLKQMMDKA----VPG----CGYSRTDIAPVDV--SRMSSMKFQNNEYKEGFLASHHGPC  131

Query  124  EVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
            E W+D+TRV   D+C   FPG   T  + + +CKG+C L +YWL     K    WQ YK+
Sbjct  132  EGWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLALHSPK----WQAYKS  187

Query  182  CIPLSSSARRLE  193
            C+P+  +A   E
Sbjct  188  CVPIKYNAYSAE  199

>PHYKE_8390
Length=130

 Score = 80.1 bits (196),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 2/97 (2%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
            Q+VL P P +  D  D +   LA+L+ QG  T  +  GW  S+GY +LRA +D  A Y V
Sbjct  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90

Query  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPC  123
            T+ A + CG T+ K   Q IP + T +++GYT DGPC
Sbjct  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PPTG_03138
Length=294

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 86/184 (47%), Gaps = 30/184 (16%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM------  80
            AH  +  PA T+ T N  T++  +A +ES        FNG    N     +AF       
Sbjct  23   AHGYMSDPAVTFLTTNDPTQF--IATIESSASGLTGTFNGAPADNTAAFTKAFESSSFSS  80

Query  81   ------DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWL  127
                  + A  TV+D A   CG  +     QP+PD  +      S G+T  H+GPCE+W 
Sbjct  81   LKELINEKATLTVSD-ATLTCGSCDPDETAQPLPDTYVEWAHSDSEGFTASHEGPCEIWC  139

Query  128  DSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
            D  RV Q D+C   + T P K    D+ +C GS +L +YWL      +  +WQVY  C P
Sbjct  140  DDVRVFQGDDCAADYTTAPAK-LPYDHDACLGSSVLTFYWLAL----HSSTWQVYVNCAP  194

Query  185  LSSS  188
            L S+
Sbjct  195  LEST  198

>PPTG_03156
Length=445

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 86/179 (48%), Gaps = 26/179 (15%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLE--SQGFK---------TVEDFNGWRRSNGYKT  75
            AH  +  PA T++ +  D K   +A +E  S GFK          V  F     ++ YK+
Sbjct  20   AHGWLSKPAATFSNEAGD-KSQFIATIEASSSGFKGTFNTAPADNVASFTKAFATSTYKS  78

Query  76   LRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
            L+AF+D  AK TVT GA   CG     A  QP+PD        S G+T  H+GPCE W D
Sbjct  79   LKAFIDDKAKITVT-GATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEAWCD  137

Query  129  STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            S RV   +NC   F      + Y  S C G+  L +YW+      +  +WQVY  C PL
Sbjct  138  SERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWM----AMHGPTWQVYVNCAPL  192

>PYAP_18221
Length=226

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 71/135 (53%), Gaps = 25/135 (19%)

Query  69   RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD---GTMRSTGY------TH  119
            + +G K+LR  MD  KY         CG TN    P+ +      T ++  Y      +H
Sbjct  77   KQSGLKSLRELMD--KYVPG------CGNTNPNTTPRDVTKLKTMTYQNNEYKEGFLNSH  128

Query  120  DGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSW  176
             GPCEVW+D+TRV Q+++C   ++++P     +DYS CKG+C L +YWL     K    W
Sbjct  129  HGPCEVWIDNTRVFQNNDCAANYKSYPA-ALPVDYSKCKGTCRLTFYWLALHSQK----W  183

Query  177  QVYKACIPLSSSARR  191
            Q YK C+P+   A R
Sbjct  184  QAYKQCVPIKYGASR  198

>PYIR_20481
Length=277

 Score = 83.2 bits (204),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 71/126 (56%), Gaps = 17/126 (13%)

Query  72   GYKTLRAFMD----GAKYTVTDGADY-YCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVW  126
            GYK+L+  +D    G  +T+TDGA     G  + K        G + S    H GPCEVW
Sbjct  74   GYKSLKEMLDLSVPGCGFTLTDGAPVDVSGLKSMKWQNDQEQKGFIDS----HHGPCEVW  129

Query  127  LDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
            +D+T+++ SD+C   +  +P +   +DYS CKG C L +YWL      +E +WQ+YK C+
Sbjct  130  IDNTKIMHSDDCRADYTAYPAE-IPVDYSKCKGKCQLTFYWLAL----HEPNWQIYKQCV  184

Query  184  PLSSSA  189
            P+ + +
Sbjct  185  PIQNGS  190

>PYAP_24691
Length=145

 Score = 80.1 bits (196),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 3/82 (4%)

Query  119  HDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
            H GPCE+W D+TRV    +C + F   T + +DYS CKG+C+LR+YWLG +       WQ
Sbjct  3    HPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQ  60

Query  178  VYKACIPLSSSARRLEGAANES  199
             YK C+P+ +  R L    +E+
Sbjct  61   SYKNCVPIGNGKRMLAEGDDEA  82

>PYU1_G005985
Length=200

 Score = 81.6 bits (200),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 86/192 (45%), Gaps = 38/192 (20%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAP-LAFLESQGFK----------TVEDFNGWRRSNGYK  74
            +AH  + +P  TY  D   T +   L    +  F+            + F     + GY 
Sbjct  22   EAHGYISMPKATYANDYTKTSFVTTLTAAVNPAFQGKKWDGSPQENTQQFTSGFHAAGYS  81

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THDGPC  123
            +L+A +D     V  G    CG  N++    P+    + +  +           +H GPC
Sbjct  82   SLKALLD----PVAPG----CG--NSRVDVPPVGVSRLAAMEFRNDEFHEGFVNSHHGPC  131

Query  124  EVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
            EVW+D+ R+   D+C   F G   T  +++S C+G C L +YWL      +E +WQVYK 
Sbjct  132  EVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLAL----HEPTWQVYKQ  187

Query  182  CIPLSSSARRLE  193
            C+P+ +  +RL 
Sbjct  188  CVPIENQGKRLR  199

>PYAP_18226
Length=226

 Score = 82.0 bits (201),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 94/200 (47%), Gaps = 39/200 (20%)

Query  26   DAHQVV------LLPAPTYTTDNKD--TKYAPLAFLESQGFK-----TVEDFNGWRRSNG  72
            DAH  +       +P   YT  N +   K   +A  + + F        + F    + +G
Sbjct  22   DAHGYISQPRPDFIPGKMYTDINAEFTAKQTGIAAFQGKIFNWSPEHNTQVFTDAFKQSG  81

Query  73   YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-GTMR------STGY--THDGPC  123
             K+LR  MD  KY         CG TN    P+ +    TM         G+  +H GPC
Sbjct  82   LKSLRQLMD--KYVPG------CGNTNPNTTPRDVTKLKTMNWQNNEYKEGFLASHRGPC  133

Query  124  EVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVY  179
            EVW+D+TRV Q+++C   ++++P  +  +DYS CK S CMLR+YWL     K    WQ Y
Sbjct  134  EVWIDNTRVFQNNDCAGNYKSYPA-SLPVDYSKCKSSKCMLRFYWLALHSEK----WQAY  188

Query  180  KACIPLSSSARRLEGAANES  199
            K C+P+   A R     +ES
Sbjct  189  KQCVPIKYGASRSMDDEDES  208

>SDRG_08782
Length=450

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 89/185 (48%), Gaps = 34/185 (18%)

Query  27   AHQVVLLPAPTYTTDNKDTKYA-------PLAFLESQGFKTVEDFN-GWRRSNGYKTLRA  78
             H +V  P   + +D   TKY        P  F +S     V +FN  ++  + +KTLR 
Sbjct  19   GHGIVSNPPAEFRSDVMRTKYVATIQANFPGKFDDSPQ-TNVANFNKAFKAQSQFKTLRD  77

Query  79   FMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STGY----THDGPCEVWLDS  129
             +D        G D  CG+T      + IP +G M      TG     +H GPCEVW+D+
Sbjct  78   MLD------PHGPD--CGYTLTNVDKKAIPGNGQMTWKNPDTGEGFIPSHKGPCEVWIDN  129

Query  130  TRVLQSDNCHETFPGK---TYNLDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             RV Q+D+C   FP        +DYSSC  + CMLR+YWL       E  WQVYK C+PL
Sbjct  130  ERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALH----EPMWQVYKNCVPL  185

Query  186  SSSAR  190
              + +
Sbjct  186  KGNGQ  190

>PHYSO_324715
Length=274

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 82/151 (54%), Gaps = 20/151 (13%)

Query  69   RSNGYKT-LRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
            ++ GY+  +R  +DG   T   GAD  CG+++  A+P+ P  DGT   S G  H GPCE+
Sbjct  64   KAEGYENNIRKLLDGD--TKLYGAD--CGYSDPNASPKDPSTDGTATFSRGIAHHGPCEI  119

Query  126  WLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGS-CMLRWYWL---GTRFLKNE  173
            WLD   +L  D+C ETF    Y         +DYSSC  + CML +YWL   G     ++
Sbjct  120  WLDDKMILHDDDCEETFGTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQGRTTGNSK  179

Query  174  HSWQVYKACIPLSS-SARRLEGAANESAAIE  203
            + WQ+YK  + L+  +A ++  A+N +   E
Sbjct  180  YVWQIYKCYVALTGPAAGQVSTASNSTQTTE  210

>PHYKE_6078
Length=317

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 89/185 (48%), Gaps = 30/185 (16%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWR-----------RSNGYK  74
            + H  +  PA T+ T N  T++  +A +E+        FNG              S+ Y 
Sbjct  22   NGHGYMSDPAVTFLTSNDPTQF--IATIEASDSGLSGTFNGAPADNTAAFTTAFESSSYS  79

Query  75   TLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVW  126
            +L+ F+ D A  TVTD A   CG  +   A Q +PD  +      S G+T  H+GPCEVW
Sbjct  80   SLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWAHSDSEGFTASHEGPCEVW  138

Query  127  LDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
             D TRV Q D+C   + T P +    D+ +C GS  +  YWL      +  +WQVY  C 
Sbjct  139  CDDTRVFQDDDCAADYTTAPAQ-LPFDHDACLGSSTVTLYWLA----LHSSTWQVYVNCA  193

Query  184  PLSSS  188
            PL ++
Sbjct  194  PLETT  198

>PYIR_25999
Length=344

 Score = 83.6 bits (205),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 80/180 (44%), Gaps = 25/180 (14%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPL----AFLESQGFKTVED-------FNGWRRSNGYK  74
            DAH  + +P PT+T     T++A      A     G     D       F    +++ YK
Sbjct  25   DAHGSMSIPKPTFTIQGDTTQFAGTVDSSALTAPAGMSFTTDPESNTKAFTAAIKTSAYK  84

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWL  127
            ++R  ++ AK  +  GA   CG T+A   PQP+P   +      S G+T  H GPCEVW 
Sbjct  85   SVRDLIN-AKGVMMAGATKQCGITSATGTPQPLPAKYVEWSHGASEGFTPSHQGPCEVWC  143

Query  128  DSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            D      +DNC + +P     L  D+S C G  +L   WL      +  +WQ Y  C  L
Sbjct  144  DDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLLTMIWLAL----HSPTWQAYINCAVL  199

>PYIW_16810
Length=216

 Score = 81.3 bits (199),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 85/190 (45%), Gaps = 33/190 (17%)

Query  26   DAHQVVLLPAPTYTTDNK-----------DTKYAPLAFLESQGFKTVEDFNGWRRSNGYK  74
            DAH  + LPAPT+    K           +TK  P A        T   F    + NG+K
Sbjct  24   DAHGRLALPAPTFIASAKSKPNYWAYGVDNTKNPPRA--------TAATFAANYKKNGFK  75

Query  75   TLRAF-MDG---AKYT-VTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLD  128
            +LRAF MD     KY     G    CGFT+    PQP+PD        + H+GPCE W D
Sbjct  76   SLRAFIMDNQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPCEAWCD  135

Query  129  STRVLQ-SDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               V+  + +C     G    + Y  + C G  ML +YWL T        +Q Y  C+P+
Sbjct  136  DVLVMPFTASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLATFV----SPFQAYTNCVPI  191

Query  186  -SSSARRLEG  194
             S +AR L+G
Sbjct  192  KSGAARSLDG  201

>PHYCA_69583
Length=224

 Score = 81.3 bits (199),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 63/120 (53%), Gaps = 15/120 (13%)

Query  95   CGFTNAKA-APQPIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN----  148
            CGF+N  A A  P  DGT     G  H GPCE+WLD   VL +D+C + F    Y     
Sbjct  96   CGFSNPDAKAKDPPSDGTATFERGLAHHGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKS  155

Query  149  ----LDYSSCKGS-CMLRWYWLGTR-FLKNEHSWQVYKACIPLS---SSARRLEGAANES  199
                +DYSSC  S CM R+YWL  +     ++ WQ+YK CIPL+   +      GA+N S
Sbjct  156  VFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYKDCIPLTGPGAGKSSTVGASNSS  215

>PYIR_24743
Length=357

 Score = 82.8 bits (203),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 86/178 (48%), Gaps = 29/178 (16%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAH  V  P   +      TKY        QG      FN   ++N     +AF   +++
Sbjct  33   DAHGYVSSPLAEFKDGVMPTKYTATMSPAFQG-----KFNDNPQANVDTFTKAFQGQSEF  87

Query  86   -TVTD-----GADYYCGFTNAKAAPQPIP-DGTM------RSTGY--THDGPCEVWLDST  130
             T+ D     GAD  CG +   A+ + IP DG +         G+  +H GPCE+WLD  
Sbjct  88   KTLRDLLKDHGAD--CGDSKPDASRKAIPGDGKVVWQNPDTGEGFVPSHTGPCEIWLDDK  145

Query  131  RVLQSDNCHETF---PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            RV   +NC   F   P     +D+SSCK +CMLR+YWL      +E +WQVYK C+PL
Sbjct  146  RVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLAL----HEPTWQVYKNCVPL  199

>PHYSO_255056
Length=269

 Score = 81.6 bits (200),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 59/100 (59%), Gaps = 10/100 (10%)

Query  90   GADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTY  147
            GAD  CGF+N  A P+ P  DGT     G  H GPCE+WLD T VL +D+C + F  +  
Sbjct  94   GAD--CGFSNPDAKPKDPPTDGTATFERGLAHHGPCEIWLDDTMVLHNDDCAKAFSVE--  149

Query  148  NLDYSSCKGSCMLRWYWLGTR-FLKNEHSWQVYKACIPLS  186
              DY S  G CM R+YWL  +     ++ WQ+YK CIPL+
Sbjct  150  --DYMSING-CMFRFYWLAFQGSTSGKYVWQIYKNCIPLT  186

>PHYRA_73581
Length=293

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 9/86 (10%)

Query  114  STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGS-CMLRWYW  164
            S G  H GPCE+WLD T VL  D+C +TF    Y         +DYSSC  S CMLR+YW
Sbjct  123  SRGIAHHGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLRFYW  182

Query  165  LGTRFLKNEHSWQVYKACIPLSSSAR  190
            L  +   + + WQ+YK C+PL+  A 
Sbjct  183  LAFQGSNDGYVWQIYKHCVPLTGPAE  208

>PPTG_18166
Length=445

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 60/112 (54%), Gaps = 18/112 (16%)

Query  92   DYYCGFTNAKAAPQPIP-DGTM-----RSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
            D  CG T    +P+PIP DG +     R  G+TH GPCE++LD   VL  D+C E +PG 
Sbjct  81   DQKCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGG  140

Query  146  TYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            +          +D+SSC G C L  YWL  +  +    WQ Y  C+PLS S+
Sbjct  141  SDGSSSGSEMPVDFSSCNGKCTLTIYWLAFQNAQ----WQTYVNCVPLSGSS  188

>PPTG_03160
Length=379

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 65/135 (48%), Gaps = 13/135 (10%)

Query  61   VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----ST  115
            V  F     S+ YK+L+ ++      +  GA   CG  + K  PQP+P  T+      S 
Sbjct  64   VAAFTKAFTSSKYKSLKEYVTDKAKIIVSGATLTCGSCDPKQEPQPMPKSTVEWSHSDSE  123

Query  116  GYT--HDGPCEVWLDSTRVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLK  171
            G+T  H+GPCEVW D  R  Q D+C  H T        D  +C G+  L +YW+      
Sbjct  124  GFTPSHEGPCEVWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMA----M  179

Query  172  NEHSWQVYKACIPLS  186
            +  SWQVY  C PL+
Sbjct  180  HSSSWQVYVNCAPLA  194

>PHYCA_18657
Length=295

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 55/114 (48%), Gaps = 18/114 (16%)

Query  90   GADYYCGFTNAKAAPQPIPDGTMR------STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
            G D  CGFT     P+P+P             G+TH GPCE+++D   VL SD+C   +P
Sbjct  167  GNDKKCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYP  226

Query  144  GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            G   +        +DYSSC G C    YWLG +       WQ Y  C+PLS + 
Sbjct  227  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAYINCVPLSGTG  276

>PHYRA_78175
Length=319

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 63/132 (48%), Gaps = 13/132 (10%)

Query  63   DFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGY  117
            +FN    ++ Y +L+ FM      V       CG+TN   A QP+P   +        G+
Sbjct  68   NFNKGFAASKYSSLKEFMADKLVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGF  127

Query  118  T--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNE  173
            T  H+GPCEVW D TRV Q DNC + FP     L Y   +C GS  L  YW+      + 
Sbjct  128  TASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIAL----HS  183

Query  174  HSWQVYKACIPL  185
             SWQVY  C  L
Sbjct  184  ASWQVYINCAAL  195

>PYU1_G005868
Length=267

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 25/128 (20%)

Query  70   SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHD  120
            S+ YK+LR  +D A   V D     CGFT     P  +          D   +    +H 
Sbjct  72   SSSYKSLREMLDSA---VPD-----CGFTLTDGTPVDVSSLKSMKWQNDQEQKGFIDSHH  123

Query  121  GPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
            GPCE+W+D T+++ SD+C   +  +P +   +DYS CKG C L +YWL      +E +WQ
Sbjct  124  GPCELWIDDTKIMHSDDCRADYTAYPAE-IPVDYSVCKGKCQLTFYWLAL----HEPNWQ  178

Query  178  VYKACIPL  185
            +YK C+P+
Sbjct  179  IYKQCVPI  186

>PHYRA_84947
Length=265

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 63/131 (48%), Gaps = 17/131 (13%)

Query  62   EDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYY-CGFTNAKAAPQPIP-DGTMR--STGY  117
            E  + W   N   +L+      +Y  T G D   CG T    APQP+P DG  +  + G 
Sbjct  64   EAVDSWFTKNNIASLK------EYITTYGTDISECGVTKKNGAPQPVPSDGYAQHDNLGN  117

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
            +H GPCE+W D TRV    NC   F G++     +D S+CK S  L +YWL         
Sbjct  118  SHPGPCEIWCDDTRVFHDSNCVAKFSGQSPAKIPIDVSTCKSSSELVFYWLALHI----Q  173

Query  175  SWQVYKACIPL  185
             WQVY  C+ L
Sbjct  174  PWQVYINCVAL  184

>PHYKE_1913
Length=280

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 82/180 (46%), Gaps = 34/180 (19%)

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDF----NGWRRSNGYKTLRAFMD  81
            DAH  +  P PT+       ++  L          +E++    +G  +   YKT+ A   
Sbjct  21   DAHGHLKSPEPTFEDGAPTVEWVTL----------IENYWDIGSGGDQVGKYKTMAAEKG  70

Query  82   -GAKYTVTDGA-DYYCGFTNAKAAPQPIP-DGTM-----RSTGYTHDGPCEVWLDSTRVL  133
               K  V D   D  CG+T A A P+P+P DG          G+TH GPCEV+++   VL
Sbjct  71   MSVKDVVLDMVKDKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVL  130

Query  134  QSDNCHETFPG--------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              D+C + +PG            +DYSSC G C L  YWL  +  +    WQ Y  C+PL
Sbjct  131  HGDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQAYINCVPL  186

>PHYCA_103479
Length=314

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 69/139 (50%), Gaps = 39/139 (28%)

Query  69   RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT----------  118
             + GYK+LR  +D          DY  GF+   A P       +  TGYT          
Sbjct  72   NATGYKSLREMVDPI------ATDY--GFSVKTATP-------VDVTGYTEMWWQNDEYK  116

Query  119  ------HDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRF  169
                  H+GPCE W+D TR+   DNC    +T+P K    DYSSCKG C+  +YWL    
Sbjct  117  EGFIASHEGPCEGWIDDTRIFHYDNCAAQFKTYPAK-IPADYSSCKGDCLFSFYWLAL--  173

Query  170  LKNEHSWQVYKACIPLSSS  188
              +E +WQ+YK C+P++++
Sbjct  174  --HEPNWQIYKQCVPITNN  190

>PYAP_18138
Length=268

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 67/116 (58%), Gaps = 16/116 (14%)

Query  69   RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP--DGTMRSTGYTHDGPCEVW  126
            + +G K LR+++D AK T        CG +    +P+PIP  +        TH GPCE W
Sbjct  80   KQHGVKDLRSYID-AKIT-------ECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEFW  131

Query  127  LDSTRVLQSDNCHETFPGK-TYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVYK  180
            +D TRV Q+++C   F  K T  LDYS C G +C+LR+YWLG   L+N   WQVY+
Sbjct  132  IDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLG---LQNS-DWQVYR  183

>PYVX_16138
Length=559

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 72/150 (48%), Gaps = 29/150 (19%)

Query  60   TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
            +V+ +       G   +R+ +D    T   GAD  CG+T+     Q IP D T   S G 
Sbjct  63   SVDTYVSLAEEKGVTQIRSLLDD---TSIYGAD--CGYTDPDGTAQDIPTDSTATFSRGM  117

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPG------KTYNLDYSSC--KGSCMLRWYWLGTRF  169
             H GPCE+WLD T VL  D+C+ T+ G        + +DYSSC   G  M+R+YWL  + 
Sbjct  118  VHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQG  177

Query  170  LKNEHSWQVYKA--------------CIPL  185
            + +E  WQVY                CIPL
Sbjct  178  VDDETVWQVYSVMSAQLTAMRDFTEDCIPL  207

>PPTG_07520
Length=294

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 63/143 (44%), Gaps = 25/143 (17%)

Query  57   GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
            G   +  F    +  G       +D  K       D  CG T     PQPIP DG ++  
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                 G+TH GPCE++LD   VL  D+C + F G            +D+SSC G C+L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  163  YWLGTRFLKNEHSWQVYKACIPL  185
            YWL  +  +    WQ Y  C+PL
Sbjct  166  YWLAFQNAQ----WQTYVNCVPL  184

>PPTG_07516
Length=294

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 66/143 (46%), Gaps = 25/143 (17%)

Query  57   GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
            G   +  F    +  G       +D  K       D  CG T     PQPIP DG ++  
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG------KTYNL--DYSSCKGSCMLRW  162
                 G+TH GPCE++LD   VL  D+C + F G      +T ++  D+SSC G C+L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  163  YWLGTRFLKNEHSWQVYKACIPL  185
            YWL  +  +    WQ Y  C+PL
Sbjct  166  YWLAFQNAQ----WQTYVNCVPL  184

>PYU1_G001519
Length=265

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 71/176 (40%), Gaps = 20/176 (11%)

Query  26   DAHQVVLLPAPTY-----------TTDNKDTKYAP--LAFLESQGFKTVEDFNGWRRSNG  72
            DAH  + LP PT+           T D   T   P  ++F       T      ++    
Sbjct  20   DAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTNAYLKAFKAQTK  79

Query  73   YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLDSTR  131
            YK+L+         V  GA   CGF++    PQP+PD         +H GPCEVW D   
Sbjct  80   YKSLKDLAMSDAQKVESGATKECGFSDVNGTPQPLPDTVQWDRFDNSHMGPCEVWCDDVM  139

Query  132  VLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            V Q DNC    P     L Y  + C G  ML  +W+         +WQ+Y  C P+
Sbjct  140  VFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALHV----PTWQIYTNCAPI  191

>PHYSO_488921
Length=296

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 85/191 (45%), Gaps = 50/191 (26%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLE-SQGF----------KTVEDFNGWRRSNGYKT  75
            AH  +  P  TY +  + TKY  L     ++GF             + FN    + GYK+
Sbjct  19   AHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATGYKS  78

Query  76   LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT----------------H  119
            LR  +D          DY  G +   A P  +       TGYT                H
Sbjct  79   LREMLDPI------APDY--GHSLKTATPVDV-------TGYTEMWWQNDEYKEGFINSH  123

Query  120  DGPCEVWLDSTRVLQSDNCH---ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSW  176
             GPCE W+D  ++   DNC    +++P K    DYSSCKG C+L +YWL      +E +W
Sbjct  124  SGPCEAWIDDVKIFHHDNCAAEFKSYPAKV-PADYSSCKGDCLLVFYWLAL----HEPNW  178

Query  177  QVYKACIPLSS  187
            Q+YK C+P+++
Sbjct  179  QIYKQCVPITN  189

>PHYSO_329293
Length=310

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 85/191 (45%), Gaps = 50/191 (26%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLE-SQGF----------KTVEDFNGWRRSNGYKT  75
            AH  +  P  TY +  + TKY  L     ++GF             + FN    + GYK+
Sbjct  19   AHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATGYKS  78

Query  76   LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT----------------H  119
            LR  +D          DY  G +   A P       +  TGYT                H
Sbjct  79   LREMLDPI------APDY--GHSLKTATP-------VDVTGYTEMWWQNDEYKEGFINSH  123

Query  120  DGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSW  176
             GPCE W+D  ++   DNC    +++P K    DYSSCKG C+L +YWL      +E +W
Sbjct  124  SGPCEAWIDDVKIFHHDNCAAEFKSYPAKV-PADYSSCKGDCLLVFYWLAL----HEPNW  178

Query  177  QVYKACIPLSS  187
            Q+YK C+P+++
Sbjct  179  QIYKQCVPITN  189

>SDRG_16534
Length=320

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 79/178 (44%), Gaps = 25/178 (14%)

Query  27   AHQVVLLPAPTYTTDNKD-TKYA---------PLAFLESQGFKTVEDFNGWRRSNGYKTL  76
             H  ++ P P +T    D +K+A         P +  E       + F    +++ +KTL
Sbjct  20   GHGHLVDPVPAFTDKYGDPSKFAATLNGPTVLPGSSYEQGPDWNTDQFTKHFKASSFKTL  79

Query  77   RAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----THDGPCEVWLDSTR  131
            +AF+D        G D  CG T++    QP+P     + G      +H GPCE+W D TR
Sbjct  80   KAFLD----AYPTGGD--CGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCELWCDETR  133

Query  132  VLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            V Q DNC    P    ++D S C G+  L   WL          WQVYK C+ LS  A
Sbjct  134  VFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALH----TPEWQVYKNCVNLSGVA  187

>PYU1_G001528
Length=274

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 75/180 (42%), Gaps = 24/180 (13%)

Query  26   DAHQVVLLPAPTYTTDNKDTKY----------APLAF-LESQGFKTVEDFNGWRRSNGYK  74
            DAH  + +P PT+T +   T++          AP      +        F    +++ YK
Sbjct  25   DAHGSMSVPKPTFTINGDTTQFCGTVDSSALTAPAGMSFTTDPLSNTNAFTAALKTSSYK  84

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-------DGTMRSTGYTHDGPCEVWL  127
            ++R   +        GA   CG+T+A  A QP+P        G+      +H GPCEVW 
Sbjct  85   SVRDLWNAKGVLGVTGATKQCGYTSATGAAQPLPAKYVEWSHGSGEGFTPSHQGPCEVWC  144

Query  128  DSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            D+       NC + +P     L  D++ C G  ML  YWL      +   WQ Y  C PL
Sbjct  145  DNVLAFTDTNCAKNYPTAPAKLPFDHAKCVGKKMLTIYWLAL----HSPQWQAYINCAPL  200

>PYVX_21297
Length=263

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 7/100 (7%)

Query  87   VTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            + + A   CG T+  AA QP+P DG +       H GPCEVWLD T+V  +++C  T+  
Sbjct  59   LANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHIGPCEVWLDDTKVASANDCWSTYAD  118

Query  145  KTYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVYKACI  183
            KT  +DYS C G SC LRW WL T        W+++  C+
Sbjct  119  KTIPIDYSVCTGSSCQLRWVWLATH----NDPWEIFDNCV  154

>SPRG_07627
Length=536

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 83/178 (47%), Gaps = 32/178 (18%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPL--AFL----ESQGFKTVEDFN-GWRRSNGYKTLRAFM  80
            H V+  P   +  +   T Y  +  AFL    +      V +FN  +     YKTLR  +
Sbjct  18   HGVISSPLAEFAPNIMRTTYVAIIQAFLPGKFDDSPQTNVANFNKAFAAQTQYKTLRDLL  77

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STGY----THDGPCEVWLDSTR  131
            D        G D  CG T    A + IP DG M      TG     +H GPCE+WLDSTR
Sbjct  78   D------LHGPD--CGNTLPNVAAKAIPSDGKMTWKNPDTGEGFIPSHTGPCEIWLDSTR  129

Query  132  VLQSDNCHETFPGKT---YNLDYSSC-KGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            V Q+++C   FP        +DY+ C    C+LR+YWL       +  WQVYK C+PL
Sbjct  130  VFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALH----QPQWQVYKNCVPL  183

>PYVX_20783
Length=276

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (47%), Gaps = 23/172 (13%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAP---LAFLESQGFKTVEDF----NGWRRSNGYKTLRAF  79
             H  +++P PT  +D+      P   +   E  G  +  D+    + W  +NG  +L+  
Sbjct  22   GHGNIIVPQPTGDSDHVYYYGGPAGTIDMAEIIGSASYGDYYQAVDDWFTANGISSLK--  79

Query  80   MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSD  136
                +Y  T G+   CG T     PQP+P DG  +  + G +H GPCE+W D TRV  S 
Sbjct  80   ----EYITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDTRVFTST  135

Query  137  NCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
            NC   F G++     +D ++C GS    +YWL          WQVY  C+ L
Sbjct  136  NCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLALH----AQPWQVYINCVAL  183

>PHYKE_10295
Length=292

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 23/126 (18%)

Query  73   YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHDGPC  123
            +KTLRA MD      T   D  CG T    +P  +          D   +    +H GPC
Sbjct  75   FKTLRALMD------TVAPD--CGNTALTGSPVDVSALSSMKWQNDQEQKGFIDSHHGPC  126

Query  124  EVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
            E W+D TRV+QSD+C   +P       +DYSSC G C   +YW+      +E +WQVYK 
Sbjct  127  EAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMAL----HEPNWQVYKQ  182

Query  182  CIPLSS  187
            C P+++
Sbjct  183  CAPITN  188

>PYAP_19707
Length=241

 Score = 78.6 bits (192),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 7/100 (7%)

Query  87   VTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
            + + A   CG T+A A  QPIP DG +       H GPCEVWLD+T+V  +  C + FP 
Sbjct  61   LAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHIGPCEVWLDNTKVASAKECWKEFPN  120

Query  145  KTYNLDYSSCK-GSCMLRWYWLGTRFLKNEHSWQVYKACI  183
            K   +D++ CK GSC LRW W+ T    +   W+ +  C+
Sbjct  121  KRIKVDFAKCKSGSCQLRWVWMAT----HTSPWEFFDNCV  156

>PHYKE_2454
Length=374

 Score = 80.5 bits (197),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 79/179 (44%), Gaps = 24/179 (13%)

Query  26   DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKT  75
            + H  +  P  T++    D T++       S GF+          V  F    +++ YK+
Sbjct  19   NGHGWMTKPEATFSASAGDKTQFVATIGSSSTGFEGSYNSAPADNVASFTKAFKASSYKS  78

Query  76   LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWLD  128
            L+A +D        GA   CG  +  AA QP+P  T+      S G+T  H+GPCE W D
Sbjct  79   LKALIDDKAKITVSGATLTCGSADPSAAAQPLPS-TLEWSHSDSEGFTPSHEGPCEAWCD  137

Query  129  STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              RV Q +NC   FP     + Y  SS  G+  L +YW+         SWQVY  C  L
Sbjct  138  DVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMH----GPSWQVYVNCAAL  192

>PYAR_18165
Length=261

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 8/107 (7%)

Query  81   DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNC  138
            D  K  +       CG TNA AA QP P DG +  +    H GPCE+WLD T+V+ + +C
Sbjct  55   DEVKSLLEKAGGSKCGKTNANAAVQPAPSDGVVAFAISAQHIGPCEIWLDDTKVVSATDC  114

Query  139  HETFPGKTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
             + FP K   +D+S C  K SC LRW W+ T    +   W+ Y  C+
Sbjct  115  WKQFPDKRIPVDFSKCANKASCELRWIWMAT----HTSPWEFYDNCV  157

>SPRG_07797
Length=318

 Score = 79.7 bits (195),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 82/178 (46%), Gaps = 25/178 (14%)

Query  27   AHQVVLLPAPTYTTDNKD-TKYA-----PLAFLES---QGFK-TVEDFNGWRRSNGYKTL  76
             H  ++ P P +T    D TK+A     P     S   QG     ++F    +++ +KTL
Sbjct  20   GHGHLVDPVPAFTDKYGDPTKFAATLDGPTVLPGSTYGQGPDWNTDEFTKHFKASSFKTL  79

Query  77   RAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----THDGPCEVWLDSTR  131
            +AF+D        G D  CG T+A    QP+P     + G      +H GPCE+W D+ R
Sbjct  80   KAFLDAHP----SGGD--CGITDANGPAQPLPSTVKWANGQEGFISSHQGPCELWCDNMR  133

Query  132  VLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            V   +NC   +P    ++D S C G+  L   WL          WQVYK C+ LS +A
Sbjct  134  VFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALH----SPQWQVYKNCVNLSGAA  187

>PYU1_G001527
Length=278

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 61/123 (50%), Gaps = 14/123 (11%)

Query  73   YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
            YK++RA +D AK     G +  CG T+     QP+P   +      S G+T  H GPCEV
Sbjct  83   YKSVRALVD-AKGVFQPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCEV  141

Query  126  WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
            W D+     +DNC   +P     L  D S C G  ML++YWL         +WQ Y AC 
Sbjct  142  WCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIACA  197

Query  184  PLS  186
            PL+
Sbjct  198  PLA  200

>PYU1_G001523
Length=278

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 61/123 (50%), Gaps = 14/123 (11%)

Query  73   YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
            YK++RA +D AK     G +  CG T+     QP+P   +      S G+T  H GPCEV
Sbjct  83   YKSVRALVD-AKGVFQPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCEV  141

Query  126  WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
            W D+     +DNC   +P     L  D S C G  ML++YWL         +WQ Y AC 
Sbjct  142  WCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIACA  197

Query  184  PLS  186
            PL+
Sbjct  198  PLA  200

>SPRG_07825
Length=337

 Score = 79.7 bits (195),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 81/181 (45%), Gaps = 26/181 (14%)

Query  27   AHQVVLLPAPTYTTDNKD-----------TKYAPLAFLESQGFKTVEDFNGWRRSNGYKT  75
            AH  +  P PT+   N D           T     A+ +  G+   + F    +++ YKT
Sbjct  19   AHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNAAQ-FAANFKTSKYKT  77

Query  76   LRAFMDGAKYTVTDGADYYCGFTNAKAA-PQPIPD------GTMRSTGYTHDGPCEVWLD  128
            L+AF+D    +   G    CG T   AA PQP+P       G       +H+GPCE+W D
Sbjct  78   LKAFLDAWDTSAQCGQ---CGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWCD  134

Query  129  STRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
             TRV  +D+C +  P  +  +D S C G+  L   W+     +    WQ YK C+ + S+
Sbjct  135  ETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAYKNCVAIGSA  190

Query  189  A  189
             
Sbjct  191  G  191

Lambda      K        H        a         alpha
   0.318    0.133    0.431    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9439740474

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40