Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_11834147551341347009e-96
PHYRA_95903147551341346234e-84
PHALS_06479147551361336131e-82
PHYSO_321155147551361336132e-82
PPTG_17126147551361336123e-82
PITG_18455147551321305922e-79
PHYKE_8392147551381355811e-77
HYAP_07103147551641645389e-71
PYVX_18180147551351304612e-59
PYAP_17747147551341354204e-53
PYU1_G001736147551231263831e-47
CCA17542147551201213578e-44
CCI44820147551231243464e-42
PYIW_19970147551301223404e-41
PYIR_13454147551291223145e-37
H257_06293147551231233041e-35
H310_09224147551231232901e-33
SDRG_01782147551231222892e-33
SPRG_06335147551231222735e-31
HYAP_0849911147108621073e-06
HYAP_0850065260172621086e-06
PITG_137391114710561977e-05
PHYKE_58411114712157988e-05
PHYSO_3150171114710961942e-04
PYIW_147431114710556942e-04
PPTG_092521114710561933e-04
PYIR_151861114710956934e-04
PYU1_G0059631114710357925e-04
PYAP_228461114710492916e-04
PHALS_115641114710756916e-04
CCA175211114710451880.001
CCI442321114710554850.004
PYAR_232071114711260840.006
PHYRA_816751114710661840.007
PYVX_208541114710460840.007
SDRG_149121114710576820.010
SPRG_128831114710576820.010
PHYCA_5353801114710861810.016
H310_07567111479849790.027
CCA240562362427061780.14
PHYRA_751931416310461740.18
PYVX_151505606474667760.21
PHYRA_748055734432874760.21
H257_07358111479866720.23
PYIW_142931416310445710.40
PHALS_00343295789253661.9
PYAR_201682038130691692.2
PPTG_171541557258170682.7
PYAP_248671340314770662.9
SPRG_1173112822943177673.6
H310_138701481110798673.9
PYAP_21848351389079674.0
PYU1_G0131561561313157644.2
SPRG_21627911025434654.6
PYU1_G0104059611959339664.8
PYAP_195249573253737655.2
PHYCA_5404611416310461626.8
CCI487201340311484627.0
PYIR_247561073749595647.9
PYAR_212891340311871628.6
SDRG_0686812822954877648.6
H257_0521914045048872639.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_11834

Length=134
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_11834                                                           274        9e-96
PHYRA_95903                                                           244        4e-84
PHALS_06479                                                           240        1e-82
PHYSO_321155                                                          240        2e-82
PPTG_17126                                                            240        3e-82
PITG_18455                                                            232        2e-79
PHYKE_8392                                                            228        1e-77
HYAP_07103                                                            211        9e-71
PYVX_18180                                                            182        2e-59
PYAP_17747                                                            166        4e-53
PYU1_G001736                                                          152        1e-47
CCA17542                                                              142        8e-44
CCI44820                                                              137        4e-42
PYIW_19970                                                            135        4e-41
PYIR_13454                                                            125        5e-37
H257_06293                                                            121        1e-35
H310_09224                                                            116        1e-33
SDRG_01782                                                            115        2e-33
SPRG_06335                                                            109        5e-31
HYAP_08499                                                            45.8       3e-06
HYAP_08500                                                            46.2       6e-06
PITG_13739                                                            42.0       7e-05
PHYKE_5841                                                            42.4       8e-05
PHYSO_315017                                                          40.8       2e-04
PYIW_14743                                                            40.8       2e-04
PPTG_09252                                                            40.4       3e-04
PYIR_15186                                                            40.4       4e-04
PYU1_G005963                                                          40.0       5e-04
PYAP_22846                                                            39.7       6e-04
PHALS_11564                                                           39.7       6e-04
CCA17521                                                              38.5       0.001
CCI44232                                                              37.4       0.004
PYAR_23207                                                            37.0       0.006
PHYRA_81675                                                           37.0       0.007
PYVX_20854                                                            37.0       0.007
SDRG_14912                                                            36.2       0.010
SPRG_12883                                                            36.2       0.010
PHYCA_535380                                                          35.8       0.016
H310_07567                                                            35.0       0.027
CCA24056                                                              34.7       0.14 
PHYRA_75193                                                           33.1       0.18 
PYVX_15150                                                            33.9       0.21 
PHYRA_74805                                                           33.9       0.21 
H257_07358                                                            32.3       0.23 
PYIW_14293                                                            32.0       0.40 
PHALS_00343                                                           30.0       1.9  
PYAR_20168                                                            31.2       2.2  
PPTG_17154                                                            30.8       2.7  
PYAP_24867                                                            30.0       2.9  
SPRG_11731                                                            30.4       3.6  
H310_13870                                                            30.4       3.9  
PYAP_21848                                                            30.4       4.0  
PYU1_G013156                                                          29.3       4.2  
SPRG_21627                                                            29.6       4.6  
PYU1_G010405                                                          30.0       4.8  
PYAP_19524                                                            29.6       5.2  
PHYCA_540461                                                          28.5       6.8  
CCI48720                                                              28.5       7.0  
PYIR_24756                                                            29.3       7.9  
PYAR_21289                                                            28.5       8.6  
SDRG_06868                                                            29.3       8.6  
H257_05219                                                            28.9       9.6  

>PHYCA_11834
Length=134

 Score = 274 bits (700),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 134/134 (100%), Positives = 134/134 (100%), Gaps = 0/134 (0%)

Query  1    MAARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLG  60
            MAARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLG
Sbjct  1    MAARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLG  60

Query  61   YLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQ  120
            YLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQ
Sbjct  61   YLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQ  120

Query  121  YFMDRKSGPPRPIF  134
            YFMDRKSGPPRPIF
Sbjct  121  YFMDRKSGPPRPIF  134

>PHYRA_95903
Length=134

 Score = 244 bits (623),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)

Query  1    MAARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLG  60
            MAARELRPLYKKLLRLAQSLPEPKRQ S+DQIRREFRSHE+LTDPKEVS L+QRAQSSLG
Sbjct  1    MAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLG  60

Query  61   YLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQ  120
            YLKIVTPRAESN G+QR+IYR+G+RVNA+E+E  GEENAR+KTQD+E GLKRHHQLLRRQ
Sbjct  61   YLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQ  120

Query  121  YFMDRKSGPPRPIF  134
            +FMDRKSGPPRPIF
Sbjct  121  HFMDRKSGPPRPIF  134

>PHALS_06479
Length=136

 Score = 240 bits (613),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 122/133 (92%), Gaps = 0/133 (0%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61
            A RELRPLYKKLLRLAQ+LP+ KRQ+SIDQIRREFR HEDLTDPKEVS+ +QRAQSSL Y
Sbjct  4    ATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSY  63

Query  62   LKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQY  121
            LKI+TPR ESNTGVQRFIYR+G+RVNA + E KG ENARWKTQDMEAG KRHHQLLRRQY
Sbjct  64   LKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQY  123

Query  122  FMDRKSGPPRPIF  134
            FMDRKSGPPRPIF
Sbjct  124  FMDRKSGPPRPIF  136

>PHYSO_321155
Length=136

 Score = 240 bits (613),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61
            AARELRPLYKKLLRLAQSLPEPKR+ S+DQIRREFRSH DLTDP+ VS L+QRAQSSL Y
Sbjct  4    AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSY  63

Query  62   LKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQY  121
            LKIVTPR ESNTGVQRFIYR+G+RVNA E E KGEENAR+KTQD+EAGLKRHHQLLRRQY
Sbjct  64   LKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQY  123

Query  122  FMDRKSGPPRPIF  134
            FMDRKSGPPRPIF
Sbjct  124  FMDRKSGPPRPIF  136

>PPTG_17126
Length=136

 Score = 240 bits (612),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61
            A RELRPLYKKLLRLAQSLPEPKRQ+SIDQIRR+FR+H DLTDP+EVS L+QRAQSSL Y
Sbjct  4    AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63

Query  62   LKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQY  121
            LKIVTPRAESN GVQR+IYR+G+RVNA+E E KGEENARWKTQDME GL+RHHQLLRRQY
Sbjct  64   LKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQY  123

Query  122  FMDRKSGPPRPIF  134
            F+DRKSGPPRPIF
Sbjct  124  FLDRKSGPPRPIF  136

>PITG_18455
Length=132

 Score = 232 bits (592),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 0/130 (0%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64
            ELRPLYKKLLRLAQSLPEPKRQ+SIDQIRR+FRSH D TDPKEVS L+QRAQSSL YLKI
Sbjct  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62

Query  65   VTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124
            VTPRAESNTGVQR+IYR+G+RVNA E E KG ENARWK QDME GLKRHHQLL+RQYFM+
Sbjct  63   VTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMN  122

Query  125  RKSGPPRPIF  134
            RKSGPPRPIF
Sbjct  123  RKSGPPRPIF  132

>PHYKE_8392
Length=138

 Score = 228 bits (581),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 2/135 (1%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61
            AARELRPLYKKLLR+AQ+LPEPKR  S+ QIRREFR+H DL+DPKEVSKLLQ AQSSL Y
Sbjct  4    AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSY  63

Query  62   LKIVTPR--AESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRR  119
            LKIVTPR   ESN+GVQR+IYR+G+RVNA ELE KGEENAR+KTQDMEAGLKRHHQL+RR
Sbjct  64   LKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRR  123

Query  120  QYFMDRKSGPPRPIF  134
            Q+FMDRKSGPPRP+F
Sbjct  124  QHFMDRKSGPPRPMF  138

>HYAP_07103
Length=164

 Score = 211 bits (538),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 122/164 (74%), Gaps = 35/164 (21%)

Query  6    LRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIV  65
            +RPLYKKLLRLAQSLPEPKRQ S+DQIRREFR H DLTDPKEVS LLQRAQSS+ +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  66   TPRAES-----------------------------------NTGVQRFIYRDGKRVNAEE  90
            TPRAES                                   +TG+QRF+YRDGKR++A E
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  91   LEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMDRKSGPPRPIF  134
            L+ KGEENAR+KTQD+EAG+KRHHQLLRRQ+FMDRKSGPPRPIF
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PYVX_18180
Length=135

 Score = 182 bits (461),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 0/130 (0%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64
            ELRPLYKKLLRLAQSLPEPKR +++ QIR EFRSH ++TD  EV+KLLQRAQS LGYLKI
Sbjct  6    ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKI  65

Query  65   VTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124
            VTPR  S +GV+R+IYR+G+RV+A+  E  GE+ AR+KT DME  LKRHHQLLRRQ+FMD
Sbjct  66   VTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMD  125

Query  125  RKSGPPRPIF  134
            R   PPRPIF
Sbjct  126  RGVAPPRPIF  135

>PYAP_17747
Length=134

 Score = 166 bits (420),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 108/135 (80%), Gaps = 2/135 (1%)

Query  1    MAARELRPLYKKLLRLAQSLP-EPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL  59
            MA  ELRPLYK+LLRLA+SLP E KR+ ++ QIR EFRS +D  DPKEV+ L+QRAQ+ +
Sbjct  1    MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60

Query  60   GYLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRR  119
            GYLKIVTPR+ ++ GV+ F+Y +GKRV++ +++ + EE AR+KT D E  ++RH+QLLRR
Sbjct  61   GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRR  119

Query  120  QYFMDRKSGPPRPIF  134
            Q+FMDR   PP+PIF
Sbjct  120  QHFMDRGVAPPKPIF  134

>PYU1_G001736
Length=123

 Score = 152 bits (383),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (78%), Gaps = 3/126 (2%)

Query  1    MAARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLG  60
            MA+ +LRP+YKKLL+LAQ+LP  KRQT+++QIRREFR+H    DPKE++ LL RAQSS+G
Sbjct  1    MASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIG  60

Query  61   YLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQ  120
            YLKIVTPRA S+ GV+ ++Y  GKRV A       E+ AR+KT D  A ++RH QLLRRQ
Sbjct  61   YLKIVTPRATSDAGVKNYVYIKGKRVEAAGAA---EDGARYKTADYNAQMQRHVQLLRRQ  117

Query  121  YFMDRK  126
            +FMDRK
Sbjct  118  HFMDRK  123

>CCA17542
Length=120

 Score = 142 bits (357),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 94/121 (78%), Gaps = 3/121 (2%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64
            + R +YK+L+RLA+SLP  K+  ++  IR EFR H D++DP ++S+LL+RAQS++GYLKI
Sbjct  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62

Query  65   VTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124
            VTP   S++GV+RF+++DG+R+   E   K  E AR+K QD+  GLKRHHQLLRRQ+FMD
Sbjct  63   VTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFMD  119

Query  125  R  125
            R
Sbjct  120  R  120

>CCI44820
Length=123

 Score = 137 bits (346),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 93/124 (75%), Gaps = 3/124 (2%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61
            A  E R ++KK+++LA+SLP  K+  ++  IR EFR H D+ DP ++++LL+RAQS++GY
Sbjct  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62

Query  62   LKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQY  121
            LKIVTP   S++GV+ F+Y+DG+R+      G   E A++K QDME GLKRH+QL+RRQY
Sbjct  63   LKIVTPHKRSDSGVKHFVYKDGERIEKSLQAG---EKAKFKVQDMEEGLKRHNQLIRRQY  119

Query  122  FMDR  125
            FMDR
Sbjct  120  FMDR  123

>PYIW_19970
Length=130

 Score = 135 bits (340),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 94/122 (77%), Gaps = 3/122 (2%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64
            +LRP+YKKLL+LA++LPE KR+T+  QIR EFRS ++L+DPKE++ LL RAQSS+ YLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  65   VTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124
            VTPR  S+ GV+ +IY++G+RV A  +    E+ A+++  D    + RH +LLRRQ+FMD
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVM---EDGAKYQLPDYNGQMLRHQKLLRRQHFMD  128

Query  125  RK  126
            RK
Sbjct  129  RK  130

>PYIR_13454
Length=129

 Score = 125 bits (314),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 95/122 (78%), Gaps = 3/122 (2%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64
            +LRP+YKKLL+LA++LPE KR  ++ QIR EFR+ +D++DPKE++ LL RAQSS+GYLKI
Sbjct  11   DLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70

Query  65   VTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124
            VTPR  S+ GV+ +IY++G+RV A  +    E+ A++   D  A ++RH +LLRRQ+FMD
Sbjct  71   VTPRKSSDAGVKNYIYKNGQRVEATSVL---EDGAKYSIPDYNAQMQRHQKLLRRQHFMD  127

Query  125  RK  126
            RK
Sbjct  128  RK  129

>H257_06293
Length=123

 Score = 121 bits (304),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 90/123 (73%), Gaps = 2/123 (2%)

Query  4    RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63
            + +R  YKKL++LAQSLP  ++ T++D+IR +FRS   ++  +E+ KL+ +AQS + YLK
Sbjct  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62

Query  64   IVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFM  123
            IVTP+    +G QRFIY+DGKR++++ L+  G  N   KT D+ A ++RH +L+RRQ+FM
Sbjct  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFM  120

Query  124  DRK  126
            DRK
Sbjct  121  DRK  123

>H310_09224
Length=123

 Score = 116 bits (290),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 85/123 (69%), Gaps = 2/123 (2%)

Query  4    RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63
            + +R  YKKL++LAQSLP  ++  ++D++R EFRSH  +T   ++ K++ +AQS + YLK
Sbjct  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62

Query  64   IVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFM  123
            IVTP+    T  QR+IY+DGKR++   ++     NA  KT D  A ++RH +L+RRQ+FM
Sbjct  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCID--QSTNATIKTVDFNAMMERHVKLVRRQHFM  120

Query  124  DRK  126
            DRK
Sbjct  121  DRK  123

>SDRG_01782
Length=123

 Score = 115 bits (289),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 88/122 (72%), Gaps = 4/122 (3%)

Query  6    LRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIV  65
            +R  YKKLL+LA+S+P+ +R  +++++R EFR+HE    P+E+ +LL++AQS + YLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIV  64

Query  66   TP-RAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124
            TP ++ S+T    F+Y++G+R++  EL     ++A  KT D  A + +H QL+RRQ+FMD
Sbjct  65   TPKKSSSSTQGSHFVYKNGQRIDGRELSA---DSATIKTHDYNAMMTKHVQLVRRQHFMD  121

Query  125  RK  126
            RK
Sbjct  122  RK  123

>SPRG_06335
Length=123

 Score = 109 bits (273),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 85/122 (70%), Gaps = 4/122 (3%)

Query  6    LRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIV  65
            +R  YKKLL+LA+S+P+ +R  +++++R EFR+H     P+E+ +LL++AQS + YLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIV  64

Query  66   TPRAESNTGV-QRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124
            TP+   + G    F+Y++G+R++  EL     ++A  KT D  A + +H QL+RRQ+FMD
Sbjct  65   TPKKSPSPGQGNHFVYKNGQRIDGRELSA---DSATIKTADYNAMMTKHVQLVRRQHFMD  121

Query  125  RK  126
            RK
Sbjct  122  RK  123

>HYAP_08499
Length=108

 Score = 45.8 bits (107),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 0/62 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYL  62
           A E+  +Y+++L+LAQ  P  KRQ+ I  I+ EFR++ +L+D ++V K L   Q+ +  L
Sbjct  4   ANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKEL  63

Query  63  KI  64
            +
Sbjct  64  SM  65

>HYAP_08500
Length=172

 Score = 46.2 bits (108),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 0/62 (0%)

Query  3    ARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYL  62
            A E+  +Y+++L+LAQ  P  KRQ+ I  I+ EFR++ +L+D ++V K L   Q+ +  L
Sbjct  68   ANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKEL  127

Query  63   KI  64
             +
Sbjct  128  SM  129

>PITG_13739
Length=105

 Score = 42.0 bits (97),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 40/61 (66%), Gaps = 0/61 (0%)

Query  4   RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63
           RE+  +Y+++L+LAQ  P  KR++ I  I+ EF +++DLTD +++ + L   ++ +  L 
Sbjct  5   REVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGITELS  64

Query  64  I  64
           +
Sbjct  65  M  65

>PHYKE_5841
Length=121

 Score = 42.4 bits (98),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 37/57 (65%), Gaps = 0/57 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL  59
            +E+  +Y+++L+LAQ  P  KR + I  I+ EF +H+ LTD +++ + L  A++ +
Sbjct  4   VKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGI  60

>PHYSO_315017
Length=109

 Score = 40.8 bits (94),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 40/61 (66%), Gaps = 0/61 (0%)

Query  4   RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63
           +E+  +Y+++L+LAQ  P  KR++ I  I+ EF +++DLTD +++ + L   ++ +  L 
Sbjct  5   KEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGIKELS  64

Query  64  I  64
           +
Sbjct  65  M  65

>PYIW_14743
Length=105

 Score = 40.8 bits (94),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 3/56 (5%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSS  58
           A+E+  LY+++L+LA   P  KR   I +I+ EF  ++ LTD    +K+L + QS+
Sbjct  4   AKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDS---AKILDKVQSA  56

>PPTG_09252
Length=105

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 40/61 (66%), Gaps = 0/61 (0%)

Query  4   RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63
           +E+  LY+++L+LAQ  P  KR++ I  I+ EF ++++LTD +++ + L   ++ +  L 
Sbjct  5   KEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELS  64

Query  64  I  64
           +
Sbjct  65  M  65

>PYIR_15186
Length=109

 Score = 40.4 bits (93),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSS  58
           A+E+  +Y+++L+LA   P  KR   I +I+ EF +++ LTD    +K+L + QS+
Sbjct  4   AKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDN---AKILDKVQSA  56

>PYU1_G005963
Length=103

 Score = 40.0 bits (92),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (58%), Gaps = 0/57 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL  59
           A+E+  +Y+++L+LA   P  KR   I  I+ EFR ++ LTD   +   +Q A+  +
Sbjct  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

>PYAP_22846
Length=104

 Score = 39.7 bits (91),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (47%), Gaps = 3/92 (3%)

Query  9   LYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTPR  68
           LY+ +L+LA+  P  KR   I  I+ EF   +  TD + +   +  AQ+ +  L +    
Sbjct  10  LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGIKELSMYATL  69

Query  69  AESNTGVQRFIYRDGKRVNAEELEGKGEENAR  100
             S+T    +    G+ V+ E  +  G+ N +
Sbjct  70  NPSSTA---WTVGVGREVSPEATQAAGDTNTK  98

>PHALS_11564
Length=107

 Score = 39.7 bits (91),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 34/56 (61%), Gaps = 0/56 (0%)

Query  9   LYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64
           +Y++LL+LAQ  P  KR+  I  I+ EF ++  +TD +++ + +  A + +  L +
Sbjct  10  VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELSM  65

>CCA17521
Length=104

 Score = 38.5 bits (88),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (55%), Gaps = 0/51 (0%)

Query  9   LYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL  59
           LY+++LRLA+  P  KR   I+ IR EFR   D+T    +   +  A + +
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGI  59

>CCI44232
Length=105

 Score = 37.4 bits (85),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  9   LYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYL  62
           LY+++LRLA+  P  KR   ++ IR EFR   ++  P  + + +  A + +  L
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKEL  62

>PYAR_23207
Length=112

 Score = 37.0 bits (84),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 34/60 (57%), Gaps = 0/60 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYL  62
           +RE+  LY+++L+LA+  P  KR   ++ I+ EF   + LTD   +   +  AQ+ +  L
Sbjct  7   SREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

>PHYRA_81675
Length=106

 Score = 37.0 bits (84),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 38/61 (62%), Gaps = 0/61 (0%)

Query  4   RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63
           +E+  +Y+++L+LAQ  P  KR + I  I+ EF +++ LTD +++ + L   ++ +  L 
Sbjct  5   KEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGIKELS  64

Query  64  I  64
           +
Sbjct  65  M  65

>PYVX_20854
Length=104

 Score = 37.0 bits (84),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 1/60 (2%)

Query  1   MAAR-ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL  59
           MA R E+  LY+++L+LAQ  P  KR + +  I+ EF  ++ L+D ++V + +  A++ +
Sbjct  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60

>SDRG_14912
Length=105

 Score = 36.2 bits (82),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 3/76 (4%)

Query  1   MAARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSS--  58
           MA R +  +Y+++L+LAQ  P  K+   +  I+ EF  +  LTD  ++ + +  A     
Sbjct  1   MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIE  60

Query  59  -LGYLKIVTPRAESNT  73
            LG    + P A S T
Sbjct  61  QLGQYVHLDPTAHSWT  76

>SPRG_12883
Length=105

 Score = 36.2 bits (82),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 3/76 (4%)

Query  1   MAARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSS--  58
           MA R +  +Y+++L+LAQ  P  K+   +  I+ EF  +  LTD  ++ + +  A     
Sbjct  1   MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIE  60

Query  59  -LGYLKIVTPRAESNT  73
            LG    + P A S T
Sbjct  61  QLGQYVHLDPTAHSWT  76

>PHYCA_535380
Length=108

 Score = 35.8 bits (81),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 37/61 (61%), Gaps = 0/61 (0%)

Query  4   RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63
           +E+  +Y+++L+LA   P  KR++ I  I+ EF +++ LTD + + + L   ++ +  L 
Sbjct  5   KEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGIKELS  64

Query  64  I  64
           +
Sbjct  65  M  65

>H310_07567
Length=98

 Score = 35.0 bits (79),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query  1   MAARELRP-LYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEV  48
           M+A    P +Y+++L+LA+  P  KR   ++ I+ EF  ++ LTDP ++
Sbjct  1   MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKI  49

>CCA24056
Length=4270

 Score = 34.7 bits (78),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (51%), Gaps = 4/61 (7%)

Query  58    SLGYLKIVTPRAESNTGVQRFI----YRDGKRVNAEELEGKGEENARWKTQDMEAGLKRH  113
             S+  L +V P+ ES   V   +    YR+G R++A ++    ++N R K+ D E     H
Sbjct  2039  SMEQLSMVVPKQESKDSVDEILGPVRYREGSRLDATQVPNDAKQNWRSKSTDAEKDPAFH  2098

Query  114   H  114
             H
Sbjct  2099  H  2099

>PHYRA_75193
Length=104

 Score = 33.1 bits (74),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 30/61 (49%), Gaps = 3/61 (5%)

Query  9   LYKKLLRLAQSL--PEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL-GYLKIV  65
           LY+  +RLAQ +     K Q   D +RREF    D TDP++V  L   A   L  YL + 
Sbjct  14  LYRDCMRLAQHIGGNSKKGQAIKDLVRREFAKGRDETDPEKVEALKANAIRGLSNYLMLA  73

Query  66  T  66
            
Sbjct  74  N  74

>PYVX_15150
Length=746

 Score = 33.9 bits (76),  Expect = 0.21, Method: Composition-based stats.
 Identities = 20/67 (30%), Positives = 34/67 (51%), Gaps = 4/67 (6%)

Query  16   LAQSLPEPKRQTSIDQI--RREFRSHEDLTDPKEVSKLLQ--RAQSSLGYLKIVTPRAES  71
            LA+ L  P    + + +     FRS  D ++   V  +L+  R+  SL YL +V PR + 
Sbjct  592  LAKELARPSSLVAQNVLCWSYSFRSEADTSESGRVEGILEMLRSNCSLQYLSLVMPREQH  651

Query  72   NTGVQRF  78
            +  ++RF
Sbjct  652  DASLERF  658

>PHYRA_74805
Length=328

 Score = 33.9 bits (76),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 35/74 (47%), Gaps = 12/74 (16%)

Query  29   IDQIRREFRSHEDLTDPKEVSK---LLQRAQSSLGYLKIVTPRAESNTGV--QRFIYRDG  83
            +D I+ +F   EDL DP  ++    + Q  Q+S       TP  E++  V    + Y D 
Sbjct  191  LDNIKEKFDRDEDLGDPVSLTGPRIVKQTYQNS-------TPEEEADVVVFPSEYFYPDI  243

Query  84   KRVNAEELEGKGEE  97
             R NAE LE K  E
Sbjct  244  ARWNAESLEAKCRE  257

>H257_07358
Length=98

 Score = 32.3 bits (72),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 36/66 (55%), Gaps = 3/66 (5%)

Query  9   LYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK---IV  65
           +Y+++L+LA   P  K++  +  I+ EF  ++ LTDP ++ + +  A   +  L     +
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGIQQLNQYVAL  69

Query  66  TPRAES  71
            P A+S
Sbjct  70  DPNAQS  75

>PYIW_14293
Length=104

 Score = 32.0 bits (71),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 26/45 (58%), Gaps = 2/45 (4%)

Query  9   LYKKLLRLAQSLPEPKRQTSI--DQIRREFRSHEDLTDPKEVSKL  51
           LY+  +RLA+ +    ++ S   D IRREF    D TDP+++  L
Sbjct  13  LYRDCMRLAKHIGGTSKKGSAIKDLIRREFEKARDETDPEKIEAL  57

>PHALS_00343
Length=92

 Score = 30.0 bits (66),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 0/53 (0%)

Query  20  LPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTPRAESN  72
           L +  RQ S+    + F  H  +   KE+   L   Q ++G+L   TPR   N
Sbjct  37  LKDAGRQESLMSNNKGFGCHLYVQGTKEICTELTLVQCNVGFLATPTPRMRIN  89

>PYAR_20168
Length=1306

 Score = 31.2 bits (69),  Expect = 2.2, Method: Composition-based stats.
 Identities = 26/91 (29%), Positives = 41/91 (45%), Gaps = 21/91 (23%)

Query  22   EPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTPRAESNTGVQRFIYR  81
            EP   ++I+Q+ +  R +     P  +  L QRA         +  RAE N   QR    
Sbjct  632  EPWLASTIEQMNQNLRQN---ISPDRIRVLGQRA---------IQERAELN---QR----  672

Query  82   DGKRVNAEELEGKGEENARWKTQDMEAGLKR  112
              +   AEE++G+   ++ WK+Q  E G  R
Sbjct  673  --RTATAEEVQGRVSGSSEWKSQRQEDGSTR  701

>PPTG_17154
Length=581

 Score = 30.8 bits (68),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query  42   LTDPKEVSKLLQRAQSSLGYLK------IVTPRAESNTGVQRFIYRDGKRVNAEELEGKG  95
            L   KE  + LQ  +SS G LK      I+      +T  ++FI+R G   N  E++   
Sbjct  240  LVYSKEYEQALQFVESSQG-LKFYACNMIIRHAGAEDTNTKQFIFRAGLAANFPEVDTSA  298

Query  96   EENARWKTQD  105
            E+   +K QD
Sbjct  299  EDGKTFKNQD  308

>PYAP_24867
Length=147

 Score = 30.0 bits (66),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 34/70 (49%), Gaps = 3/70 (4%)

Query  10  YKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTPRA  69
           Y + LR+ Q L E  R+    QIR  F  +  + D K+V + +++ +     LK V+   
Sbjct  26  YHEFLRITQPLAEDTRRDVRQQIRAAFDMYRHVEDEKQVMQFIRQGREQ---LKHVSDLV  82

Query  70  ESNTGVQRFI  79
           +S    QR +
Sbjct  83  DSAVARQRVV  92

>SPRG_11731
Length=431

 Score = 30.4 bits (67),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (51%), Gaps = 5/77 (6%)

Query  7    RPLYKKLLRLAQSL--PEPKRQTSIDQIRRE--FRSHEDLTDPKEVSKLLQRAQSSLGYL  62
            RPL K  L L   L   +PK++ + +Q  +   FRSH  L DP  VS  +    S+  + 
Sbjct  301  RPLPKGFLELLDKLLQIDPKKRFNAEQALQSEYFRSHPHLQDPATVSTWIPTITSASCH-  359

Query  63   KIVTPRAESNTGVQRFI  79
            ++ T +A+  +G Q  +
Sbjct  360  EMATRKAKKESGAQAIL  376

>H310_13870
Length=1107

 Score = 30.4 bits (67),  Expect = 3.9, Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 42/98 (43%), Gaps = 5/98 (5%)

Query  6    LRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSK-----LLQRAQSSLG  60
            L P   +  ++A +LP  +      Q+R  FR+  D++    V+      +L R  S L 
Sbjct  632  LPPHTPRTFQMALTLPATQTTVMCQQVRLVFRNRHDVSWTWTVTSFVPQTILTRRNSLLA  691

Query  61   YLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEEN  98
             ++ V P      G   F  +    ++ E++ G G E+
Sbjct  692  EMQGVIPGMGQGAGSPSFQRKPTTSLDFEDVTGAGLED  729

>PYAP_21848
Length=890

 Score = 30.4 bits (67),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (47%), Gaps = 3/79 (4%)

Query  32   IRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTPRAESNTGVQRFIYRDGKRVNAEEL  91
            ++RE ++ E L   +EV  L  +  S    + +VT   E+ T  +   Y DG  V   E+
Sbjct  170  LKREGKTQEALAVFREVKTLEAQMASETAAVVVVTSATETVTRTRAGSYEDGNDV---EV  226

Query  92   EGKGEENARWKTQDMEAGL  110
              +  EN  + +Q  E GL
Sbjct  227  TDEDMENPEYLSQLAELGL  245

>PYU1_G013156
Length=131

 Score = 29.3 bits (64),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 31/57 (54%), Gaps = 1/57 (2%)

Query  4   RELRPLYKKLLRLAQSLPE-PKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL  59
           R++  LY + LR A+  P+  +R+     ++ +FR   D+ DP  + +LL  A+  L
Sbjct  9   RQVLGLYAQCLRSARKCPQWEQREMMKAYVKMKFRHDADVQDPARIQRLLADAREEL  65

>SPRG_21627
Length=254

 Score = 29.6 bits (65),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 1/34 (3%)

Query  18   QSLPEPKRQTSI-DQIRREFRSHEDLTDPKEVSK  50
            Q+L EP R   + D +R  FR++  LTDPK +++
Sbjct  68   QALLEPHRGADLRDVVRATFRANATLTDPKTIAQ  101

>PYU1_G010405
Length=593

 Score = 30.0 bits (66),  Expect = 4.8, Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  22   EPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLG  60
            +P+R + I  IRR      +L +  E+ K+++ A+S LG
Sbjct  329  KPQRASIISGIRRRLLEETELGNIHEIEKIIREAKSCLG  367

>PYAP_19524
Length=537

 Score = 29.6 bits (65),  Expect = 5.2, Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 0/37 (0%)

Query  85   RVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQY  121
            R+ A +L  KG + A      +++G++  H+LLRR Y
Sbjct  163  RIGAPKLWAKGVDGAGITVGSIDSGVRVTHELLRRNY  199

>PHYCA_540461
Length=104

 Score = 28.5 bits (62),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (48%), Gaps = 3/61 (5%)

Query  9   LYKKLLRLAQSL--PEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL-GYLKIV  65
           LY+  LRLA+ +     K Q   D +RREF      TDP+++  L   A   L  YL + 
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIKDLVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  66  T  66
            
Sbjct  74  N  74

>CCI48720
Length=114

 Score = 28.5 bits (62),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 19/84 (23%), Positives = 39/84 (46%), Gaps = 0/84 (0%)

Query  10   YKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTPRA  69
            Y++  R+   LP   R     QIR EF +   + + +++  LL+  +  L Y+  +   A
Sbjct  21   YREFQRVTAKLPTSTRSDIRRQIRVEFENCRFVEEEEQIQLLLRYGKEQLKYVSSLVDTA  80

Query  70   ESNTGVQRFIYRDGKRVNAEELEG  93
             S    +R + R+ +  N + ++ 
Sbjct  81   VSKQHQKRKVNRNPEHTNGQGVDA  104

>PYIR_24756
Length=495

 Score = 29.3 bits (64),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 42/95 (44%), Gaps = 0/95 (0%)

Query  15   RLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTPRAESNTG  74
            ++AQ+L  P+ + +  Q+    +S  D        K++  A   L  +  V    ES+  
Sbjct  110  KVAQALNTPETKVATTQVFETLQSFIDFFASDSGRKVIATAGECLSQMCEVAASPESSIF  169

Query  75   VQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAG  109
            +          ++AE L    +++A+ +TQ  E+G
Sbjct  170  LAEIATNICHAMDAEALRKDAKQDAKDQTQQPESG  204

>PYAR_21289
Length=118

 Score = 28.5 bits (62),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 36/71 (51%), Gaps = 3/71 (4%)

Query  10  YKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTPRA  69
           YK+  R+ Q L +  R+   +QIR  +  +  + D K+V+  L++ +     LK V+   
Sbjct  27  YKEFWRITQPLDDATRRDVREQIRAGYELYRHVDDEKQVALFLRQGREQ---LKHVSDLV  83

Query  70  ESNTGVQRFIY  80
           +S    QR ++
Sbjct  84  DSAVARQRVVH  94

>SDRG_06868
Length=548

 Score = 29.3 bits (64),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (51%), Gaps = 5/77 (6%)

Query  7    RPLYKKLLRLAQSL--PEPKRQTSIDQIRRE--FRSHEDLTDPKEVSKLLQRAQSSLGYL  62
            RPL K  L L   L   +PK++ + +Q  +   FRSH  L DP  VS  +    S+  + 
Sbjct  299  RPLPKGFLELLDKLLQIDPKKRFNAEQALQSEYFRSHPYLQDPATVSTWIPTITSASCH-  357

Query  63   KIVTPRAESNTGVQRFI  79
            ++ T +A+  +G Q  +
Sbjct  358  EMATRKAKKESGAQAIL  374

>H257_05219
Length=488

 Score = 28.9 bits (63),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 15/72 (21%)

Query  75   VQRFI---YRDGKRVNA--EELEGKGE----ENARWKTQDMEAGLKRHHQLLR-----RQ  120
            ++ FI   +R  +R+ A   +LEG+G+    E+   KT D     K+HHQ LR       
Sbjct  404  IESFIEVGWRQEERLQALDAKLEGRGDYKKRESVSLKTTDTIPATKKHHQALRLPQQHHS  463

Query  121  YFMDRKSGP-PR  131
            + M+  +GP PR
Sbjct  464  FDMNCMTGPHPR  475

Lambda      K        H        a         alpha
   0.318    0.134    0.382    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3408956100

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40