Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_1047404086778782411e-27
PHYCA_1319324340455301254e-10
PHYCA_133705162935026872e-04
PHYCA_113012417187626857e-04
PHYCA_97486401437626857e-04
PHYCA_133094436858725840.001
PHYCA_1334054374522224880.001
PHYCA_994724032111326830.002
PITG_20812162939628800.005
PHYCA_1020394054816324700.23
PHYCA_1093854137112424680.41
PHYCA_1157294199218626651.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_104740

Length=78
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_104740                                                          97.4       1e-27
PHYCA_131932                                                          52.8       4e-10
PHYCA_133705                                                          38.1       2e-04
PHYCA_113012                                                          37.4       7e-04
PHYCA_97486                                                           37.4       7e-04
PHYCA_133094                                                          37.0       0.001
PHYCA_133405                                                          38.5       0.001
PHYCA_99472                                                           36.6       0.002
PITG_20812                                                            35.4       0.005
PHYCA_102039                                                          31.6       0.23 
PHYCA_109385                                                          30.8       0.41 
PHYCA_115729                                                          29.6       1.2  

>PHYCA_104740
Length=78

 Score = 97.4 bits (241),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)

Query  1   LCTCPRSCSFAGATAVSTGDPEsraarasstvvvlarsrarrllptaaNTEAATGARDSA  60
           LCTCPRSCSFAGATAVSTGDPESRAARASSTVVVLARSRARRLLPTAANTEAATGARDSA
Sbjct  1   LCTCPRSCSFAGATAVSTGDPESRAARASSTVVVLARSRARRLLPTAANTEAATGARDSA  60

Query  61  SATTFVLPGLYCTSKSNS  78
           SATTFVLPGLYCTSKSNS
Sbjct  61  SATTFVLPGLYCTSKSNS  78

>PHYCA_131932
Length=55

 Score = 52.8 bits (125),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)

Query  49  NTEAATGARDSASATTFVLPGLYCTSKSNS  78
           NT+AATGARD+ASATTFVLPG Y  SKSNS
Sbjct  2   NTDAATGARDNASATTFVLPGRYWISKSNS  31

>PHYCA_133705
Length=50

 Score = 38.1 bits (87),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)

Query  53  ATGARDSASATTFVLPGLYCTSKSNS  78
           A GA +SASATTFVLPG Y TSKS S
Sbjct  1   AVGALESASATTFVLPGRYTTSKSYS  26

>PHYCA_113012
Length=76

 Score = 37.4 bits (85),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  53  ATGARDSASATTFVLPGLYCTSKSNS  78
           A GARD ASATTFV PGLY   KS S
Sbjct  15  AAGARDKASATTFVDPGLYSIPKSYS  40

>PHYCA_97486
Length=76

 Score = 37.4 bits (85),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  53  ATGARDSASATTFVLPGLYCTSKSNS  78
           A GARD ASATTFV PGLY   KS S
Sbjct  15  AAGARDKASATTFVDPGLYSIPKSYS  40

>PHYCA_133094
Length=87

 Score = 37.0 bits (84),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 20/25 (80%), Gaps = 0/25 (0%)

Query  54  TGARDSASATTFVLPGLYCTSKSNS  78
           TGA D+ASATTFVLPG Y T KS S
Sbjct  39  TGALDNASATTFVLPGRYSTVKSYS  63

>PHYCA_133405
Length=222

 Score = 38.5 bits (88),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)

Query  55   GARDSASATTFVLPGLYCTSKSNS  78
            GARD+ASATTFV PG Y TSKS S
Sbjct  175  GARDNASATTFVFPGRYSTSKSYS  198

>PHYCA_99472
Length=113

 Score = 36.6 bits (83),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  53   ATGARDSASATTFVLPGLYCTSKSNS  78
            A GARD ASATTFV PGLY   KS S
Sbjct  81   AAGARDRASATTFVDPGLYSILKSYS  106

>PITG_20812
Length=96

 Score = 35.4 bits (80),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  51  EAATGARDSASATTFVLPGLYCTSKSNS  78
           EAA  AR+SASATTFV+PG Y  S S S
Sbjct  47  EAAADARESASATTFVVPGRYKISNSYS  74

>PHYCA_102039
Length=163

 Score = 31.6 bits (70),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 17/24 (71%), Gaps = 0/24 (0%)

Query  55   GARDSASATTFVLPGLYCTSKSNS  78
            GAR+SASATTFV P  Y   KS S
Sbjct  84   GARESASATTFVAPDRYSMEKSYS  107

>PHYCA_109385
Length=124

 Score = 30.8 bits (68),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 17/24 (71%), Gaps = 0/24 (0%)

Query  55  GARDSASATTFVLPGLYCTSKSNS  78
           GARD+ASATT V PG Y   KS S
Sbjct  77  GARDNASATTLVDPGRYSMLKSYS  100

>PHYCA_115729
Length=186

 Score = 29.6 bits (65),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  53   ATGARDSASATTFVLPGLYCTSKSNS  78
            A GA D ASATTFV PG +   KS S
Sbjct  105  AAGALDKASATTFVDPGRFSILKSYS  130

Lambda      K        H        a         alpha
   0.311    0.121    0.365    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3349237668

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40