Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_1046184085830830815010.0
PHYCA_1330194366829528610482e-143
PHYCA_112333416502852559803e-133
PHYCA_107546411572352149676e-132
PHYCA_70629392371811819425e-129
PHYCA_52016386881811819312e-127
PHYCA_40966380931811819313e-127
PHYCA_133758438462132139041e-122
PHYCA_110369414502132138735e-118
PHYRA_86391729877502459171e-117
PHYCA_133732438383772298852e-117
PHYCA_50840385681811818445e-114
PHYRA_8689638909203069046e-114
PHYCA_121828424892192138269e-111
PHYCA_70638392401791818081e-108
PHYCA_60922389381811818081e-108
PHYCA_80504396011801818053e-108
PHYCA_133835438672192137893e-105
PHYCA_70633392381811817811e-104
PHYRA_861657284612732918378e-102
PHYCA_80503396001811817612e-101
PHYCA_40967380941811817533e-100
PHYCA_80487395931871817213e-95
PHYCA_70614465511871817152e-94
PHYCA_70608392261871817074e-93
PHYCA_129115431091881816944e-91
PHYCA_115313419501851816934e-91
PHYCA_105784539431881816928e-91
PHYCA_60908389321871846892e-90
PHYCA_80489395951871816822e-89
PHYCA_105275409122952226897e-89
PHYCA_49690384661841816771e-88
PHYCA_40958380911871816771e-88
PHYCA_60918389371841816752e-88
PHYCA_60917499121841816743e-88
PHYCA_80492395971871866744e-88
PHYCA_70623392331841816734e-88
PHYCA_40968380951811816717e-88
PHYCA_70624392341841816711e-87
PHYCA_60904389291931936711e-87
PHYCA_70613392291871816711e-87
PHYCA_49682384621871816692e-87
PHYCA_50404385171501816652e-87
PHYCA_80488395941871826631e-86
PHYCA_70602392231871866632e-86
PHYCA_80490395961871816597e-86
PHYCA_60905389301921926554e-85
PHYCA_80493395981921926537e-85
PHYCA_70603471701871866441e-83
PHYCA_49688384641841816423e-83
PHYCA_49678384601781896394e-83
PHYCA_52408387481871816404e-83
PHYCA_70612392281871816405e-83
PHYCA_7059850411781896371e-82
PHYCA_52295387331871816362e-82
PHYCA_70627392361841816343e-82
PHYCA_42670382541751816333e-82
PHYCA_40959590991871816336e-82
PHYCA_49689384651841786327e-82
PHYCA_70617392311871866328e-82
PHYRA_783935729621632536914e-81
PHYCA_70610392271751866248e-81
PHYCA_103268407101961946251e-80
PHYCA_49680384611761816187e-80
PHYCA_70625392351841816171e-79
PHYCA_60900389281771836162e-79
PHYCA_51561386571871856172e-79
PHYCA_70604392251871856145e-79
PHYCA_60916389351841816127e-79
PHYCA_52423387501751856073e-78
PHYCA_52147387111661815933e-76
PHYCA_60907595191751855934e-76
PHYCA_49691384671401785792e-74
PITG_0595950411811845728e-73
PHYCA_133106436862951475793e-72
PHYCA_112785417032211355621e-70
PHYCA_52634387641581645472e-69
PHYCA_107793411831771775371e-67
PHYCA_53300388131181185276e-67
PHYCA_114654419051961965164e-64
PHYCA_112082416221961965164e-64
PPTG_11961219915832055445e-64
PHYCA_49686384631801815111e-63
PHYCA_133632438091821835102e-63
PHYCA_60914389331851815075e-63
PHYCA_119919423251821835023e-62
PHYCA_70621392321801814998e-62
PHYCA_121952424901941864954e-61
PHYCA_110684414901861834921e-60
PHYCA_131659433542412054962e-60
PHYSO_32778038903752055054e-60
PHYCA_116743420642471054944e-60
PHYCA_13318738903072054985e-60
PHYCA_108448412451941864851e-59
PHYCA_40785380821371074792e-59
PHYCA_102255405732711154861e-58
PHYCA_133316437292541074832e-58
PHYCA_40798380841371074713e-58
PHYCA_117161420932461074804e-58
PHYCA_42179381991371074681e-57
PHYCA_40787380831371074653e-57
PHYCA_131428433382541074753e-57
PHYCA_133093436842461074735e-57
PHYSO_491041380932331524665e-56
PHYCA_131662433552541074641e-55
PHYSO_526654395941911534582e-55
PHYCA_125154427271841834502e-54
PHYCA_70703473531261204401e-53
PHYRA_86556730964051614533e-52
PHYCA_408123808699994258e-52
PHYCA_129340431331931074348e-52
PHYCA_129900431791982174262e-50
PHYCA_70637392391661674162e-49
PHYCA_122305425191641954135e-49
PHYSO_520168595191771784136e-49
PHYCA_80433395911221344086e-49
PPTG_21901504110892364419e-48
PPTG_05705197101761513953e-46
PHYCA_132485435261931643921e-45
PHYCA_10456335962471243953e-45
PITG_0452138903121723863e-43
PHYCA_97812401752691513823e-43
PHYCA_131451433401661023692e-42
PHYCA_102147405622821713773e-42
PHYSO_375184539431471493653e-42
PHYCA_133010436641771613632e-41
PHYSO_513804590992061743643e-41
PHYCA_609293893976763446e-40
PYVX_2313838901301253434e-39
PHYCA_99042402831741043431e-38
PHYSO_320761499121241263373e-38
PHYCA_128371430441571513394e-38
PHYCA_40777380811361073305e-37
PHYSO_422151419051471473237e-36
PHYSO_372996538611531463239e-36
PHYCA_40454380691361073211e-35
PHYCA_113013417192161063243e-35
PHYSO_501270219912261503229e-35
PHYCA_49670384591361273122e-34
PHYCA_525633875792923013e-33
PHYSO_435623556581541532993e-32
PHYCA_133014436662101182861e-29
PITG_041023596255922882e-29
PHYRA_78588707013941892847e-28
PHYSO_471543565022131042694e-27
PHYCA_1012444045751512494e-26
PPTG_15814590996971172704e-25
PHYCA_101667404992151722502e-24
PHYCA_5126438619991172412e-24
PHYCA_13284143608216912493e-24
PHYRA_85713725803631852442e-22
PHYSO_257212465519521322448e-22
PPTG_2352428021156992252e-21
H257_033051396981891642263e-21
PHYSO_26201646885707852361e-20
PHYCA_10114940452227732189e-20
PPTG_2160426283148992023e-18
PHYSO_4343165558977781964e-18
PHYSO_4095295486573711876e-17
PYAR_22794104928760982067e-17
PHYSO_2886554764284841833e-16
PHYRA_82899398138212061988e-16
PHYSO_2845054717090841801e-15
PHYSO_48397157193170811832e-15
PYIW_248121646311961201834e-15
H257_033101397035261511881e-14
PITG_030252624118511732e-14
PHYCA_13327543722138561725e-14
PPTG_1934224656220601643e-12
PHYSO_32685250701260611566e-11
PHYRA_86947733566682141589e-11
PHYSO_2857754735385861395e-10
PHALS_12004347226402361464e-09
PHYRA_861305313623002291464e-09
PHYRA_825025266430612141448e-09
PHYRA_756027012613192071411e-08
PHYRA_78074357410982321393e-08
PITG_2036216015249391344e-08
PHYRA_85542724793041881354e-08
PHYRA_770657039810912211313e-07
PHYRA_770637039615742211304e-07
PPTG_244412884465541131e-06
PHYRA_85959529003902341251e-06
PHYSO_2473314575414601691252e-06
PHYRA_86797732646972281232e-06
PHYCA_1106764148913142111232e-06
H257_13890144501142611153e-06
PYU1_G015063977325801101223e-06
PYU1_G014831975488891101214e-06
PHYRA_86197728675282361196e-06
PHYRA_85544527603172751171e-05
PHYCA_133059436772481991151e-05
PHYRA_79389709063902341161e-05
PHYRA_87083734503952341152e-05
PHYRA_85739725919712311152e-05
PHYCA_419093817582751043e-05
PHYRA_858137262823922311153e-05
PHYRA_794675949913492211144e-05
PHYCA_116403420283111991124e-05
PHYRA_71960693783751661124e-05
PHYCA_111946416078532341135e-05
PHYCA_827783981369621006e-05
PHYRA_81147712726822301117e-05
PYU1_G01483297549529721117e-05
PHYRA_86012727433041901097e-05
PHYRA_86072518499132361101e-04
PHYRA_85955727153902341091e-04
PHYRA_85793588655012351091e-04
PHYRA_863647296913842361082e-04
PHYRA_74987700283061961053e-04
PHYRA_853737238511882281063e-04
PHYRA_78326706417422281054e-04
PHYRA_75588701186311371054e-04
PHYRA_796177097112402071064e-04
PHYRA_85651725418081921045e-04
PHYRA_86634731493742071035e-04
PHYRA_87161735082171901007e-04
PHYRA_843727206214292121047e-04
PHYRA_87789739965442341037e-04
PHYRA_74385199929952341038e-04
PHYRA_85899726816272051020.001
PHYRA_85442724195761111010.001
PHYRA_783504055811902371020.001
PHYKE_574576325159105960.001
PPTG_1709223798289197990.001
PYAR_25247106220329217990.001
PHYKE_708151849329143990.002
PHYRA_8750573772306196990.002
PHALS_144363577423893970.002
PHYSO_3418505290013541871000.002
PHYRA_8186671416265196970.002
PHYSO_26220046889957122990.003
PPTG_01238182376853870.004
PYIW_26681165971276221940.005
PHYRA_8727973589304196950.005
PHYRA_8518172304304169950.005
PHYRA_84637721271730104960.006
PHYRA_7399469793841117950.007
PHYRA_7438969912919137950.007
PPTG_16139166981002208930.011
PHYRA_8053871139114898930.014
PHYRA_723956946514479870.016
PHYRA_76817703581115224920.019
PHYCA_962363999122298890.020
CCA20400154451256197890.020
PHYRA_8598072726262110890.020
PHYCA_12330742581154108870.022
PHYCA_13129743330181153880.022
PYAR_23528105273275150890.022
PHYRA_740016979971086910.023
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_104618

Length=308
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_104618                                                          582        0.0   
PHYCA_133019                                                          408        2e-143
PHYCA_112333                                                          382        3e-133
PHYCA_107546                                                          377        6e-132
PHYCA_70629                                                           367        5e-129
PHYCA_52016                                                           363        2e-127
PHYCA_40966                                                           363        3e-127
PHYCA_133758                                                          352        1e-122
PHYCA_110369                                                          340        5e-118
PHYRA_86391                                                           357        1e-117
PHYCA_133732                                                          345        2e-117
PHYCA_50840                                                           329        5e-114
PHYRA_86896                                                           352        6e-114
PHYCA_121828                                                          322        9e-111
PHYCA_70638                                                           315        1e-108
PHYCA_60922                                                           315        1e-108
PHYCA_80504                                                           314        3e-108
PHYCA_133835                                                          308        3e-105
PHYCA_70633                                                           305        1e-104
PHYRA_86165                                                           327        8e-102
PHYCA_80503                                                           297        2e-101
PHYCA_40967                                                           294        3e-100
PHYCA_80487                                                           282        3e-95 
PHYCA_70614                                                           280        2e-94 
PHYCA_70608                                                           276        4e-93 
PHYCA_129115                                                          271        4e-91 
PHYCA_115313                                                          271        4e-91 
PHYCA_105784                                                          271        8e-91 
PHYCA_60908                                                           270        2e-90 
PHYCA_80489                                                           267        2e-89 
PHYCA_105275                                                          270        7e-89 
PHYCA_49690                                                           265        1e-88 
PHYCA_40958                                                           265        1e-88 
PHYCA_60918                                                           264        2e-88 
PHYCA_60917                                                           264        3e-88 
PHYCA_80492                                                           264        4e-88 
PHYCA_70623                                                           263        4e-88 
PHYCA_40968                                                           263        7e-88 
PHYCA_70624                                                           263        1e-87 
PHYCA_60904                                                           263        1e-87 
PHYCA_70613                                                           263        1e-87 
PHYCA_49682                                                           262        2e-87 
PHYCA_50404                                                           260        2e-87 
PHYCA_80488                                                           259        1e-86 
PHYCA_70602                                                           259        2e-86 
PHYCA_80490                                                           258        7e-86 
PHYCA_60905                                                           256        4e-85 
PHYCA_80493                                                           256        7e-85 
PHYCA_70603                                                           252        1e-83 
PHYCA_49688                                                           251        3e-83 
PHYCA_49678                                                           250        4e-83 
PHYCA_52408                                                           251        4e-83 
PHYCA_70612                                                           251        5e-83 
PHYCA_70598                                                           249        1e-82 
PHYCA_52295                                                           249        2e-82 
PHYCA_70627                                                           248        3e-82 
PHYCA_42670                                                           248        3e-82 
PHYCA_40959                                                           248        6e-82 
PHYCA_49689                                                           248        7e-82 
PHYCA_70617                                                           248        8e-82 
PHYRA_78393                                                           270        4e-81 
PHYCA_70610                                                           244        8e-81 
PHYCA_103268                                                          245        1e-80 
PHYCA_49680                                                           242        7e-80 
PHYCA_70625                                                           242        1e-79 
PHYCA_60900                                                           241        2e-79 
PHYCA_51561                                                           242        2e-79 
PHYCA_70604                                                           241        5e-79 
PHYCA_60916                                                           240        7e-79 
PHYCA_52423                                                           238        3e-78 
PHYCA_52147                                                           233        3e-76 
PHYCA_60907                                                           233        4e-76 
PHYCA_49691                                                           227        2e-74 
PITG_05959                                                            224        8e-73 
PHYCA_133106                                                          227        3e-72 
PHYCA_112785                                                          221        1e-70 
PHYCA_52634                                                           215        2e-69 
PHYCA_107793                                                          211        1e-67 
PHYCA_53300                                                           207        6e-67 
PHYCA_114654                                                          203        4e-64 
PHYCA_112082                                                          203        4e-64 
PPTG_11961                                                            214        5e-64 
PHYCA_49686                                                           201        1e-63 
PHYCA_133632                                                          201        2e-63 
PHYCA_60914                                                           199        5e-63 
PHYCA_119919                                                          197        3e-62 
PHYCA_70621                                                           196        8e-62 
PHYCA_121952                                                          195        4e-61 
PHYCA_110684                                                          194        1e-60 
PHYCA_131659                                                          195        2e-60 
PHYSO_327780                                                          199        4e-60 
PHYCA_116743                                                          194        4e-60 
PHYCA_133187                                                          196        5e-60 
PHYCA_108448                                                          191        1e-59 
PHYCA_40785                                                           189        2e-59 
PHYCA_102255                                                          191        1e-58 
PHYCA_133316                                                          190        2e-58 
PHYCA_40798                                                           186        3e-58 
PHYCA_117161                                                          189        4e-58 
PHYCA_42179                                                           184        1e-57 
PHYCA_40787                                                           183        3e-57 
PHYCA_131428                                                          187        3e-57 
PHYCA_133093                                                          186        5e-57 
PHYSO_491041                                                          184        5e-56 
PHYCA_131662                                                          183        1e-55 
PHYSO_526654                                                          181        2e-55 
PHYCA_125154                                                          177        2e-54 
PHYCA_70703                                                           174        1e-53 
PHYRA_86556                                                           179        3e-52 
PHYCA_40812                                                           168        8e-52 
PHYCA_129340                                                          171        8e-52 
PHYCA_129900                                                          168        2e-50 
PHYCA_70637                                                           164        2e-49 
PHYCA_122305                                                          163        5e-49 
PHYSO_520168                                                          163        6e-49 
PHYCA_80433                                                           161        6e-49 
PPTG_21901                                                            174        9e-48 
PPTG_05705                                                            156        3e-46 
PHYCA_132485                                                          155        1e-45 
PHYCA_104563                                                          156        3e-45 
PITG_04521                                                            153        3e-43 
PHYCA_97812                                                           151        3e-43 
PHYCA_131451                                                          146        2e-42 
PHYCA_102147                                                          149        3e-42 
PHYSO_375184                                                          145        3e-42 
PHYCA_133010                                                          144        2e-41 
PHYSO_513804                                                          144        3e-41 
PHYCA_60929                                                           137        6e-40 
PYVX_23138                                                            136        4e-39 
PHYCA_99042                                                           136        1e-38 
PHYSO_320761                                                          134        3e-38 
PHYCA_128371                                                          135        4e-38 
PHYCA_40777                                                           131        5e-37 
PHYSO_422151                                                          129        7e-36 
PHYSO_372996                                                          129        9e-36 
PHYCA_40454                                                           128        1e-35 
PHYCA_113013                                                          129        3e-35 
PHYSO_501270                                                          128        9e-35 
PHYCA_49670                                                           124        2e-34 
PHYCA_52563                                                           120        3e-33 
PHYSO_435623                                                          119        3e-32 
PHYCA_133014                                                          114        1e-29 
PITG_04102                                                            115        2e-29 
PHYRA_78588                                                           114        7e-28 
PHYSO_471543                                                          108        4e-27 
PHYCA_101244                                                          100        4e-26 
PPTG_15814                                                            108        4e-25 
PHYCA_101667                                                          100        2e-24 
PHYCA_51264                                                           97.4       2e-24 
PHYCA_132841                                                          100        3e-24 
PHYRA_85713                                                           98.6       2e-22 
PHYSO_257212                                                          98.6       8e-22 
PPTG_23524                                                            91.3       2e-21 
H257_03305                                                            91.7       3e-21 
PHYSO_262016                                                          95.5       1e-20 
PHYCA_101149                                                          88.6       9e-20 
PPTG_21604                                                            82.4       3e-18 
PHYSO_434316                                                          80.1       4e-18 
PHYSO_409529                                                          76.6       6e-17 
PYAR_22794                                                            84.0       7e-17 
PHYSO_288655                                                          75.1       3e-16 
PHYRA_82899                                                           80.9       8e-16 
PHYSO_284505                                                          73.9       1e-15 
PHYSO_483971                                                          75.1       2e-15 
PYIW_24812                                                            75.1       4e-15 
H257_03310                                                            77.0       1e-14 
PITG_03025                                                            71.2       2e-14 
PHYCA_133275                                                          70.9       5e-14 
PPTG_19342                                                            67.8       3e-12 
PHYSO_326852                                                          64.7       6e-11 
PHYRA_86947                                                           65.5       9e-11 
PHYSO_285775                                                          58.2       5e-10 
PHALS_12004                                                           60.8       4e-09 
PHYRA_86130                                                           60.8       4e-09 
PHYRA_82502                                                           60.1       8e-09 
PHYRA_75602                                                           58.9       1e-08 
PHYRA_78074                                                           58.2       3e-08 
PITG_20362                                                            56.2       4e-08 
PHYRA_85542                                                           56.6       4e-08 
PHYRA_77065                                                           55.1       3e-07 
PHYRA_77063                                                           54.7       4e-07 
PPTG_24441                                                            48.1       1e-06 
PHYRA_85959                                                           52.8       1e-06 
PHYSO_247331                                                          52.8       2e-06 
PHYRA_86797                                                           52.0       2e-06 
PHYCA_110676                                                          52.0       2e-06 
H257_13890                                                            48.9       3e-06 
PYU1_G015063                                                          51.6       3e-06 
PYU1_G014831                                                          51.2       4e-06 
PHYRA_86197                                                           50.4       6e-06 
PHYRA_85544                                                           49.7       1e-05 
PHYCA_133059                                                          48.9       1e-05 
PHYRA_79389                                                           49.3       1e-05 
PHYRA_87083                                                           48.9       2e-05 
PHYRA_85739                                                           48.9       2e-05 
PHYCA_41909                                                           44.7       3e-05 
PHYRA_85813                                                           48.9       3e-05 
PHYRA_79467                                                           48.5       4e-05 
PHYCA_116403                                                          47.8       4e-05 
PHYRA_71960                                                           47.8       4e-05 
PHYCA_111946                                                          48.1       5e-05 
PHYCA_82778                                                           43.1       6e-05 
PHYRA_81147                                                           47.4       7e-05 
PYU1_G014832                                                          47.4       7e-05 
PHYRA_86012                                                           46.6       7e-05 
PHYRA_86072                                                           47.0       1e-04 
PHYRA_85955                                                           46.6       1e-04 
PHYRA_85793                                                           46.6       1e-04 
PHYRA_86364                                                           46.2       2e-04 
PHYRA_74987                                                           45.1       3e-04 
PHYRA_85373                                                           45.4       3e-04 
PHYRA_78326                                                           45.1       4e-04 
PHYRA_75588                                                           45.1       4e-04 
PHYRA_79617                                                           45.4       4e-04 
PHYRA_85651                                                           44.7       5e-04 
PHYRA_86634                                                           44.3       5e-04 
PHYRA_87161                                                           43.1       7e-04 
PHYRA_84372                                                           44.7       7e-04 
PHYRA_87789                                                           44.3       7e-04 
PHYRA_74385                                                           44.3       8e-04 
PHYRA_85899                                                           43.9       0.001 
PHYRA_85442                                                           43.5       0.001 
PHYRA_78350                                                           43.9       0.001 
PHYKE_5745                                                            41.6       0.001 
PPTG_17092                                                            42.7       0.001 
PYAR_25247                                                            42.7       0.001 
PHYKE_7081                                                            42.7       0.002 
PHYRA_87505                                                           42.7       0.002 
PHALS_14436                                                           42.0       0.002 
PHYSO_341850                                                          43.1       0.002 
PHYRA_81866                                                           42.0       0.002 
PHYSO_262200                                                          42.7       0.003 
PPTG_01238                                                            38.1       0.004 
PYIW_26681                                                            40.8       0.005 
PHYRA_87279                                                           41.2       0.005 
PHYRA_85181                                                           41.2       0.005 
PHYRA_84637                                                           41.6       0.006 
PHYRA_73994                                                           41.2       0.007 
PHYRA_74389                                                           41.2       0.007 
PPTG_16139                                                            40.4       0.011 
PHYRA_80538                                                           40.4       0.014 
PHYRA_72395                                                           38.1       0.016 
PHYRA_76817                                                           40.0       0.019 
PHYCA_96236                                                           38.9       0.020 
CCA20400                                                              38.9       0.020 
PHYRA_85980                                                           38.9       0.020 
PHYCA_123307                                                          38.1       0.022 
PHYCA_131297                                                          38.5       0.022 
PYAR_23528                                                            38.9       0.022 
PHYRA_74001                                                           39.7       0.023 
PHYRA_85429                                                           39.7       0.025 
PPTG_24175                                                            39.7       0.026 
PHYRA_87740                                                           38.5       0.032 
CCA16047                                                              37.4       0.035 
PHYCA_110991                                                          38.5       0.035 
PHYRA_76607                                                           38.9       0.039 
PHYCA_39774                                                           37.7       0.042 
CCA27215                                                              38.5       0.043 
PPTG_20089                                                            37.7       0.043 
PHYRA_79115                                                           38.5       0.046 
PPTG_14641                                                            38.5       0.055 
PHYRA_86173                                                           38.5       0.057 
PPTG_21436                                                            37.0       0.065 
PHYCA_99277                                                           37.0       0.071 
H257_19342                                                            38.1       0.078 
PHYRA_77764                                                           37.7       0.084 
PHYCA_15242                                                           35.4       0.087 
PHYCA_40821                                                           35.4       0.11  
PHYRA_83101                                                           35.8       0.12  
PHYCA_113231                                                          35.8       0.14  
PHYRA_75416                                                           37.0       0.16  
H257_12059                                                            36.6       0.16  
PHYRA_86066                                                           36.2       0.20  
PYAP_25018                                                            35.0       0.27  
PHYRA_84458                                                           36.2       0.27  
PHYRA_86360                                                           35.8       0.29  
H257_13409                                                            35.8       0.30  
PHYRA_44857                                                           33.1       0.30  
PHYRA_40023                                                           33.1       0.30  
PYAR_21635                                                            35.8       0.31  
PYAR_20225                                                            35.4       0.32  
PHYRA_44594                                                           32.7       0.38  
PHYCA_81441                                                           33.1       0.44  
PHYRA_44262                                                           32.7       0.53  
PHALS_12211                                                           34.3       0.56  
PHALS_03390                                                           34.7       0.59  
HYAP_13638                                                            34.7       0.61  
PHYSO_510353                                                          34.7       0.61  
PPTG_11944                                                            34.7       0.70  
PITG_16448                                                            34.3       0.73  
CCA24320                                                              34.7       0.73  
PHYRA_50756                                                           32.3       0.78  
PHYRA_44886                                                           32.0       0.86  
PHYRA_85133                                                           34.3       0.88  
PHYCA_108861                                                          33.5       0.88  
PHYRA_39426                                                           32.0       0.91  
PHYRA_85680                                                           34.7       0.94  
PHYRA_78589                                                           33.9       0.96  
CCA26622                                                              33.9       0.98  
PHYRA_77067                                                           34.3       1.0   
PPTG_15775                                                            33.5       1.1   
PHYRA_50622                                                           31.6       1.1   
H310_13353                                                            33.9       1.1   
PHYCA_115299                                                          31.6       1.2   
PHYRA_41948                                                           31.6       1.2   
PHYRA_72441                                                           33.5       1.2   
PHYCA_132531                                                          32.0       1.2   
PHYRA_51301                                                           31.2       1.3   
PHYRA_54168                                                           31.6       1.4   
PHYRA_53926                                                           31.6       1.4   
PHYRA_50512                                                           31.6       1.4   
PHYRA_49774                                                           31.6       1.4   
PHYRA_44947                                                           31.6       1.4   
PHYRA_44863                                                           31.6       1.4   
PHYRA_42635                                                           31.6       1.4   
PHYRA_42288                                                           31.6       1.4   
PHYRA_41390                                                           31.6       1.4   
PPTG_22070                                                            33.9       1.4   
PHYRA_41873                                                           31.6       1.4   
PHYRA_44944                                                           31.6       1.4   
PHYRA_50984                                                           31.6       1.5   
PHYRA_41207                                                           31.6       1.5   
PHYRA_52793                                                           31.2       1.5   
PHYRA_44292                                                           31.6       1.5   
PHYRA_44623                                                           31.2       1.8   
PHYRA_54160                                                           31.2       1.8   
PHYRA_41432                                                           31.2       1.9   
PPTG_03251                                                            33.1       1.9   
PHYCA_43170                                                           30.8       1.9   
PPTG_18364                                                            32.7       1.9   
PHALS_03648                                                           32.7       1.9   
H257_09055                                                            33.5       2.0   
PHYRA_46282                                                           30.8       2.1   
PYIW_15328                                                            33.5       2.1   
CCI50317                                                              33.1       2.1   
PPTG_05849                                                            32.7       2.3   
PHYRA_39312                                                           31.2       2.5   
PHYCA_506883                                                          32.7       2.7   
PHYRA_53539                                                           30.8       2.8   
PHALS_08623                                                           32.7       2.9   
PHYRA_86672                                                           32.7       3.0   
PHYCA_123303                                                          32.0       3.1   
PHYRA_82871                                                           32.7       3.1   
PITG_05038                                                            32.7       3.2   
PHYCA_112243                                                          32.0       3.2   
PYVX_23864                                                            32.0       3.2   
PHYRA_87917                                                           32.7       3.3   
PHYRA_85763                                                           32.7       3.3   
PHYCA_549380                                                          32.7       3.5   
PHYSO_304898                                                          32.7       3.5   
H257_19399                                                            32.3       3.5   
PHYKE_9361                                                            32.3       3.6   
PHYRA_82685                                                           32.7       3.7   
PHYRA_48027                                                           31.2       3.8   
PHYRA_53878                                                           30.0       4.0   
PHYRA_86221                                                           32.3       4.2   
PHYRA_86621                                                           32.3       4.3   
H257_18324                                                            32.0       4.5   
PHYRA_42674                                                           29.3       4.5   
PHYRA_85268                                                           31.6       4.8   
PHYRA_74321                                                           32.3       4.9   
PHYRA_85204                                                           32.3       4.9   
PHYRA_42606                                                           30.0       4.9   
PHYCA_109468                                                          31.6       4.9   
PHYRA_49776                                                           30.4       4.9   
PYVX_19805                                                            32.3       4.9   
PHYCA_84056                                                           31.2       5.0   
PHYRA_73345                                                           32.0       5.1   
PHYRA_86107                                                           32.0       5.8   
PHYRA_85216                                                           32.0       5.8   
PPTG_15885                                                            30.8       5.9   
PPTG_17530                                                            31.6       5.9   
PHYRA_50440                                                           29.6       6.2   
PHYRA_87510                                                           31.2       6.2   
PHYKE_686                                                             31.6       6.3   
PHYRA_78799                                                           32.0       6.3   
PHYRA_87490                                                           32.0       6.3   
PHYRA_85993                                                           31.6       6.4   
PHYSO_515688                                                          31.2       6.4   
PHYCA_84903                                                           29.6       6.4   
PYAR_26649                                                            31.2       6.5   
PHYCA_127635                                                          31.2       6.7   
PYVX_15859                                                            31.6       6.8   
PYAR_20351                                                            31.6       7.2   
PHYRA_53688                                                           30.4       7.3   
PHYCA_132445                                                          31.2       7.7   
H257_18606                                                            31.2       8.3   
PYAR_25156                                                            30.4       8.4   
H310_14428                                                            31.6       8.7   
PHYRA_85740                                                           31.2       9.0   
PHYRA_45531                                                           28.5       9.2   
PHYSO_335121                                                          31.2       9.3   
PYAP_25323                                                            30.8       9.7   

>PHYCA_104618
Length=308

 Score = 582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/308 (100%), Positives = 308/308 (100%), Gaps = 0/308 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK
Sbjct  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR
Sbjct  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP
Sbjct  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTT  240
            RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTT
Sbjct  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTT  240

Query  241  ATDIVTELERENAGDNgehataaettsgtttasvhataavRGTKRSRETVANEEPTERTS  300
            ATDIVTELERENAGDNGEHATAAETTSGTTTASVHATAAVRGTKRSRETVANEEPTERTS
Sbjct  241  ATDIVTELERENAGDNGEHATAAETTSGTTTASVHATAAVRGTKRSRETVANEEPTERTS  300

Query  301  EVVVELRR  308
            EVVVELRR
Sbjct  301  EVVVELRR  308

>PHYCA_133019
Length=295

 Score = 408 bits (1048),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/286 (72%), Positives = 229/286 (80%), Gaps = 0/286 (0%)

Query  15   LTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRD  74
            +TDGA   TG  ++ELV LLQA+QTNPVPYRPQLVGL+ERFNRTWKD+V ISMN G QRD
Sbjct  1    MTDGALAFTGNFVKELVTLLQARQTNPVPYRPQLVGLIERFNRTWKDMVDISMNDGKQRD  60

Query  75   WDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQ  134
            WDRWVPFAVYAYNSGRHSTVAL PNELMMGRRLRSPNELLR T +R+AGEL+EYHR L++
Sbjct  61   WDRWVPFAVYAYNSGRHSTVALWPNELMMGRRLRSPNELLRATCRREAGELSEYHRNLIR  120

Query  135  TMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIG  194
            TMKESHA AECAREREQ RQ  YYER+VRQ + FKPGDHVWMF+ PRGP  SKFVH W+G
Sbjct  121  TMKESHAIAECAREREQERQRKYYERRVRQTKTFKPGDHVWMFRSPRGPGTSKFVHYWMG  180

Query  195  PLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTTATDIVTELERENAG  254
            P+R+IE AGYDN LLEREDGE+AERLIAHVSFLVSYH PADFL  TA DI   L  EN  
Sbjct  181  PMRIIEPAGYDNFLLEREDGEDAERLIAHVSFLVSYHRPADFLAVTAADIEAALNYENEQ  240

Query  255  DNgehataaettsgtttasvhataavRGTKRSRETVANEEPTERTS  300
            ++ EHA A  T +  TTA V+   A   TKR+R  V NE   +R S
Sbjct  241  NDNEHAAATSTITRATTAPVYEVTATASTKRTRRAVTNERTEDRAS  286

>PHYCA_112333
Length=285

 Score = 382 bits (980),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/255 (78%), Positives = 221/255 (87%), Gaps = 0/255 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M+++VLKFGPFRELLTDGAPELT  +IEELVELLQA QTNPVPYRPQLVGLVERFNRTWK
Sbjct  1    MREIVLKFGPFRELLTDGAPELTSHLIEELVELLQAHQTNPVPYRPQLVGLVERFNRTWK  60

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            DIVAISMN G+QRDWDRW+ FA       RHSTVAL PNELMMGRRLRSPNELLR TS+R
Sbjct  61   DIVAISMNAGEQRDWDRWISFACVCIQFWRHSTVALSPNELMMGRRLRSPNELLRATSRR  120

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            +AGEL+E H++L+Q M+ESHA AE AREREQ RQA YY RKV++KR FKPGD+VWMFKPP
Sbjct  121  EAGELSELHQKLVQAMRESHACAERAREREQERQARYYARKVKRKRDFKPGDYVWMFKPP  180

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTT  240
            RGPRASKFVHQW+GPLR+IE AG+D  LLEREDGE+A RLIAHVSFLVSYHHPADFL   
Sbjct  181  RGPRASKFVHQWMGPLRIIEPAGHDKFLLEREDGEDAVRLIAHVSFLVSYHHPADFLAAA  240

Query  241  ATDIVTELERENAGD  255
            A D+ +ELER+   D
Sbjct  241  AADLESELERDERSD  255

>PHYCA_107546
Length=235

 Score = 377 bits (967),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 195/214 (91%), Gaps = 0/214 (0%)

Query  15   LTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRD  74
            +TDGAPELTG++IEELV LLQA++TNPVPYRPQLVGLVERFNRTWKDIVAISMN G QRD
Sbjct  1    MTDGAPELTGKLIEELVILLQARKTNPVPYRPQLVGLVERFNRTWKDIVAISMNDGRQRD  60

Query  75   WDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQ  134
            WDRWV FAVYAYNSGRHSTVAL PNELMMG+RLRSPNELLR  S+R+AGEL+EYHR+L+ 
Sbjct  61   WDRWVSFAVYAYNSGRHSTVALSPNELMMGKRLRSPNELLRAASRREAGELDEYHRKLIS  120

Query  135  TMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIG  194
            TMKESHA AE AR REQ RQA YY RKVRQ + FKPGDHVWMF+PPRGP ASKFVHQW+G
Sbjct  121  TMKESHAIAERARGREQERQARYYTRKVRQTKTFKPGDHVWMFRPPRGPGASKFVHQWVG  180

Query  195  PLRVIEDAGYDNLLLEREDGENAERLIAHVSFLV  228
            PLR++E AGYDN LLEREDGE+AERL+AHVSFLV
Sbjct  181  PLRILEPAGYDNFLLEREDGEDAERLLAHVSFLV  214

>PHYCA_70629
Length=181

 Score = 367 bits (942),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS
Sbjct  1    LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGRRLRSPNELLR TSQR+AGELNEYHRRLLQTMKESHASAE AREREQA
Sbjct  61   TVALTPNELMMGRRLRSPNELLRATSQREAGELNEYHRRLLQTMKESHASAERAREREQA  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQASYYERKVR+KR FKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE
Sbjct  121  RQASYYERKVRRKRTFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_52016
Length=181

 Score = 363 bits (931),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS
Sbjct  1    LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL  NELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQT+KESHASAE AREREQA
Sbjct  61   TVALTHNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTIKESHASAERAREREQA  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQASYY+RKVR+KR FKPGDHVWMFKPPRGP+ASKFVHQWIGPLRVIEDAGYDNLLLERE
Sbjct  121  RQASYYKRKVRRKRTFKPGDHVWMFKPPRGPKASKFVHQWIGPLRVIEDAGYDNLLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_40966
Length=181

 Score = 363 bits (931),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS
Sbjct  1    LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGRRLRSPNELLR TSQR+AGELNEYHRRLLQTMKESH SAE AREREQA
Sbjct  61   TVALTPNELMMGRRLRSPNELLRATSQREAGELNEYHRRLLQTMKESHVSAERAREREQA  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQ SYYERKVR+KR FKPGDHVWMFKPPRGP+ASKFVHQWIGPLRVIEDAGYDNLLLERE
Sbjct  121  RQTSYYERKVRRKRTFKPGDHVWMFKPPRGPKASKFVHQWIGPLRVIEDAGYDNLLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_133758
Length=213

 Score = 352 bits (904),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 192/213 (90%), Gaps = 0/213 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M+DVVLKFGPFRELLTDGAPELT  +IEELVELLQA+QTNPVPYRPQLVGLVERFNRTWK
Sbjct  1    MRDVVLKFGPFRELLTDGAPELTSHLIEELVELLQARQTNPVPYRPQLVGLVERFNRTWK  60

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            DIVAI M+   QRDWDRWVPFAVYAYNSGRHSTVAL PNELMMGRRLRSPNELLR TS+R
Sbjct  61   DIVAILMSDEKQRDWDRWVPFAVYAYNSGRHSTVALSPNELMMGRRLRSPNELLRATSRR  120

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            ++GEL EYHR L+Q MKE+HA AE AREREQ RQ  YYERKVR+ R F+PGDHVW+F+PP
Sbjct  121  ESGELEEYHRDLVQAMKENHAYAERAREREQERQTKYYERKVRRTRTFRPGDHVWVFRPP  180

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLERED  213
            RGP ASKFVHQW+GPLRVIE AGYDN LLERED
Sbjct  181  RGPGASKFVHQWMGPLRVIEPAGYDNFLLERED  213

>PHYCA_110369
Length=213

 Score = 340 bits (873),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 181/213 (85%), Gaps = 0/213 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK VVLKFGPFRELLTDGAPELTGRVIEELV LLQAQQT PVPYRPQ+VGLVERFNRTWK
Sbjct  1    MKRVVLKFGPFRELLTDGAPELTGRVIEELVVLLQAQQTTPVPYRPQMVGLVERFNRTWK  60

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D+VA  +N   QRDWD+WV FAVYAYNSGRHSTVAL PNELMMGR+LRSPNELLR  S+ 
Sbjct  61   DMVATYINDELQRDWDQWVDFAVYAYNSGRHSTVALSPNELMMGRKLRSPNELLRAGSRT  120

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            +AGEL  +HRRL++ +K+ H  AE AREREQ RQA YY R  R KR FK  D VW++KPP
Sbjct  121  EAGELTTHHRRLVENLKKCHKHAEHAREREQQRQARYYNRMERHKRTFKVNDRVWVYKPP  180

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLERED  213
            RG +ASKFVHQW+GPLR++EDAGYDN +LERED
Sbjct  181  RGVKASKFVHQWLGPLRIVEDAGYDNFVLERED  213

>PHYRA_86391
Length=750

 Score = 357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/245 (69%), Positives = 196/245 (80%), Gaps = 1/245 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M+DVVLKFG FRELLTDGAPE+ G+VIE+LV LLQA+QTNPVPYRPQ++GLVERF+R+WK
Sbjct  383  MEDVVLKFGAFRELLTDGAPEIVGKVIEQLVVLLQAEQTNPVPYRPQMIGLVERFHRSWK  442

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D V+  M    Q DW+ WV FAVYAYNS RHSTVAL PNELMMGRRLR PNELLR T+  
Sbjct  443  DCVSTFMLSNVQNDWNLWVKFAVYAYNSARHSTVALTPNELMMGRRLRPPNELLRRTAVT  502

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            +AGEL  YH RLL  M+ SHA AE AR +EQARQA YY R+VRQKR F  GD VW++ PP
Sbjct  503  EAGELMPYHERLLLAMERSHACAEEARVKEQARQARYYNRRVRQKRTFAVGDRVWVYNPP  562

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENA-ERLIAHVSFLVSYHHPADFLTT  239
            RGP+A+KFVHQW GP+R++E AGY+N +LERED   A E LIAHVSFLVSYHHPA  L  
Sbjct  563  RGPKATKFVHQWQGPMRIVESAGYENFVLEREDKTGAPEVLIAHVSFLVSYHHPASLLRQ  622

Query  240  TATDI  244
             A D+
Sbjct  623  VAADL  627

>PHYCA_133732
Length=377

 Score = 345 bits (885),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 189/229 (83%), Gaps = 1/229 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK+++LKFGPF ELLTDGAPELTG+VIEELV LLQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  148  MKEIILKFGPFCELLTDGAPELTGKVIEELVRLLQAQQTNPVPYRPQMIGLVERFHRTWK  207

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D VA  M+   Q DWD WV FAVYAYNSG+HSTVAL PNELMMGR+LR+PNELLR T   
Sbjct  208  DCVATYMSNEQQCDWDNWVSFAVYAYNSGKHSTVALTPNELMMGRKLRTPNELLRRTHVT  267

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            +AG+L ++H +LL+T+KESH  AE AR REQ RQA YY RK R +  FKPGD VW+F+PP
Sbjct  268  EAGDLAKHHYKLLETLKESHECAEEARRREQDRQAKYYNRKTRSRCEFKPGDRVWVFRPP  327

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGEN-AERLIAHVSFLV  228
            RGP+ASKFVH WIGP ++IE AGYDN L+ RED +   E +IAHVSFLV
Sbjct  328  RGPKASKFVHSWIGPTKIIEPAGYDNFLIRREDLDGRGELIIAHVSFLV  376

>PHYCA_50840
Length=181

 Score = 329 bits (844),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 165/181 (91%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+QTNPVPYRPQLVGLVERFNRTWKD+VAISMN G QRDWDRWVPFAVYAYNSGRHS
Sbjct  1    LLQARQTNPVPYRPQLVGLVERFNRTWKDMVAISMNDGKQRDWDRWVPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGRRLRSPNELLR T +R+AGEL+EYHR L++ MKESHA AECAREREQ 
Sbjct  61   TVALSPNELMMGRRLRSPNELLRATCRREAGELSEYHRNLVRAMKESHAIAECAREREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQ  YYER+VRQ + FKPGDHVWMF+PPRGP ASKFVHQW+GPLR+IE AGYDN LLERE
Sbjct  121  RQRKYYERRVRQTKTFKPGDHVWMFRPPRGPGASKFVHQWMGPLRIIEPAGYDNFLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYRA_86896
Length=920

 Score = 352 bits (904),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 181/306 (59%), Positives = 216/306 (71%), Gaps = 1/306 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M++VVLKFG FRE+LTDGAPELTG+ IE+LV +LQA Q NPVPYRPQ++GLVERF+R+WK
Sbjct  554  MQEVVLKFGAFREILTDGAPELTGKTIEQLVLMLQANQINPVPYRPQMIGLVERFHRSWK  613

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D VA+ M    Q DW+ WV FAVYAYNS RHSTVAL PNELMMGRRLRSPN+LLR     
Sbjct  614  DCVALYMANERQNDWNLWVKFAVYAYNSARHSTVALSPNELMMGRRLRSPNDLLRRLEIT  673

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            +AGEL EYH +LL  M +SH  A  A  +EQ RQA YY R+V+Q R F PGD VW++ PP
Sbjct  674  EAGELTEYHEKLLAAMAKSHECAAKAMRKEQRRQARYYNRRVKQTREFSPGDRVWVYHPP  733

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENA-ERLIAHVSFLVSYHHPADFLTT  239
            RGP+A+KFVHQW+GP+RV+E +GY+N LL RED     E +IAHVSFLVSYH P   L  
Sbjct  734  RGPKATKFVHQWMGPMRVVESSGYENFLLRREDKSGVPETIIAHVSFLVSYHSPTQLLQR  793

Query  240  TATDIVTELERENAGDNgehataaettsgtttasvhataavRGTKRSRETVANEEPTERT  299
            TA DI  +LE EN  D  ++           TAS +A  A R  KR R TVAN     R+
Sbjct  794  TARDIEAQLEYENQVDEQQNEPTNRALVRAATASSNAATAGRREKRRRGTVANTNGDGRS  853

Query  300  SEVVVE  305
               +VE
Sbjct  854  DARLVE  859

>PHYCA_121828
Length=219

 Score = 322 bits (826),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 180/213 (85%), Gaps = 0/213 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK+++LKFGPFRELLTDGAPELTG+VIEELV LLQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  1    MKEIILKFGPFRELLTDGAPELTGKVIEELVRLLQAQQTNPVPYRPQMIGLVERFHRTWK  60

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D VA  M+   Q DWD WV FAVYAYNSG+HSTVAL PNELMMGR+LR+PNELLR T   
Sbjct  61   DCVATYMSNEQQCDWDNWVSFAVYAYNSGKHSTVALTPNELMMGRKLRTPNELLRRTHVT  120

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            +AGEL +YH +LL+TMKESH  AE AR REQ RQA YY RKVR +  FKPGD VW+F+PP
Sbjct  121  EAGELTKYHEKLLKTMKESHECAEEARRREQERQAKYYNRKVRSRCEFKPGDRVWVFRPP  180

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLERED  213
            RGP+ASKFVH WIGP ++IE AGYDN L+ RED
Sbjct  181  RGPKASKFVHSWIGPTKIIEPAGYDNFLIRRED  213

>PHYCA_70638
Length=179

 Score = 315 bits (808),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 163/181 (90%), Gaps = 2/181 (1%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+Q NPVPYRPQLVGLVERFNRTWKD+VAI MN G QRD  RWVPFAVYAYNSGRHS
Sbjct  1    LLQARQMNPVPYRPQLVGLVERFNRTWKDMVAIGMNGGKQRD--RWVPFAVYAYNSGRHS  58

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGRRLRSPNELL  T +R+AGEL+EYHR L++TMKESHA AECAREREQ 
Sbjct  59   TVALSPNELMMGRRLRSPNELLWATCRREAGELSEYHRNLIRTMKESHAIAECAREREQE  118

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQ+ YYER+VRQ +A+KPGDHVWMF+PPRGP ASKFVHQW+GPLR+IE AGYDN LLERE
Sbjct  119  RQSKYYERRVRQTKAYKPGDHVWMFRPPRGPGASKFVHQWMGPLRIIEPAGYDNFLLERE  178

Query  213  D  213
            D
Sbjct  179  D  179

>PHYCA_60922
Length=181

 Score = 315 bits (808),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 159/181 (88%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA QTNPVPYRPQLVGLVERFNRTWKDIVA  MN   QRDWDRW+PFAVYAYNSGRHS
Sbjct  1    LLQAHQTNPVPYRPQLVGLVERFNRTWKDIVATLMNDEKQRDWDRWIPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVA+ PNELMMGRRLRSPNELLR TS+R+ GEL++YHR L+Q MKESHA AE AREREQ 
Sbjct  61   TVAVSPNELMMGRRLRSPNELLRATSRRETGELSDYHRNLVQAMKESHACAEQAREREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQ  YYERKVR+ R FKPGDHVWM++PPRGP ASKFVHQW+GP+R+IE AGYD  LLERE
Sbjct  121  RQTKYYERKVRRTRTFKPGDHVWMYRPPRGPTASKFVHQWMGPMRIIEPAGYDKFLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_80504
Length=180

 Score = 314 bits (805),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 163/181 (90%), Gaps = 1/181 (1%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTNPVPYRPQLVGLVERFNRTWKDIVAISMN G+QRDWDRWVPFAVYAYNSGRHS
Sbjct  1    MLQARQTNPVPYRPQLVGLVERFNRTWKDIVAISMNDGEQRDWDRWVPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMM RRLRSPN +LR T++ +AGEL EYHR L +T+KESHA AE AREREQ 
Sbjct  61   TVALSPNELMMERRLRSPN-VLRATNREEAGELEEYHRTLTRTLKESHAIAERAREREQD  119

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQ  YYERKVR+ + FKPGDHVWMF+PPRGPRASKFVHQW+GPLR+IE AGYDN LLERE
Sbjct  120  RQTKYYERKVRRAKTFKPGDHVWMFRPPRGPRASKFVHQWMGPLRIIEPAGYDNFLLERE  179

Query  213  D  213
            D
Sbjct  180  D  180

>PHYCA_133835
Length=219

 Score = 308 bits (789),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 174/213 (82%), Gaps = 0/213 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK++VLKFGPFRELLTDGAPELTG+VIEELV LLQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  1    MKEIVLKFGPFRELLTDGAPELTGKVIEELVNLLQAQQTNPVPYRPQMIGLVERFHRTWK  60

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D VA  M+   Q DWD WV  AVYAYNSG+HSTVAL PNELMMGR+L++PNELLR T   
Sbjct  61   DCVATYMSDERQCDWDNWVNCAVYAYNSGKHSTVALTPNELMMGRKLKTPNELLRQTHVT  120

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            +A EL E+HR+LL+ +K  H  AE AR REQ RQ  YY RK ++   FKPGD VW+F+PP
Sbjct  121  EADELTEHHRKLLEALKAGHECAEEARRREQERQTKYYNRKTKKVSEFKPGDRVWVFRPP  180

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLERED  213
            RGP+ASKFVH WIGP +VIE AGYDN LL RED
Sbjct  181  RGPKASKFVHSWIGPTKVIEPAGYDNFLLRRED  213

>PHYCA_70633
Length=181

 Score = 305 bits (781),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 167/181 (92%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA QTNPVPYRPQLVGLVERFNRTWKDIVAISMN G+QRDWDRW+PFAVYAYNSGRHS
Sbjct  1    LLQAHQTNPVPYRPQLVGLVERFNRTWKDIVAISMNDGEQRDWDRWIPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGRRLRSPNELLR TS+R+AGEL+E H++L+Q M+ESHA AE AREREQ 
Sbjct  61   TVALSPNELMMGRRLRSPNELLRATSRREAGELSELHQKLVQAMRESHACAERAREREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RKV++KR FKPGD+VWMFKPPRGPRASKFVHQW+GPLR+IE AGYDN LLERE
Sbjct  121  RQARYYARKVKRKRDFKPGDYVWMFKPPRGPRASKFVHQWMGPLRIIEPAGYDNFLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYRA_86165
Length=1273

 Score = 327 bits (837),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 168/291 (58%), Positives = 209/291 (72%), Gaps = 2/291 (1%)

Query  1     MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
             MK+VVL+FGPFRELLTDGAPELTG+ IE+L+ LLQA Q NPVPYRPQ++GLVERF+RTWK
Sbjct  908   MKEVVLRFGPFRELLTDGAPELTGKAIEQLIVLLQANQINPVPYRPQMIGLVERFHRTWK  967

Query  61    DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
             D VA+ M    Q DW+ WV FAVYAYNS RHSTVAL PNEL MGR+LR+P  L+R T   
Sbjct  968   DCVAMYMADERQNDWEMWVRFAVYAYNSARHSTVALTPNEL-MGRKLRAPGVLMRQTEVS  1026

Query  121   DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
             +AGEL  YHR LL++M+ +   AE AR +EQARQA YY RK ++ R F  GD VW+F+PP
Sbjct  1027  EAGELLNYHRELLRSMERNREWAERARVKEQARQAKYYNRKAKRGREFHVGDRVWLFRPP  1086

Query  181   RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGE-NAERLIAHVSFLVSYHHPADFLTT  239
             RGP+A+KFVH W+GPLR+IE AGYDN ++ RED   + E  IAH SFL +YH  A++L  
Sbjct  1087  RGPKATKFVHPWMGPLRIIEPAGYDNFVVRREDKTGDQEEFIAHSSFLTTYHQSAEWLVQ  1146

Query  240   TATDIVTELERENAGDNgehataaettsgtttasvhataavRGTKRSRETV  290
              A D+  +L+ E+    G    A   +     A V+  AA + TKR R+TV
Sbjct  1147  AARDLAAQLDDESLAAEGNDGEAGRASIRAEAAPVNTAAARQSTKRGRKTV  1197

>PHYCA_80503
Length=181

 Score = 297 bits (761),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 162/181 (90%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQ +QTNPVPYRPQLVGLVERFNRTWKDI+AI M+   QRDWDRWVPFAVYAYNSGRHS
Sbjct  1    LLQVRQTNPVPYRPQLVGLVERFNRTWKDILAILMSDEKQRDWDRWVPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGRRLRSPNELLR TS+R+AGELNEYHR L+Q MKESHA AE AREREQ 
Sbjct  61   TVALSPNELMMGRRLRSPNELLRATSRREAGELNEYHRDLVQAMKESHAYAERAREREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQ  YYERKVR+ R F+PGDHVW+F+PPRGP ASKFVHQW+GPLRVIE AGYDN LLERE
Sbjct  121  RQTKYYERKVRRTRTFRPGDHVWVFRPPRGPGASKFVHQWMGPLRVIEPAGYDNFLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_40967
Length=181

 Score = 294 bits (753),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 161/181 (89%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+QTNPVPYRPQLVGLVERFNRTWKDI+AI M+   QRDWDRWVPFAVYAYNSGRHS
Sbjct  1    LLQARQTNPVPYRPQLVGLVERFNRTWKDILAILMSDEKQRDWDRWVPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGRRLRSPNELLR TS+R+AGELNEYHR L+  MKES A AE AREREQ 
Sbjct  61   TVALSPNELMMGRRLRSPNELLRATSRREAGELNEYHRDLVHAMKESQAYAERAREREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQ  YYERKVR+ R F+PGDHVW+F+PPRGP ASKFVHQW+GPLRVIE AGYDN LLERE
Sbjct  121  RQTKYYERKVRRTRTFRPGDHVWVFRPPRGPGASKFVHQWMGPLRVIEPAGYDNFLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_80487
Length=187

 Score = 282 bits (721),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPVPYRPQ++GLVERF+RTWKD VA  M+   Q DWD WV FAVY+YNSGRHS
Sbjct  1    LLQAQQTNPVPYRPQMIGLVERFHRTWKDCVATYMSDERQCDWDHWVDFAVYSYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +AGEL EYH +LL+TMKESH  A+ AR+REQ 
Sbjct  61   TVALTPNELMMGRKLRTPNELLRRTHVTEAGELTEYHEKLLKTMKESHKCADTARQREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RK ++   FKPGD VW+F+PPRGP+ASKFVH WIGP +++E AGYDN L+ RE
Sbjct  121  RQAKYYNRKTKKMYDFKPGDRVWVFRPPRGPKASKFVHSWIGPTKIVEPAGYDNFLIRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_70614
Length=187

 Score = 280 bits (715),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPVPYRPQ++GLVERF+RTWKD VA  M+   Q DWD WV FAVY+YNSG+HS
Sbjct  1    LLQAQQTNPVPYRPQMIGLVERFHRTWKDCVATYMSDERQCDWDHWVDFAVYSYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +AGEL EYH +LL+TMKESH  A+ AR+REQ 
Sbjct  61   TVALTPNELMMGRKLRTPNELLRRTHVTEAGELTEYHEKLLKTMKESHKCADTARQREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R+ ++   FKPGD VW+F+PPRGP+ASKFVH WIGP +++E AGYDN L+ RE
Sbjct  121  RQAKYYNRRTKKMYDFKPGDRVWVFRPPRGPKASKFVHSWIGPTKIVEPAGYDNFLIRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_70608
Length=187

 Score = 276 bits (707),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 148/181 (82%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQ TNPVPYRPQ++GLVERF+RTWKD VA  M+   Q DWD WV FAVY+YNSGRHS
Sbjct  1    LLQAQHTNPVPYRPQMIGLVERFHRTWKDCVATYMSDERQCDWDHWVDFAVYSYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +AGEL E+H +LL+TMKESH  A+ AR+REQ 
Sbjct  61   TVALTPNELMMGRKLRTPNELLRRTHVTEAGELTEHHEKLLKTMKESHKCADIARQREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R+ ++   FKPGD VW+F+PPRGP+ASKFVH WIGP +++E AGYDN L+ RE
Sbjct  121  RQAKYYNRRTKKMYDFKPGDRVWVFRPPRGPKASKFVHSWIGPTKIVEPAGYDNFLIRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_129115
Length=188

 Score = 271 bits (694),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 148/181 (82%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQT  VPYRPQ+VGLVERFNRT KDIVA  M + +QRDWDRWV FAVYAYNSG+HS
Sbjct  2    LLQAQQTTAVPYRPQMVGLVERFNRTRKDIVATYMQEENQRDWDRWVDFAVYAYNSGQHS  61

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLRSPN+LLR  S  +AGEL+EYH++++  MK S   AE AR +EQA
Sbjct  62   TVKLSPNELMMGRRLRSPNDLLRKMSVTEAGELSEYHKKMIAAMKSSLRCAEIARAKEQA  121

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY+R+VRQK+  + GD VWMF+PPRG  ASKFVHQW+GP+RV+E  GYDN L+ RE
Sbjct  122  RQARYYDRRVRQKKKLRAGDRVWMFRPPRGADASKFVHQWVGPMRVVEPVGYDNWLVRRE  181

Query  213  D  213
            D
Sbjct  182  D  182

>PHYCA_115313
Length=185

 Score = 271 bits (693),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 147/181 (81%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQAQQTNPVPYRPQ++GLVERF+RTWKD VA  M+   Q DWD WV FAVY+YNSGRHS
Sbjct  1    MLQAQQTNPVPYRPQMIGLVERFHRTWKDCVATYMSDERQCDWDNWVDFAVYSYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV+L PNELMMGR+LR+PNELLR T   +AGEL+EYH +LL+T++ SH  AE AR REQ 
Sbjct  61   TVSLSPNELMMGRKLRTPNELLRRTLVTEAGELSEYHEKLLKTLRRSHECAEEARRREQD  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RK ++   FKPGD VW+F+PPRGP+ASKFVH W GP +++E AGYDN LL RE
Sbjct  121  RQAKYYNRKSKKMNDFKPGDRVWVFRPPRGPKASKFVHSWFGPTKIVEPAGYDNFLLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_105784
Length=188

 Score = 271 bits (692),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 147/181 (81%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPV YRPQ++GLVERF+RTWKD VA  M+   Q DWD WV FAVY+YNSGRHS
Sbjct  2    LLQAQQTNPVQYRPQMIGLVERFHRTWKDCVATYMSDERQCDWDHWVDFAVYSYNSGRHS  61

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +AGEL  +H +LL+TMKESH  A+ AR+REQ 
Sbjct  62   TVALTPNELMMGRKLRTPNELLRRTHVTEAGELTGHHEKLLKTMKESHKCADIARQREQE  121

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R+ ++   FKPGD VW+F+PPRGP+ASK+VH WIGP +++E AGYDN L+ RE
Sbjct  122  RQAKYYNRRTKKVYDFKPGDRVWVFRPPRGPKASKYVHSWIGPTKIVEPAGYDNFLIRRE  181

Query  213  D  213
            D
Sbjct  182  D  182

>PHYCA_60908
Length=187

 Score = 270 bits (689),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 145/184 (79%), Gaps = 0/184 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQT  VPYRPQ+VGLVERFNRTWKDIVA  M    QRDWDRWV FAVYAYNSG+HS
Sbjct  1    LLQAQQTTAVPYRPQMVGLVERFNRTWKDIVATYMQDESQRDWDRWVDFAVYAYNSGQHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLRSPNELLR     +AGEL+EY+++L+ TM+ S   AE AR  EQ 
Sbjct  61   TVKLSPNELMMGRRLRSPNELLRKLQVTEAGELSEYYKKLVATMESSLRCAEVARANEQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY ++VRQKR  + GD VWMF+PPRG  ASKFVHQW+GP+RV+E  GYDN L+ RE
Sbjct  121  RQARYYNQRVRQKRKLRAGDRVWMFRPPRGADASKFVHQWVGPMRVVEPVGYDNWLVRRE  180

Query  213  DGEN  216
            D E 
Sbjct  181  DVEG  184

>PHYCA_80489
Length=187

 Score = 267 bits (682),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 143/181 (79%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            + QA+Q NPVPYRPQ+VGLVERF+RTWKD VA+ M    Q+DW+ WV FA YAYNS RHS
Sbjct  1    MAQAKQINPVPYRPQMVGLVERFHRTWKDCVAVFMQDESQKDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLR+PNELLR T   +AGEL+ YH RLL+ M+ S   AE AR REQ 
Sbjct  61   TVLLTPNELMMGRRLRAPNELLRRTEVTEAGELSTYHARLLEAMERSSKCAESARVREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY+R VR +R F  GD VWM+ PPRGPRA+KFVHQW+GPLR++E AGYDN LLERE
Sbjct  121  RQARYYDRNVRVRREFHVGDRVWMYNPPRGPRATKFVHQWMGPLRIVEPAGYDNFLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_105275
Length=295

 Score = 270 bits (689),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 159/222 (72%), Gaps = 1/222 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ++GLVERF+RTWKD VA+ M    Q+DW+ WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQMIGLVERFHRTWKDCVAVFMQDETQKDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLRSPNELLR T+  +AGEL EYH +LL  +  +    E AR REQ 
Sbjct  61   TVLLTPNELMMGRRLRSPNELLRRTAVTEAGELTEYHEKLLAAVTRAQQCVEQARAREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY+  VR +R FK GD V ++ P RGP+A+KFVHQW+GP+R++E  GYDN+ L+RE
Sbjct  121  RQARYYDWNVRNRREFKTGDRVSLYNPLRGPKATKFVHQWMGPMRILEPVGYDNVWLKRE  180

Query  213  DGENA-ERLIAHVSFLVSYHHPADFLTTTATDIVTELERENA  253
            D     E + AHVSFL SY+ P   L+  A DI  +L  E A
Sbjct  181  DQMGVPEEMTAHVSFLSSYYEPESPLSEIAADIGKQLRYEEA  222

>PHYCA_49690
Length=184

 Score = 265 bits (677),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 146/181 (81%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ+VGLVERF+RTWKD VA  MN   Q DWD WV FAVY+YNSG+HS
Sbjct  1    MLQAEQKNPVPYRPQMVGLVERFHRTWKDCVATYMNDERQCDWDNWVDFAVYSYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +AG+L EYH++L++ +++  A A  AREREQ 
Sbjct  61   TVALSPNELMMGRKLRTPNELLRATRVTEAGDLTEYHQKLVKALEDGVACANEAREREQQ  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY ++ RQ+R FK GD VWMF+PPRG +ASK VH WIGPLRV+E AG+DN LL RE
Sbjct  121  RQAKYYNKRTRQRREFKVGDRVWMFRPPRGAKASKLVHNWIGPLRVMEPAGFDNFLLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_40958
Length=187

 Score = 265 bits (677),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 142/181 (78%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            + QA+Q NPVPYRPQLVGLVERF+RTWKD VA+ M +  Q+DW+ WV FA YAYNS RHS
Sbjct  1    MAQAKQINPVPYRPQLVGLVERFHRTWKDCVAVFMQEESQKDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLR+PNELLR T   +AGEL+ YH RLL+ ++ S   AE AR REQ 
Sbjct  61   TVLLTPNELMMGRRLRAPNELLRRTEVTEAGELSAYHARLLEALERSRKCAELARTREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R  R +R F  GD VWM+ PPRGP+A+KFVHQW+GPLR++E AGYDN LLERE
Sbjct  121  RQARYYNRNARARREFHSGDRVWMYNPPRGPKATKFVHQWMGPLRIVEPAGYDNFLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_60918
Length=184

 Score = 264 bits (675),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 147/181 (81%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ+VGLVERF+RTWKD VA  MN   Q DWD WV FAVY+YNSG+HS
Sbjct  1    MLQAEQKNPVPYRPQMVGLVERFHRTWKDCVATYMNDERQCDWDNWVDFAVYSYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR TS  +AG+L EYH++L++ +++  A A+ AREREQ 
Sbjct  61   TVALSPNELMMGRKLRTPNELLRATSVTEAGDLTEYHQKLVKALEDGVACADEAREREQR  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R+ R++R FK GD VWMF+PPRG +ASK VH WIGPLRV+E AG+ N LL RE
Sbjct  121  RQAKYYNRRTRKRREFKVGDRVWMFRPPRGAKASKLVHNWIGPLRVMEPAGFGNFLLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_60917
Length=184

 Score = 264 bits (674),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 146/181 (81%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQAQQ NPVPYRPQ++GLVERF+RTWKD VA  MN   Q DWD WV FAVY+YNSG+HS
Sbjct  1    MLQAQQKNPVPYRPQMIGLVERFHRTWKDCVATYMNDERQCDWDNWVDFAVYSYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +AGEL E+H++L++T+K+    A+ AR REQ 
Sbjct  61   TVALSPNELMMGRKLRTPNELLRATHVTEAGELAEHHQKLMKTLKDGVRCADEARMREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R+ R++R F  GD VWM++PPRG +ASKFVH WIGPLRV+E AGYDN LL RE
Sbjct  121  RQARYYNRRTRKRREFVSGDKVWMYRPPRGAKASKFVHNWIGPLRVLEPAGYDNFLLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_80492
Length=187

 Score = 264 bits (674),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 0/186 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ++GLVERF+RTWKD VA+ M    Q DW+ WV FA YAYNS +HS
Sbjct  1    MLQARQINPVPYRPQMIGLVERFHRTWKDCVAVFMQDETQTDWNLWVKFATYAYNSAQHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGR+LR+PNELLR T  R+AGEL+ YH +LL+ MK S   AE AR REQ 
Sbjct  61   TVKLSPNELMMGRKLRAPNELLRRTEVREAGELSVYHEQLLEAMKRSSQCAEIARVREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA +Y R VR KR F+ GD VW++ PPRGP+A+KFVHQW+GPLR++E AGY+N LL+RE
Sbjct  121  RQARFYNRNVRNKREFQVGDRVWLYNPPRGPKATKFVHQWMGPLRIVEPAGYENFLLKRE  180

Query  213  DGENAE  218
            DG   E
Sbjct  181  DGLGKE  186

>PHYCA_70623
Length=184

 Score = 263 bits (673),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 145/181 (80%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ+VGLVERF+RTWKD VA  MN   Q DWD WV FAVY+YNSG+HS
Sbjct  1    MLQAEQKNPVPYRPQMVGLVERFHRTWKDCVATYMNDERQCDWDNWVDFAVYSYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +AG+L EYH++L++ +++    A  AREREQ 
Sbjct  61   TVALSPNELMMGRKLRTPNELLRATRVTEAGDLTEYHQKLVKALEDGITCANEAREREQQ  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY ++ RQ+R FK GD VWMF+PPRG +ASK VH WIGPLRV+E AG+DN LL RE
Sbjct  121  RQAKYYNKRTRQRREFKVGDRVWMFRPPRGAKASKLVHNWIGPLRVMEPAGFDNFLLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_40968
Length=181

 Score = 263 bits (671),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 147/181 (81%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ+VGLVERF+RTWKD V+I M   +Q+DW+ WV FAVYAYNS +HS
Sbjct  1    MLQARQINPVPYRPQMVGLVERFHRTWKDCVSIFMQDEEQKDWNLWVKFAVYAYNSAQHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGR+LR+PNELLR T   +AGEL+ YH RLL+ M+ S  SAE AR REQ 
Sbjct  61   TVKLSPNELMMGRKLRAPNELLRRTEVGEAGELSTYHERLLEAMERSRRSAEIARVREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA +Y R VR +R F+ GD VW++ PPRGPRA+KFVHQW+GPLR++E AGY+N LL+RE
Sbjct  121  RQAKFYNRNVRNRREFQIGDRVWLYNPPRGPRATKFVHQWMGPLRILEPAGYENFLLKRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_70624
Length=184

 Score = 263 bits (671),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 147/181 (81%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQAQQ NPVPYRPQ++GLVERF+RTWKD VA  M+   Q DWD WV FAVY+YNSG+HS
Sbjct  1    MLQAQQKNPVPYRPQMIGLVERFHRTWKDCVATYMSDERQCDWDNWVDFAVYSYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +AGEL E+H++L++ +K+    A+ AR+REQ 
Sbjct  61   TVALSPNELMMGRKLRTPNELLRATHVTEAGELTEHHQKLMKALKDGVRCADEARKREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY+R+ R++R F  GD VWM++PPRG +ASKFVH WIGPLRV+E AGYDN LL RE
Sbjct  121  RQARYYDRRTRKRREFVSGDKVWMYRPPRGAKASKFVHNWIGPLRVLEPAGYDNFLLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_60904
Length=193

 Score = 263 bits (671),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 152/193 (79%), Gaps = 1/193 (1%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ++GLVERF+RTWKD V++ M    Q+DW+ WV FA YAYNS +HS
Sbjct  1    MLQAKQINPVPYRPQMIGLVERFHRTWKDCVSVFMQDESQKDWNLWVKFAAYAYNSAQHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGR+LR+PNELLR T   +AG+L+EYH +LL+ +++    AE AR REQ 
Sbjct  61   TVKLSPNELMMGRKLRAPNELLRRTEVTEAGKLSEYHEKLLEALEQGRRCAEIARVREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA +Y R  R++R F+ GD VW+++PPRGPRA+KFVHQW+GPLR++E AGY+N LL+RE
Sbjct  121  RQAKFYNRNTRKRREFRAGDRVWLYQPPRGPRATKFVHQWVGPLRILEPAGYENYLLKRE  180

Query  213  DGENAER-LIAHV  224
            DG   E  LIAH 
Sbjct  181  DGLGQEETLIAHF  193

>PHYCA_70613
Length=187

 Score = 263 bits (671),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 143/181 (79%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPVPYRPQ++GLVERF+RTWKD VA+ M+   Q DWD WV FAVYA NSG+HS
Sbjct  1    LLQAQQTNPVPYRPQMIGLVERFHRTWKDCVAVYMSDERQCDWDSWVNFAVYANNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +A EL ++H  LL+T++ SH  AE AR REQ 
Sbjct  61   TVALTPNELMMGRKLRTPNELLRRTHVTEADELTKHHENLLKTLEVSHQCAEEARRREQD  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA Y  RK ++   FKPGD VW+F+PPRGP ASKFVH WIGP +VIE AGYDN LL RE
Sbjct  121  RQAKYCNRKTKKVSEFKPGDRVWVFRPPRGPTASKFVHSWIGPTKVIEPAGYDNFLLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_49682
Length=187

 Score = 262 bits (669),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 142/181 (78%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            + Q+ Q+NPVPYRPQ+VGLVERF+RTWKD VAI M    Q+DW+ WV FA YAYNS RHS
Sbjct  1    MAQSIQSNPVPYRPQMVGLVERFHRTWKDCVAIFMQDESQKDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLR+PNELLR T   +AGEL+ YH RLL+ M+ S   AE AR RE  
Sbjct  61   TVLLTPNELMMGRRLRAPNELLRRTEVTEAGELSTYHARLLEAMERSSKCAESARIREHE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY+R VR +R F  GD VWM+ PPRGPRA+KFVHQW+GPL+++E AGYDN LLERE
Sbjct  121  RQARYYDRNVRVRREFHVGDRVWMYNPPRGPRATKFVHQWMGPLKIVEPAGYDNFLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_50404
Length=150

 Score = 260 bits (665),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 139/181 (77%), Gaps = 31/181 (17%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+QTNPVPYRPQLVGLVERFNRTWKD+V ISMN G+QRDWDRWVPFAVYAYNSGRHS
Sbjct  1    LLQARQTNPVPYRPQLVGLVERFNRTWKDMVDISMNDGEQRDWDRWVPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGRRLRSPNELLR TS+                               Q 
Sbjct  61   TVALSPNELMMGRRLRSPNELLRATSR-------------------------------QE  89

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RKVR+ R F+PGDHVW+++PPRGP+ SKFVHQW+GPLRVIE AGYDNLLLERE
Sbjct  90   RQARYYNRKVRRTRTFEPGDHVWLYRPPRGPKVSKFVHQWMGPLRVIEPAGYDNLLLERE  149

Query  213  D  213
            D
Sbjct  150  D  150

>PHYCA_80488
Length=187

 Score = 259 bits (663),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 144/182 (79%), Gaps = 0/182 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+Q NPVPYRPQ+VGLVERF+RTWKD VA+ M    Q+DW+ WV FA YAYNS +HS
Sbjct  1    LLQARQINPVPYRPQMVGLVERFHRTWKDCVAVFMQDETQKDWNLWVKFAAYAYNSAQHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMM RRLR+PNELLR T   +AGEL+ YH RL+  M+ S   AE AR REQ 
Sbjct  61   TVKLSPNELMMERRLRAPNELLRRTKVTEAGELSVYHERLIAAMERSRRCAEVARLREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA +Y R VR++R F+ GD VW++ PPRGPRA+KFVHQW+GPLR++E AGY+N LL+RE
Sbjct  121  RQAKFYNRNVRKRREFRVGDRVWLYNPPRGPRATKFVHQWMGPLRILEPAGYENFLLKRE  180

Query  213  DG  214
            DG
Sbjct  181  DG  182

>PHYCA_70602
Length=187

 Score = 259 bits (663),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 148/186 (80%), Gaps = 0/186 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ++GLVERF+RTWKD VA+ M    Q+DW+ WV FA YAYNS +HS
Sbjct  1    MLQARQVNPVPYRPQMIGLVERFHRTWKDCVAVFMQDEMQKDWNLWVKFAAYAYNSAQHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGR+LR+PNELLR T   +AG+L+EYH +LL+ ++ S   AE AR REQ 
Sbjct  61   TVKLSPNELMMGRKLRAPNELLRRTEVTEAGKLSEYHEKLLEALERSRRCAEIARVREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA +Y R  R++R F+ GD VW+++PPRGPRA+KFVHQW+GPLR++E AGY+N LL+RE
Sbjct  121  RQAKFYNRNTRKRREFRVGDRVWLYQPPRGPRATKFVHQWVGPLRILEPAGYENYLLKRE  180

Query  213  DGENAE  218
            DG   E
Sbjct  181  DGLGQE  186

>PHYCA_80490
Length=187

 Score = 258 bits (659),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 141/181 (78%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ++GLVERF+RTWKD VA+ M    Q+DW+ WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQMIGLVERFHRTWKDCVAVLMQDETQKDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLRSPNELLR T+  +AGEL EYH +LL  M  +   AE AR REQ 
Sbjct  61   TVLLTPNELMMGRRLRSPNELLRRTAVTEAGELTEYHEKLLAAMTRAQQCAEQARAREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY+R VR +R FK GD VW++ PPRGP+A+KFVHQW+GP+R++E  GYDN  L+RE
Sbjct  121  RQARYYDRNVRNRREFKAGDRVWLYNPPRGPKATKFVHQWMGPMRILEPVGYDNFRLKRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_60905
Length=192

 Score = 256 bits (655),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 150/192 (78%), Gaps = 1/192 (1%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPVPYRPQ++GLVERF+RTWKD VA  MN   Q DW+ WV FAVY+YNSG+HS
Sbjct  1    LLQAQQTNPVPYRPQMIGLVERFHRTWKDCVATYMNDERQCDWNNWVDFAVYSYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T  ++AGEL EYHR LL TMK S   AE AR REQ 
Sbjct  61   TVALTPNELMMGRKLRTPNELLRRTHVKEAGELTEYHRTLLTTMKASQKCAEEARRREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R  ++   F PGD VW+F+PPRGP+ASKFVH WIGP ++IE AGYDN L+ RE
Sbjct  121  RQAKYYNRGTKRVHDFGPGDKVWVFRPPRGPKASKFVHSWIGPTKIIEPAGYDNFLIRRE  180

Query  213  DGEN-AERLIAH  223
            D +   E LIAH
Sbjct  181  DVDGRGELLIAH  192

>PHYCA_80493
Length=192

 Score = 256 bits (653),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 149/192 (78%), Gaps = 1/192 (1%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPVPYRPQ++GLVERF+RTWKD VA  MN   Q DWD WV FAVY+YNSG+HS
Sbjct  1    LLQAQQTNPVPYRPQMIGLVERFHRTWKDCVATYMNDERQCDWDNWVDFAVYSYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T  ++AGEL EYHR LL TMK S   AE AR REQ 
Sbjct  61   TVALTPNELMMGRKLRTPNELLRRTHVKEAGELTEYHRTLLATMKASRECAEEARRREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R  R+   F PGD VW+F+PPR P+ASKFVH WIGP ++IE AGYDN L+ RE
Sbjct  121  RQAKYYNRGTRRVHDFGPGDKVWVFRPPRAPKASKFVHSWIGPTKIIEPAGYDNFLIRRE  180

Query  213  DGEN-AERLIAH  223
            D +   E LIAH
Sbjct  181  DVDGRGELLIAH  192

>PHYCA_70603
Length=187

 Score = 252 bits (644),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 142/186 (76%), Gaps = 0/186 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ++GLVERF+RTWKD VA+ M    Q+DW+ WV FA YAYNS +HS
Sbjct  1    MLQAKQINPVPYRPQMIGLVERFHRTWKDCVAVFMQDETQKDWNLWVKFATYAYNSAQHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGR+L + NELLR T+  +AGEL EYH RLL  M+ S   AE AR REQ 
Sbjct  61   TVKLSPNELMMGRKLLALNELLRRTAVTEAGELPEYHERLLDAMERSRQCAEIARTREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA +Y R VR +R F+ GD VW++ P RGPRA+KFVHQW+GPL V+E AGY+N LL+RE
Sbjct  121  RQAKFYNRNVRNRREFRVGDKVWLYNPLRGPRATKFVHQWMGPLLVVEPAGYENYLLKRE  180

Query  213  DGENAE  218
            DG   E
Sbjct  181  DGLGQE  186

>PHYCA_49688
Length=184

 Score = 251 bits (642),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 144/181 (80%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQTNPVPYRPQ++GLVERF+RTWKD VA  M+   Q DWD WV FAVYAYNSG+HS
Sbjct  1    LLQAQQTNPVPYRPQMIGLVERFHRTWKDCVATYMSDERQCDWDNWVNFAVYAYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +AGEL +YH  LL+ +K SH  AE AR REQ 
Sbjct  61   TVALTPNELMMGRKLRTPNELLRRTHVTEAGELTDYHANLLKALKASHECAEEARRREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RK + K  FKPGD VW+F+PPRG +ASKFVH WIGP +++E AGYDN L+ RE
Sbjct  121  RQAKYYNRKTKSKCEFKPGDRVWVFRPPRGAKASKFVHSWIGPTKILEPAGYDNFLIRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_49678
Length=178

 Score = 250 bits (639),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 143/189 (76%), Gaps = 12/189 (6%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ++GLVERF+RTWKD             W+ WV FAVYAYNS +HS
Sbjct  1    MLQAKQINPVPYRPQMIGLVERFHRTWKDY------------WNLWVKFAVYAYNSAQHS  48

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGR+LR+PNELLR T   +AGEL+ YH+ LL+ M++S   AE AR REQ 
Sbjct  49   TVKLSPNELMMGRKLRAPNELLRRTELTEAGELSAYHQGLLEAMEQSRRCAEIARAREQT  108

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA +Y R VR+KR F+ GD VW++ PPRGPRA+KFVHQW+GPLR++E AGY+N LL+RE
Sbjct  109  RQAKFYNRNVRKKREFQVGDRVWLYNPPRGPRATKFVHQWMGPLRIVESAGYENFLLKRE  168

Query  213  DGENAERLI  221
            DG   E  I
Sbjct  169  DGSGKEEAI  177

>PHYCA_52408
Length=187

 Score = 251 bits (640),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 135/181 (75%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ +GLVERF+RTWKD VAI M    QRDW+ WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQTIGLVERFHRTWKDCVAIFMQDETQRDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLRSPNELLR T+  +AGEL  YH++LL  M  +   AE AR REQ 
Sbjct  61   TVLLTPNELMMGRRLRSPNELLRRTAMTEAGELTTYHKQLLAAMTRAQQCAEQARIREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R VR +R FK GD VW++ PPRG  A+KFVHQW+GPLR+ E  GYDN  L RE
Sbjct  121  RQARYYNRNVRNRREFKVGDRVWLYNPPRGQNATKFVHQWMGPLRIAEPVGYDNFRLIRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_70612
Length=187

 Score = 251 bits (640),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 138/181 (76%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA QTN V YRPQ++GLVERF+RTWKD V++ M    Q+DW+ WV FA+YAYNS RHS
Sbjct  1    MLQAHQTNAVAYRPQMIGLVERFHRTWKDCVSMFMQDEAQKDWNLWVRFALYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLR PNELLR TS  +AGEL  YH +LL  M  +   AE AR REQ 
Sbjct  61   TVLLTPNELMMGRRLRPPNELLRRTSVTEAGELTTYHEQLLAAMTRAQQCAEEARIREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY+RKVR +R FK GD VW++ PPRGP+A+KFVHQW+GP+R+ E  GYDN  L RE
Sbjct  121  RQARYYDRKVRNRREFKVGDRVWLYNPPRGPKATKFVHQWMGPMRIAEPVGYDNFRLVRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_70598
Length=178

 Score = 249 bits (637),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 143/189 (76%), Gaps = 12/189 (6%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ++GLVERF+RTWKD             W+ WV FAVYAYNS +HS
Sbjct  1    MLQAKQINPVPYRPQMIGLVERFHRTWKDY------------WNLWVKFAVYAYNSAQHS  48

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGR+LR+PNELLR T   +AGEL+ YH+ LL+ M++S   AE AR REQ 
Sbjct  49   TVKLSPNELMMGRKLRAPNELLRRTELTEAGELSAYHQGLLEAMEQSRRCAEIARAREQE  108

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA +Y R VR+KR F+ GD VW++ PPRGPRA+KFVHQW+GPLR++E AGY+N LL+RE
Sbjct  109  RQAKFYNRNVRKKREFRVGDRVWLYNPPRGPRATKFVHQWMGPLRILESAGYENFLLKRE  168

Query  213  DGENAERLI  221
            DG   E  I
Sbjct  169  DGSGKEEAI  177

>PHYCA_52295
Length=187

 Score = 249 bits (636),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 135/181 (75%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ +GLVERF+RTWKD VAI M    Q+DW+ WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQTIGLVERFHRTWKDCVAIFMQDETQKDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLRSPNELLR T+  +AGEL  YH++LL  M  +   AE AR REQ 
Sbjct  61   TVLLTPNELMMGRRLRSPNELLRRTAVTEAGELTTYHKQLLAAMTRAQQCAEQARVREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R VR +R FK GD VW++ PPRG  A+KFVHQW+GPLR+ E  GYDN  L RE
Sbjct  121  RQARYYNRNVRNRREFKVGDRVWLYNPPRGQNATKFVHQWMGPLRIAEPVGYDNFRLIRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_70627
Length=184

 Score = 248 bits (634),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 137/181 (76%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+QTN V YRPQ++GLVERF+RTWKD ++  M    QRDW+ WV FA YAYNS RHS
Sbjct  1    LLQARQTNAVAYRPQMIGLVERFHRTWKDCISTFMQDETQRDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELM+GR+LRSPNELLR T   +AGE+  YH +LL  M  +   AE AR REQ 
Sbjct  61   TVLLTPNELMLGRKLRSPNELLRRTEVTEAGEITAYHEQLLAAMARARQCAEQARVREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RKVR+ R F+ GD VW++ PPRGP+A+KFVHQW+GP+R++E  GYDN  L RE
Sbjct  121  RQARYYNRKVRKLREFQVGDRVWLYNPPRGPKATKFVHQWMGPMRIVEAVGYDNFRLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_42670
Length=175

 Score = 248 bits (633),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 136/181 (75%), Gaps = 12/181 (7%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            + QA+Q NPVPYRPQ+VGLVERF+RTWKD             W+ WV FA YAYNS RHS
Sbjct  1    MAQAKQINPVPYRPQMVGLVERFHRTWKDY------------WNLWVRFATYAYNSARHS  48

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLR+PNELLR T+  +AGEL EYH RLL+ M+ SH  AE AR REQ 
Sbjct  49   TVLLTPNELMMGRRLRAPNELLRRTAVTEAGELAEYHTRLLKAMERSHKCAELARVREQE  108

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R VR +R F  GD VW + PPRGP+A+KFVHQW+GPL++IE AGYDN LLERE
Sbjct  109  RQAKYYNRNVRAQREFHVGDRVWFYNPPRGPKATKFVHQWMGPLKIIEPAGYDNFLLERE  168

Query  213  D  213
            D
Sbjct  169  D  169

>PHYCA_40959
Length=187

 Score = 248 bits (633),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 136/181 (75%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            + Q +Q  PVPYRPQLVGLVERF+RTWKD VA+ M +G Q+DW+ WV FA YAYNS RHS
Sbjct  1    MAQVKQITPVPYRPQLVGLVERFHRTWKDCVAVFMPEGSQKDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLR+PNELLR T   +AGEL+ YH RLL+ ++ S   AE A+ REQ 
Sbjct  61   TVLLTPNELMMGRRLRAPNELLRRTEVTEAGELSTYHTRLLEALERSRKCAELAQTREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R  R +  F  GD  WM+ PPR P+A KFVHQW+ PLR++E AGYDN LLERE
Sbjct  121  RQARYYNRNPRARWEFHSGDREWMYNPPRSPKAPKFVHQWMRPLRIVETAGYDNFLLERE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_49689
Length=184

 Score = 248 bits (632),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 142/178 (80%), Gaps = 0/178 (0%)

Query  36   AQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVA  95
            AQQTNP+ YRPQ++GLVER +RTWKD VA  M+   Q DWD WV FAVYAYNSG+HSTVA
Sbjct  1    AQQTNPLRYRPQMIGLVERSHRTWKDCVATYMSNEQQCDWDNWVSFAVYAYNSGKHSTVA  60

Query  96   LIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQA  155
            L PNELMMGR+LR+PNELLR T   +AGEL +YH  LL+TMKESH  AE AR REQ RQA
Sbjct  61   LTPNELMMGRKLRTPNELLRRTHVTEAGELTKYHENLLKTMKESHECAEEARRREQERQA  120

Query  156  SYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERED  213
             YY RK R +  FKPGD VW+F+PPRGP+ASKFVH WIGP ++IE AGYDN L+ RED
Sbjct  121  KYYNRKARSRYEFKPGDRVWVFRPPRGPKASKFVHSWIGPTKIIEPAGYDNFLIRRED  178

>PHYCA_70617
Length=187

 Score = 248 bits (632),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 143/186 (77%), Gaps = 0/186 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +L A+Q NPVPYRPQ++G VER++RTWKD VA+ M    Q+DW+ WV FA YAYNS +HS
Sbjct  1    MLHAKQINPVPYRPQMIGFVERYHRTWKDCVAVFMQDETQKDWNLWVKFAAYAYNSAKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGR+LR+PNELLR T   +AG+L+EYH +LL+ +++    AE A+ REQ 
Sbjct  61   TVKLTPNELMMGRKLRAPNELLRRTEVTEAGKLSEYHEKLLEALEQGRRCAEIAQVREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA +Y R  R++R F+ GD VW ++PPRGPRA+KFVHQW+ PLR++E AGY+N LL+RE
Sbjct  121  RQAKFYNRNTRKRREFRAGDRVWSYQPPRGPRATKFVHQWVRPLRILEPAGYENYLLKRE  180

Query  213  DGENAE  218
             G   E
Sbjct  181  GGLGQE  186

>PHYRA_78393
Length=2163

 Score = 270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 172/253 (68%), Gaps = 3/253 (1%)

Query  1     MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
             M+ VVL +GP RE++ DGAPEL G V+E LV +LQA+Q  PVPYRP L+GLVERF+RTWK
Sbjct  1869  MEKVVLVYGPVREIVMDGAPELNGAVVEALVSMLQAKQITPVPYRPALLGLVERFHRTWK  1928

Query  61    DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
             D+VAI +++  Q DWDRW+  A YAYN  +HS     PNELMMGRRLR+PNELLR +   
Sbjct  1929  DMVAIYVSEA-QDDWDRWLSCAAYAYNGAKHSGTGFSPNELMMGRRLRAPNELLRSSGVT  1987

Query  121   DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
               G   ++ R L+  +  +  +A+ A  +EQ R+A YY+R+VRQ   F  GD VW+ +PP
Sbjct  1988  QVGAFADFERALVSNLARATTAAKKALVKEQQRRARYYDRRVRQSVVFDVGDRVWVLRPP  2047

Query  181   RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTT  240
             RG   +K  HQW GP R++EDAG+DN  + RED +  E ++ H SFLVS H P+D L   
Sbjct  2048  RGKGITKLSHQWDGPARIMEDAGFDNWRVVREDTD--EHMVVHCSFLVSSHCPSDSLGNV  2105

Query  241   ATDIVTELERENA  253
             A  I+ EL  E+A
Sbjct  2106  AERILKELAEEDA  2118

>PHYCA_70610
Length=175

 Score = 244 bits (624),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 140/186 (75%), Gaps = 12/186 (6%)

Query  36   AQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVA  95
            A+Q NPVPYRPQ++GLVERF+RTWKD             W+ WV FAVYAYNS +HSTV 
Sbjct  1    AKQINPVPYRPQMIGLVERFHRTWKDY------------WNLWVKFAVYAYNSAQHSTVK  48

Query  96   LIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQA  155
            L PNELMMGR+LR+PNELLR T   +AGEL+ YH+ LL+ M++S   AE AR REQ RQA
Sbjct  49   LSPNELMMGRKLRAPNELLRRTELTEAGELSAYHQGLLEAMEQSRRCAEIARAREQERQA  108

Query  156  SYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGE  215
             +Y R VR+KR F+ GD VW++ PPRGPRA+KFVHQW+GPLR++E AGY+N LL+REDG 
Sbjct  109  KFYNRNVRKKREFRVGDRVWLYNPPRGPRATKFVHQWMGPLRILESAGYENFLLKREDGS  168

Query  216  NAERLI  221
              E  I
Sbjct  169  GKEEAI  174

>PHYCA_103268
Length=196

 Score = 245 bits (625),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 141/194 (73%), Gaps = 13/194 (7%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ +GLVERF+RTWKD             W+ WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQTIGLVERFHRTWKDY------------WNLWVRFATYAYNSARHS  48

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLRSPNELLR T+  +AGEL EYH +LL  MK +   AE AR REQ 
Sbjct  49   TVLLTPNELMMGRRLRSPNELLRRTAVTEAGELTEYHEQLLAAMKRARQYAEQARVREQE  108

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R VR +R FK GD VW++ PPRGP+A+KFVHQW+GP++++E  GYDN  L+RE
Sbjct  109  RQARYYNRNVRSRREFKIGDRVWLYNPPRGPKATKFVHQWMGPMKIVEPVGYDNFRLKRE  168

Query  213  DGENA-ERLIAHVS  225
            D   A E +IAHVS
Sbjct  169  DKTGATEEVIAHVS  182

>PHYCA_49680
Length=176

 Score = 242 bits (618),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 136/181 (75%), Gaps = 11/181 (6%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQAQQ NPVPYRPQ++GLVERF+RTWKD VA  M           +  AVYAY+SG+HS
Sbjct  1    LLQAQQINPVPYRPQMIGLVERFHRTWKDCVATYM-----------MNCAVYAYDSGKHS  49

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNELMMGR+LR+PNELLR T   +A  L E+HR+LL+ +K  H  AE AR REQ 
Sbjct  50   TVALTPNELMMGRKLRTPNELLRQTHVTEADILTEHHRKLLKALKAGHECAEEARRREQD  109

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RK ++   FKPGD VW+F+PPRGP+ASKFVH WIGP +VIE AGYDN LL RE
Sbjct  110  RQAKYYNRKTKKVSKFKPGDRVWVFRPPRGPKASKFVHSWIGPTKVIEPAGYDNFLLRRE  169

Query  213  D  213
            D
Sbjct  170  D  170

>PHYCA_70625
Length=184

 Score = 242 bits (617),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 135/181 (75%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ++GLVERF+RTWKD ++  M    QRDW+ WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQMIGLVERFHRTWKDCISTFMQDETQRDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELM+GR+LRSPNELLR T   +AGE+  YH ++L  M  +   AE AR REQ 
Sbjct  61   TVLLTPNELMLGRKLRSPNELLRRTEVTEAGEITAYHEQMLAAMARAQQCAEQARVREQD  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RKVR+ R F+ GD VW++ PPR P+A+KFVHQW+GP+R++E  GYD   L RE
Sbjct  121  RQARYYNRKVRKLREFEVGDQVWLYNPPRAPKATKFVHQWMGPMRIMEPVGYDKFRLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_60900
Length=177

 Score = 241 bits (616),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 132/183 (72%), Gaps = 12/183 (7%)

Query  34   LQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHST  93
            +QA QT PVPYRPQ +GLVERF+RTWKD             WD WV FA YAYNSG HST
Sbjct  1    VQAHQTTPVPYRPQFIGLVERFHRTWKDY------------WDVWVDFATYAYNSGEHST  48

Query  94   VALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQAR  153
            V L PNELMMGR+LRSPNELLR     + G L EYHR+LL  MK S   AE AR++EQ R
Sbjct  49   VKLSPNELMMGRKLRSPNELLRAMRVTETGNLTEYHRKLLVAMKRSGECAEQARKQEQER  108

Query  154  QASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERED  213
            QA YY R+VR  R  KPG  VWM+KPPRG +ASKFVH WIGPLRV+E AGYDN ++ERED
Sbjct  109  QAKYYNRQVRNTREVKPGHRVWMYKPPRGAKASKFVHPWIGPLRVVEAAGYDNFVVERED  168

Query  214  GEN  216
             E+
Sbjct  169  TED  171

>PHYCA_51561
Length=187

 Score = 242 bits (617),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 140/185 (76%), Gaps = 0/185 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ++GLVERF+RTWKD +A  M    QRDW+ WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQMIGLVERFHRTWKDCIATFMQDETQRDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELM+GR+LRSPNELLR T   +AGE+  YH +LL  M ++   AE AR REQA
Sbjct  61   TVLLTPNELMLGRKLRSPNELLRRTEVTEAGEITAYHEQLLTAMAQAQQCAEQARVREQA  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RKVR+ R F+ GD VW++ PPRGP+A+KFVHQW+GP+RV+E  GYDN  L RE
Sbjct  121  RQARYYNRKVRKLREFEVGDQVWLYNPPRGPKATKFVHQWMGPMRVVEPVGYDNFRLRRE  180

Query  213  DGENA  217
            D   A
Sbjct  181  DQTGA  185

>PHYCA_70604
Length=187

 Score = 241 bits (614),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 140/185 (76%), Gaps = 0/185 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ++GLVERF+RTWKD ++  M    QRDW+ WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQMIGLVERFHRTWKDCISTFMQDETQRDWNLWVRFATYAYNSARHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELM+GR+LRSPNELLR T   +AGE+  YH +LL  M ++   AE AR REQA
Sbjct  61   TVLLTPNELMLGRKLRSPNELLRRTEVTEAGEITAYHEQLLTAMAQAQQCAEQARVREQA  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RKVR+ R F+ GD VW++ PPRGP+A+KFVHQW+GP+RV+E  GYDN  L RE
Sbjct  121  RQARYYNRKVRKLREFEVGDQVWLYNPPRGPKATKFVHQWMGPMRVVEPVGYDNFRLRRE  180

Query  213  DGENA  217
            D   A
Sbjct  181  DQTGA  185

>PHYCA_60916
Length=184

 Score = 240 bits (612),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 141/181 (78%), Gaps = 0/181 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQAQQ NPVPYRPQ++GLVERF+  WKD VA  MN   Q DWD WV FAVY+YNSG+HS
Sbjct  1    MLQAQQKNPVPYRPQMIGLVERFHHAWKDCVATYMNDERQCDWDNWVDFAVYSYNSGKHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TVAL PNEL +GR+LR+PNELLR T   +AGEL E+H+ LL+T+K+    A+ AR+REQ 
Sbjct  61   TVALSPNELTIGRKLRTPNELLRATHVTEAGELAEHHQNLLKTLKDGVRCADEARKREQE  120

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R+ R +R F  GD VWM++PPRG +ASKF H WIGPLRV+E AGYDN LL RE
Sbjct  121  RQARYYNRRTRNRREFVSGDKVWMYRPPRGAKASKFAHNWIGPLRVLEPAGYDNFLLRRE  180

Query  213  D  213
            D
Sbjct  181  D  181

>PHYCA_52423
Length=175

 Score = 238 bits (607),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 134/185 (72%), Gaps = 12/185 (6%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ +GLVERF+RTWKD             W+ WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQTIGLVERFHRTWKDY------------WNLWVRFATYAYNSARHS  48

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLRSPNELLR T+  +AGEL EYH +LL  M  +   AE AR REQA
Sbjct  49   TVLLTPNELMMGRRLRSPNELLRRTAVTEAGELTEYHEQLLAAMTRARQCAEQARMREQA  108

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R VR +R FK GD VW++ PPRGP+A+KFVHQW+GP++++E  GYDN  L+RE
Sbjct  109  RQARYYNRNVRSRREFKIGDRVWLYNPPRGPKATKFVHQWMGPMKIVEPVGYDNFRLKRE  168

Query  213  DGENA  217
            D   A
Sbjct  169  DKTGA  173

>PHYCA_52147
Length=166

 Score = 233 bits (593),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 131/181 (72%), Gaps = 21/181 (12%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQAQQTNPVPYRP ++GL                      DWD WV FAVY+YNSGRHS
Sbjct  1    MLQAQQTNPVPYRPHMIGLC---------------------DWDNWVDFAVYSYNSGRHS  39

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV+L PNELMMGR+LR+PNELLR T   +AGEL+EYH +LL+T++ SH  AE AR REQ 
Sbjct  40   TVSLSPNELMMGRKLRTPNELLRRTLVTEAGELSEYHEKLLKTLRRSHECAEEARRREQD  99

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY RK ++   FKPGD VW+F+PPRGP+ASKFVH W GP +++E AGYDN LL RE
Sbjct  100  RQAKYYNRKSKKMNDFKPGDRVWVFRPPRGPKASKFVHSWFGPTKIVEPAGYDNFLLRRE  159

Query  213  D  213
            D
Sbjct  160  D  160

>PHYCA_60907
Length=175

 Score = 233 bits (593),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 132/185 (71%), Gaps = 12/185 (6%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+QTN V YRPQ +GLVERF+RTWKD             WD WV FA YAYNS RHS
Sbjct  1    MLQARQTNAVAYRPQTIGLVERFHRTWKDY------------WDLWVRFATYAYNSARHS  48

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV L PNELMMGRRLRSPN+LLR T+  +AGEL EYH +LL  M  +   A  AR REQ 
Sbjct  49   TVLLTPNELMMGRRLRSPNDLLRRTAVTEAGELTEYHEQLLAAMTRARQCAGRARVREQE  108

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R VR +R FK GD VW++ PPRGP+A+KFVHQW+GP++++E  GYDN  L+RE
Sbjct  109  RQARYYNRNVRSRREFKIGDRVWLYNPPRGPKATKFVHQWMGPMKIVEPVGYDNFRLKRE  168

Query  213  DGENA  217
            D   A
Sbjct  169  DKTGA  173

>PHYCA_49691
Length=140

 Score = 227 bits (579),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 126/178 (71%), Gaps = 38/178 (21%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+QTNPVPYRPQLVGLVERFNRTWKD+V ISMN G+QRDWDRWVPFAVYAYNSGRHS
Sbjct  1    LLQARQTNPVPYRPQLVGLVERFNRTWKDMVDISMNDGEQRDWDRWVPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            T                                      L++TM E+   AE ARE EQ 
Sbjct  61   T--------------------------------------LVRTMTENRVCAERAREHEQE  82

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLE  210
            RQA YY RKVR+ R F+PGDHVW+++PPRGP+ASKFVHQW+GPLRVIE AGYDNLLLE
Sbjct  83   RQARYYNRKVRRTRTFEPGDHVWLYRPPRGPKASKFVHQWMGPLRVIEPAGYDNLLLE  140

>PITG_05959
Length=181

 Score = 224 bits (572),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 131/184 (71%), Gaps = 14/184 (8%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +LQA+Q NPVPYRPQ++GLVERF+RTWKD                W  FAVYAYNSG+H+
Sbjct  1    MLQAEQINPVPYRPQMIGLVERFHRTWKDYT--------------WFDFAVYAYNSGKHT  46

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            TV+L P ELMMGRRLR PNELLR  S  +AGEL  YH+RLL  M+ +HA AE  R REQ 
Sbjct  47   TVSLSPYELMMGRRLRPPNELLRQMSVSEAGELTAYHQRLLTAMQSAHACAEKTRRREQN  106

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            RQA YY R+V+ KR    GD VWMF  PRG + SKFVHQWIGP+R++E AGY+N L++ E
Sbjct  107  RQARYYVRRVKVKRLLNVGDRVWMFPSPRGRKTSKFVHQWIGPMRILEPAGYENNLVKCE  166

Query  213  DGEN  216
            D + 
Sbjct  167  DKDG  170

>PHYCA_133106
Length=295

 Score = 227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 123/147 (84%), Gaps = 0/147 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK VVLKFGPFRELLTDGAPELTG+VI+EL+ +LQAQQ NPVPYRPQ++GLVERF+RTWK
Sbjct  148  MKQVVLKFGPFRELLTDGAPELTGKVIDELMYMLQAQQKNPVPYRPQMIGLVERFHRTWK  207

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D VA  MN   Q DWD WV FAVY+YNSG+HSTVAL PNELMMGR+LR+PNELLR T   
Sbjct  208  DCVATYMNDEKQCDWDDWVDFAVYSYNSGKHSTVALSPNELMMGRKLRTPNELLRSTHVT  267

Query  121  DAGELNEYHRRLLQTMKESHASAECAR  147
            +AG+L EYHR+LL+ +K+    AE AR
Sbjct  268  EAGDLTEYHRKLLKALKDGMTCAEKAR  294

>PHYCA_112785
Length=221

 Score = 221 bits (562),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 119/135 (88%), Gaps = 0/135 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK++VL+FGPFRELLTDGAPELTG+VIEELV +LQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  87   MKEIVLRFGPFRELLTDGAPELTGKVIEELVSMLQAQQTNPVPYRPQMIGLVERFHRTWK  146

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D VA  M+   Q DWD WV FAVY+YNSGRHSTV+L PNELMMGR+LR+PNELLR T   
Sbjct  147  DCVATYMSDERQCDWDNWVDFAVYSYNSGRHSTVSLSPNELMMGRKLRTPNELLRRTHVT  206

Query  121  DAGELNEYHRRLLQT  135
            +AGEL+EYH +LL+T
Sbjct  207  EAGELSEYHEKLLRT  221

>PHYCA_52634
Length=158

 Score = 215 bits (547),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 121/164 (74%), Gaps = 12/164 (7%)

Query  50   GLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRS  109
            GLVERF+RTWKD             W+ WV FA YAYNS RHSTV L PNELMMGRRLRS
Sbjct  1    GLVERFHRTWKDY------------WNLWVRFATYAYNSARHSTVLLTPNELMMGRRLRS  48

Query  110  PNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFK  169
            PNELLR T+  +AGEL EYH +LL  MK +   AE AR REQARQA YY+R VR +R FK
Sbjct  49   PNELLRRTAVTEAGELTEYHEQLLAAMKRARQCAEQARMREQARQARYYDRNVRSRREFK  108

Query  170  PGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERED  213
             GD VW++ PPRGP+A+KFVHQW+GP++++E  GYDN  L+RED
Sbjct  109  IGDRVWLYNPPRGPKATKFVHQWMGPMKIVEPVGYDNFRLKRED  152

>PHYCA_107793
Length=177

 Score = 211 bits (537),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 128/177 (72%), Gaps = 1/177 (1%)

Query  37   QQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVAL  96
            +Q +PVPYRP L+GLVERF+RTWKD+VAI +++  Q DWD W+P A YAYN  RHS+   
Sbjct  2    KQISPVPYRPALLGLVERFHRTWKDMVAILVSEA-QDDWDAWLPCAAYAYNGARHSSTGY  60

Query  97   IPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQAS  156
             PNELMMGRRLRSPNELLRV      G+  EYH+RL++ + + + +A  A  ++Q R+ +
Sbjct  61   SPNELMMGRRLRSPNELLRVNGVTQVGKFAEYHQRLVRNLAKVNEAARIALAKDQRRREA  120

Query  157  YYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERED  213
            YY ++VRQ R F  GD VW+ KPP+G   +K  HQW+GP +V++DAGYDN  + RED
Sbjct  121  YYNKRVRQGRDFGEGDLVWVLKPPKGKGITKLAHQWVGPAKVVQDAGYDNWEVARED  177

>PHYCA_53300
Length=118

 Score = 207 bits (527),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 105/118 (89%), Gaps = 0/118 (0%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA QTNPVPYRPQLVGLVERFNRTWKDIVA  MN   QRDWDRW+PFAVYAYNSGRHS
Sbjct  1    LLQAHQTNPVPYRPQLVGLVERFNRTWKDIVATLMNDEKQRDWDRWIPFAVYAYNSGRHS  60

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECARERE  150
            TVA+ PNELMMGRRLRSPNELLR TS+R+ GEL++YHR L+Q MKESHA AE ARERE
Sbjct  61   TVAVSPNELMMGRRLRSPNELLRATSRRETGELSDYHRNLVQAMKESHACAEQARERE  118

>PHYCA_114654
Length=196

 Score = 203 bits (516),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 140/196 (71%), Gaps = 3/196 (2%)

Query  17   DGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWD  76
            DGA E   +V  EL+ LLQ +Q+ PVPYRP L+GLVERF+RTWKD++++ +++  Q DWD
Sbjct  2    DGAREFGSKVTAELLALLQTKQSTPVPYRPNLLGLVERFHRTWKDMISLYVDE-QQDDWD  60

Query  77   RWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLLQT  135
             ++P A+YAYNS RH+T    PNELMMGR+LR+P ELLR +  +     L+EYH  L+Q 
Sbjct  61   DFLPSALYAYNSSRHTTHGYQPNELMMGRKLRTPAELLRRSRLEFPHSTLDEYHEVLMQD  120

Query  136  MKESHASAECAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIG  194
            +K++   A  A E+EQARQA YY +R VR+   F+ G  VW+++P +GP  +KF H+W G
Sbjct  121  LKKAQELAAVALEKEQARQAMYYNQRNVRRGSKFRDGQLVWVYRPAKGPGITKFGHRWRG  180

Query  195  PLRVIEDAGYDNLLLE  210
            P +++E AGYDN L++
Sbjct  181  PGKIVEAAGYDNYLVQ  196

>PHYCA_112082
Length=196

 Score = 203 bits (516),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 140/196 (71%), Gaps = 3/196 (2%)

Query  17   DGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWD  76
            DGA E   +V  EL+ LLQ +Q+ PVPYRP L+GLVERF+RTWKD++++ +++  Q DWD
Sbjct  2    DGAREFGSKVTAELLALLQTKQSTPVPYRPNLLGLVERFHRTWKDMISLYVDE-QQDDWD  60

Query  77   RWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLLQT  135
             ++P A+YAYNS RH+T    PNELMMGR+LR+P ELLR +  +     L+EYH  L+Q 
Sbjct  61   DFLPSALYAYNSSRHTTHGYQPNELMMGRKLRTPAELLRRSRLEFPHSTLDEYHEVLMQD  120

Query  136  MKESHASAECAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIG  194
            +K++   A  A E+EQARQA YY +R VR+   F+ G  VW+++P +GP  +KF H+W G
Sbjct  121  LKKAQELAAVALEKEQARQAMYYNQRNVRRGSKFRDGQLVWVYRPAKGPGITKFGHRWRG  180

Query  195  PLRVIEDAGYDNLLLE  210
            P +++E AGYDN L++
Sbjct  181  PGKIVEAAGYDNYLVQ  196

>PPTG_11961
Length=583

 Score = 214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 143/205 (70%), Gaps = 3/205 (1%)

Query  48   LVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            L+GLVER+++ WKD+V++ + +  Q DWD W+P A YAYN  RH T    PNELMMGR+L
Sbjct  2    LLGLVERYHKVWKDMVSLYVRE-KQDDWDEWIPCAAYAYNGARHGTTGYSPNELMMGRQL  60

Query  108  RSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRA  167
            ++PNELLR ++  + G+  EYH+RL+  M+ +   A+ A +++Q R+  YY R+VR +  
Sbjct  61   KTPNELLRASAVEEIGDWTEYHQRLINQMERAAVLAKIALQQDQRRREHYYNRQVRCRTN  120

Query  168  FKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            FK G+ VW+ KPPRG   +K  HQW+GP ++ E+ G+DN L+ER+D +  E LI H SFL
Sbjct  121  FKTGELVWVLKPPRGKGVTKLAHQWVGPAKLAENVGFDNWLVERQDLQ--ESLIVHTSFL  178

Query  228  VSYHHPADFLTTTATDIVTELEREN  252
            VSY++P D L T A  I+TEL+ ++
Sbjct  179  VSYYYPKDRLGTLADRILTELDEDD  203

>PHYCA_49686
Length=180

 Score = 201 bits (511),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 1/181 (1%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+QT PV YRP L+GLVERF++ WKD+V+  + K  Q DWD W+P+A YAYN  RH 
Sbjct  1    LLQAKQTRPVAYRPMLLGLVERFHKVWKDMVSQYV-KEKQDDWDDWIPWAAYAYNGARHG  59

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            T    PNELMMGRRLRSPNELLRV+   +     EYH++L++ M  +   A+ A ER+Q 
Sbjct  60   TTGYSPNELMMGRRLRSPNELLRVSRVEEIRGWPEYHKKLVEHMATAATIAKEALERDQL  119

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            R+  YY ++VR +  FK GD  W+F+PPRG   +K  HQW+GP  ++ D G+DN L+ RE
Sbjct  120  RRERYYNQRVRNRVKFKLGDRAWIFRPPRGTGVTKLAHQWVGPAELMADVGFDNWLVIRE  179

Query  213  D  213
            D
Sbjct  180  D  180

>PHYCA_133632
Length=182

 Score = 201 bits (510),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 133/183 (73%), Gaps = 3/183 (2%)

Query  26   VIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYA  85
            +I EL+ L+Q +Q+ PVPYRP L+GLVERF+RTWKD++++ +N+  Q DWD ++P A+YA
Sbjct  1    MIAELLVLMQTKQSTPVPYRPNLLGLVERFHRTWKDMISLYVNEL-QDDWDEFLPAALYA  59

Query  86   YNSGRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLLQTMKESHASAE  144
            YNS +H+T    PNELMMGR+LR+P ELLR    +     L+EYH  LLQ +K++   A 
Sbjct  60   YNSAKHATHGYQPNELMMGRKLRTPAELLRRNRLEHPYQTLDEYHEVLLQDLKQAQELAA  119

Query  145  CAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAG  203
             A ++EQARQA YY  R VRQ+  F+PG  VWM++P RGP  +KF H+W GP +++E AG
Sbjct  120  VALQKEQARQAIYYNHRNVRQRSEFRPGQLVWMYRPARGPGITKFGHRWRGPAKIVEAAG  179

Query  204  YDN  206
            YDN
Sbjct  180  YDN  182

>PHYCA_60914
Length=185

 Score = 199 bits (507),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 125/181 (69%), Gaps = 1/181 (1%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+QT PV YRP L+GLVERF++ WKD+V+  + +  Q DWD WVP+A YAYN  RH 
Sbjct  1    LLQAKQTRPVAYRPMLLGLVERFHKVWKDMVSQYVEE-KQGDWDDWVPWAAYAYNGARHG  59

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            T    PNELMMGRRLRSPNELLRV+   +     EYH++L++ M  +   A+ A  ++Q 
Sbjct  60   TTGYSPNELMMGRRLRSPNELLRVSRVEEIQGWPEYHQKLVEHMAAASTIAKEALAKDQF  119

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            R+  YY +KVR +  F+ GD  W+F+PPRG   +K  HQW+GP ++I D G+DN ++ RE
Sbjct  120  RRERYYNQKVRNRVHFRVGDRAWVFRPPRGTGVTKLAHQWVGPAKLIADVGFDNWMVARE  179

Query  213  D  213
            D
Sbjct  180  D  180

>PHYCA_119919
Length=182

 Score = 197 bits (502),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 132/183 (72%), Gaps = 3/183 (2%)

Query  26   VIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYA  85
            +I EL+ L+Q +Q+ PVPYRP L+GLVERF+RTWKD++++ +N+  Q DWD ++P A+YA
Sbjct  1    MIAELLVLMQTKQSTPVPYRPNLLGLVERFHRTWKDMISLYVNE-LQDDWDEFLPAALYA  59

Query  86   YNSGRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLLQTMKESHASAE  144
            YNS +H+T    PNELMMGR+LR+P ELLR    +     L+EYH  LLQ +K++   A 
Sbjct  60   YNSAKHATHGYQPNELMMGRKLRTPAELLRRNRLEHPYQTLDEYHEVLLQDLKQAQELAA  119

Query  145  CAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAG  203
             A ++EQARQA YY  R VR+   F+PG  VWM++P RGP  +KF H+W GP +++E AG
Sbjct  120  VALQKEQARQAIYYNHRNVRRGSEFRPGQLVWMYRPARGPGITKFGHRWRGPAKIVEAAG  179

Query  204  YDN  206
            YDN
Sbjct  180  YDN  182

>PHYCA_70621
Length=180

 Score = 196 bits (499),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 124/181 (69%), Gaps = 1/181 (1%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            LLQA+QT PV YRP L+GLVERF++ WKD+V+  + K  Q DWD W+P+A YAYN  RH 
Sbjct  1    LLQAKQTRPVAYRPMLLGLVERFHKVWKDMVSQYV-KEKQDDWDDWIPWAAYAYNGARHG  59

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQA  152
            T    PNELMMGRRLRSPNELLRV+   +     EYH++L++ +  +   A  A ER+Q 
Sbjct  60   TTGYSPNELMMGRRLRSPNELLRVSRVEEIQGWPEYHKKLVEHLAAAATIAREALERDQL  119

Query  153  RQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERE  212
            R+  YY ++VR +  FK GD  W+F+PPRG   +K  HQW+GP  ++ D G+DN L+ RE
Sbjct  120  RRERYYNQRVRDRVKFKVGDRAWIFRPPRGTGVTKLAHQWVGPAELMADVGFDNWLVRRE  179

Query  213  D  213
            D
Sbjct  180  D  180

>PHYCA_121952
Length=194

 Score = 195 bits (495),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 136/186 (73%), Gaps = 3/186 (2%)

Query  26   VIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYA  85
            +I EL++L+Q++++ PVPYRP L+GLVERF+RTWKD++++ +++  Q DWD ++P A+YA
Sbjct  1    MITELLQLMQSKKSTPVPYRPNLLGLVERFHRTWKDMISLYVDE-KQDDWDEFLPSALYA  59

Query  86   YNSGRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLLQTMKESHASAE  144
            YNS +H+T    PNELMMGR+LR+P ELLR +  +    +L  YH  L+  +K++   A 
Sbjct  60   YNSAKHATHGFQPNELMMGRKLRTPAELLRRSRLEYPHQDLETYHEALIDDLKKAQELAA  119

Query  145  CAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAG  203
             A ++EQARQA YY  R VR+K  F+ G  VW+++P RGP  +KF H+W GP +++EDAG
Sbjct  120  LALQKEQARQAMYYNHRNVRKKSEFRIGQLVWVYRPARGPGITKFGHRWRGPAKILEDAG  179

Query  204  YDNLLL  209
            YDN L+
Sbjct  180  YDNYLV  185

>PHYCA_110684
Length=186

 Score = 194 bits (492),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 134/183 (73%), Gaps = 3/183 (2%)

Query  29   ELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNS  88
            EL+ L+Q +Q+ PVPYRP L+GLVERF+RTWKD++++ +++  Q DWD ++P A+YAYNS
Sbjct  4    ELLALMQTKQSTPVPYRPNLLGLVERFHRTWKDMISLYVDE-TQDDWDDFLPCALYAYNS  62

Query  89   GRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLLQTMKESHASAECAR  147
             +H+T    PNELMMGR+LR P ELLR +  +     L++YH  LL+ ++++   AE A 
Sbjct  63   AKHATHGYQPNELMMGRKLRMPAELLRRSRLEYPHQTLDKYHEILLKDLQKAQELAEVAL  122

Query  148  EREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDN  206
            ++EQARQA YY +R VRQK  F+P   VW+++P RGP  +KF H+W GP +VIE +GYDN
Sbjct  123  QKEQARQAIYYNQRNVRQKSVFRPTQLVWLYRPARGPGITKFGHRWRGPAQVIEASGYDN  182

Query  207  LLL  209
             L+
Sbjct  183  YLV  185

>PHYCA_131659
Length=241

 Score = 195 bits (496),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 140/205 (68%), Gaps = 1/205 (0%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGR+LR+PNELLR T   +AG+L EYHR+LL+ +K+  A AE ARE EQ RQA YY R+ 
Sbjct  1    MGRKLRTPNELLRSTHVTEAGDLTEYHRKLLKALKDGMACAEKAREHEQKRQAKYYNRRT  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGEN-AERLI  221
            R++R F  GD VWM++PPRG +ASK VH WIGPLRVIE AG+DN LL RED +   E +I
Sbjct  61   RKRREFVSGDKVWMYRPPRGAKASKLVHNWIGPLRVIEPAGFDNFLLRREDQDGPGELII  120

Query  222  AHVSFLVSYHHPADFLTTTATDIVTELERENAGDNgehataaettsgtttasvhataavR  281
            A+VSFLV+YH+P ++L+  A DIV ELE E+  +   +A       GTTTA V+   A  
Sbjct  121  AYVSFLVAYHYPVEYLSKVADDIVNELEDESEFERTSNAETTREMVGTTTAPVNTATAGG  180

Query  282  GTKRSRETVANEEPTERTSEVVVEL  306
             TKR+   V++    E+  E +VEL
Sbjct  181  TTKRTVRAVSSTREFEQQCEPMVEL  205

>PHYSO_327780
Length=375

 Score = 199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 136/205 (66%), Gaps = 1/205 (0%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MG +LRSPNELLR TS  +AGEL +YH RLL  +  S   AE AREREQ RQA YY R+V
Sbjct  1    MGSKLRSPNELLRRTSVAEAGELTKYHERLLAALASSQRYAEQAREREQLRQARYYNRRV  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGEN-AERLI  221
            +Q+R F+ GD VWM++PPRGP+ASKFVHQWIGP+++IE AGYDN L+ERED     E+ +
Sbjct  61   KQRRTFEAGDRVWMYRPPRGPKASKFVHQWIGPMKIIEPAGYDNYLIEREDKSGECEQFV  120

Query  222  AHVSFLVSYHHPADFLTTTATDIVTELERENAGDNgehataaettsgtttasvhataavR  281
            AHVSFLV+Y +PA+ L   A D+  +LE E A      A  A  T G T+A   A  A  
Sbjct  121  AHVSFLVTYRYPAELLRDVAADLEAQLEHEGAFQREGDAATAGETVGATSAPARAATAGH  180

Query  282  GTKRSRETVANEEPTERTSEVVVEL  306
            G KR    VA+   +    E++VEL
Sbjct  181  GKKRDGRAVASASESRLQDELLVEL  205

>PHYCA_116743
Length=247

 Score = 194 bits (494),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M+ VVLKFGPFRELLTDGAPELTG +IE+LVELLQA QTNPVPYRPQLVGLVERFNRTWK
Sbjct  143  MRQVVLKFGPFRELLTDGAPELTGHLIEKLVELLQAHQTNPVPYRPQLVGLVERFNRTWK  202

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGR  105
            DIVA  MN   QRDWDRW+PFAVYAYNSGRHSTVA+ PNELMMGR
Sbjct  203  DIVATLMNDEKQRDWDRWIPFAVYAYNSGRHSTVAVSPNELMMGR  247

>PHYCA_133187
Length=307

 Score = 196 bits (498),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 139/205 (68%), Gaps = 1/205 (0%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGR+LR+PN LLR T   +AGEL E+H++LL+T+K+    A+ AR+REQ RQA YY R+ 
Sbjct  1    MGRKLRTPNALLRATHVTEAGELAEHHQKLLKTLKDGVRCADEARKREQERQARYYNRRT  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGEN-AERLI  221
            R++R F  GD VWM++PPRG +ASKFVH WIGPLRV+E AGYDN LL RED     E +I
Sbjct  61   RKRREFVSGDKVWMYRPPRGAKASKFVHNWIGPLRVLEPAGYDNFLLRREDQYGVGELII  120

Query  222  AHVSFLVSYHHPADFLTTTATDIVTELERENAGDNgehataaettsgtttasvhataavR  281
            AHVSFLV+YH+PA+ L   A D+V ELE E A +    A  +  T   TTA V+   A R
Sbjct  121  AHVSFLVAYHYPAEHLAKVAEDLVDELEDEGATERTADAETSLETVEATTAHVNTATARR  180

Query  282  GTKRSRETVANEEPTERTSEVVVEL  306
              KR+   V+N   +E+   ++VEL
Sbjct  181  TGKRTERAVSNPNESEQQCSIMVEL  205

>PHYCA_108448
Length=194

 Score = 191 bits (485),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 135/186 (73%), Gaps = 3/186 (2%)

Query  26   VIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYA  85
            +I EL++L+Q++++ PVPYRP L+GLVERF+RTWKD++++ +++  Q DWD ++P A+YA
Sbjct  1    MITELLQLMQSKKSTPVPYRPNLLGLVERFHRTWKDMISLYVDE-KQDDWDEFLPSALYA  59

Query  86   YNSGRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLLQTMKESHASAE  144
            YNS +H+T    PNELMMGR+LR+P ELLR +  +     L  YH  L++ + ++   A 
Sbjct  60   YNSSKHATHGYQPNELMMGRKLRTPAELLRRSRLEYPHSNLETYHEALIEDLTKAQELAA  119

Query  145  CAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAG  203
             A ++EQARQA YY  R VR+K  F+ G  VW+++P RGP  +KF H+W GP +++E+AG
Sbjct  120  LALQKEQARQAMYYNHRNVRKKTEFRIGQLVWVYRPARGPGITKFGHRWRGPAKIMEEAG  179

Query  204  YDNLLL  209
            YDN L+
Sbjct  180  YDNYLV  185

>PHYCA_40785
Length=137

 Score = 189 bits (479),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 96/107 (90%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M+++VLKFGPFRELLTDGAPELTG+VIEELV LLQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  31   MREIVLKFGPFRELLTDGAPELTGKVIEELVRLLQAQQTNPVPYRPQMIGLVERFHRTWK  90

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA  M+   Q DWD WV FAVYAYNSG+HSTVAL PNELMMGR+L
Sbjct  91   DCVATYMSDERQCDWDNWVNFAVYAYNSGKHSTVALTPNELMMGRKL  137

>PHYCA_102255
Length=271

 Score = 191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 98/115 (85%), Gaps = 0/115 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK++VLKFG FRE+LTDGAPELTG  +EELV LLQAQQT   PYRPQLVGLVERFNRTWK
Sbjct  148  MKNIVLKFGVFREILTDGAPELTGHAVEELVMLLQAQQTTAAPYRPQLVGLVERFNRTWK  207

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLR  115
            DIVA  M +  QRDW RWV FAVYAYNSG+HSTV L PNELMM RRLRSPN+LLR
Sbjct  208  DIVATCMQEESQRDWHRWVDFAVYAYNSGQHSTVKLSPNELMMDRRLRSPNDLLR  262

>PHYCA_133316
Length=254

 Score = 190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 96/107 (90%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK+++LKFGPFRELLTDGAPELTG+VIEELV LLQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  148  MKEIILKFGPFRELLTDGAPELTGKVIEELVRLLQAQQTNPVPYRPQMIGLVERFHRTWK  207

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA  M+   Q DWD WV FAVYAYNSG+HSTVAL PNELMMGR+L
Sbjct  208  DCVATYMSNEQQCDWDNWVSFAVYAYNSGKHSTVALTPNELMMGRKL  254

>PHYCA_40798
Length=137

 Score = 186 bits (471),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 94/107 (88%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK++VLKFGPFRELLTDGAPELTG+VIEELV LLQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  31   MKEIVLKFGPFRELLTDGAPELTGKVIEELVNLLQAQQTNPVPYRPQMIGLVERFHRTWK  90

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA  M+   Q DWD WV  AVYAYN G+HSTVAL PNELMMGR+L
Sbjct  91   DCVATYMSDERQCDWDNWVNCAVYAYNLGKHSTVALTPNELMMGRKL  137

>PHYCA_117161
Length=246

 Score = 189 bits (480),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 97/107 (91%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK++VLKFGPFRELLTDGAPELTG+VI+ELV LLQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  140  MKEIVLKFGPFRELLTDGAPELTGKVIDELVNLLQAQQTNPVPYRPQMIGLVERFHRTWK  199

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA+ M+   Q DWD WV FAVYAYNSG+HSTVAL PNELMMGR+L
Sbjct  200  DCVAVYMSDERQCDWDSWVNFAVYAYNSGKHSTVALTPNELMMGRKL  246

>PHYCA_42179
Length=137

 Score = 184 bits (468),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 94/107 (88%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK +VLKFGPFRELLTDGAPELTG+VI+EL+ +LQAQQ NPVPYRPQ++GLVERF+RTWK
Sbjct  31   MKQIVLKFGPFRELLTDGAPELTGKVIDELMYMLQAQQKNPVPYRPQMIGLVERFHRTWK  90

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA  MN   Q DWD WV FAVY+YNSG+HSTVAL PNELMMGR+L
Sbjct  91   DCVATYMNDERQCDWDNWVDFAVYSYNSGKHSTVALSPNELMMGRKL  137

>PHYCA_40787
Length=137

 Score = 183 bits (465),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 94/107 (88%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK +VLKFGPFRELLTDGAPELTG+VI+EL+ +LQA+Q NPVPYRPQ+VGLVERF+RTWK
Sbjct  31   MKQIVLKFGPFRELLTDGAPELTGKVIDELMRMLQAEQKNPVPYRPQMVGLVERFHRTWK  90

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA  MN   Q DWD WV FAVY+YNSG+HSTVAL PNELMMGR+L
Sbjct  91   DCVATYMNDERQCDWDNWVDFAVYSYNSGKHSTVALSPNELMMGRKL  137

>PHYCA_131428
Length=254

 Score = 187 bits (475),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 96/107 (90%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M++VVLKFGPFRELLTDGAPELTG+VIEELV LLQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  148  MREVVLKFGPFRELLTDGAPELTGKVIEELVMLLQAQQTNPVPYRPQMIGLVERFHRTWK  207

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA  M+   Q DWD WV FAVY+YNSG+HSTVAL PNELMMGR+L
Sbjct  208  DCVATYMSDERQCDWDHWVDFAVYSYNSGKHSTVALTPNELMMGRKL  254

>PHYCA_133093
Length=246

 Score = 186 bits (473),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 95/107 (89%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK++VLKFGPFRELLTDGAPELTG+VIEELV LLQAQQTNPVPYRPQ++GLVERF+RTWK
Sbjct  140  MKEIVLKFGPFRELLTDGAPELTGKVIEELVNLLQAQQTNPVPYRPQMIGLVERFHRTWK  199

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA  M+   Q DWD WV  AVYAYNSG+HSTVAL PNELMMGR+L
Sbjct  200  DCVATYMSDERQCDWDNWVNCAVYAYNSGKHSTVALTPNELMMGRKL  246

>PHYSO_491041
Length=233

 Score = 184 bits (466),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 110/152 (72%), Gaps = 1/152 (1%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGRRL+SPN+LLR  S  +AG+L  YHRRLL  M  S   AE AR REQ RQA YY+R+V
Sbjct  1    MGRRLKSPNDLLRRASVEEAGKLTSYHRRLLAAMTSSRECAEVARTREQERQARYYDRRV  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENA-ERLI  221
             QKR F  GD  W++KPPRGP+A+K V +W+GP+RVIE AGYDN L++RE+     E+ +
Sbjct  61   TQKREFVAGDRAWLYKPPRGPKATKLVLRWLGPVRVIEPAGYDNYLVKRENVSGVPEQSL  120

Query  222  AHVSFLVSYHHPADFLTTTATDIVTELERENA  253
            AHVSFL+SYHHPA FL   A DI  +LE  +A
Sbjct  121  AHVSFLISYHHPATFLKMAAADIEEQLEYGDA  152

>PHYCA_131662
Length=254

 Score = 183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 94/107 (88%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK VVLKFGPFRELLTDGAPELTG+VI+EL+ +LQAQQ NPVPYRPQ++GLVERF+RTWK
Sbjct  148  MKQVVLKFGPFRELLTDGAPELTGKVIDELMYMLQAQQKNPVPYRPQMIGLVERFHRTWK  207

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA  MN   Q DWD WV FAVY+YNSG+HSTVAL PNELMMGR+L
Sbjct  208  DCVATYMNDEKQCDWDAWVDFAVYSYNSGKHSTVALSPNELMMGRKL  254

>PHYSO_526654
Length=191

 Score = 181 bits (458),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 106/153 (69%), Gaps = 3/153 (2%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGRRLRSPNELLR TS  +AGE+   H++LL  M+ S   AE AR  EQ RQA YY  KV
Sbjct  1    MGRRLRSPNELLRSTSVSEAGEMTANHQQLLAAMESSRRCAEIARTHEQERQAKYYNWKV  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERED--GENAERL  220
            R  R    GD VWMFKPPR P+ASKFVHQW+ P+RV+E  GYDN L+ERED  GE  ER 
Sbjct  61   RNMRTVSAGDRVWMFKPPRRPKASKFVHQWLDPMRVVEPVGYDNFLIEREDVTGE-PERH  119

Query  221  IAHVSFLVSYHHPADFLTTTATDIVTELERENA  253
            IAHVSFLV YH PA  L   A DI  +LE E+A
Sbjct  120  IAHVSFLVMYHQPAASLEQIAVDIEAQLEHEDA  152

>PHYCA_125154
Length=184

 Score = 177 bits (450),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 127/183 (69%), Gaps = 11/183 (6%)

Query  29   ELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNS  88
            EL+ L+Q +Q+ PVPYRP L+GLVERF+RTWKD++++         +D ++P A+YAYNS
Sbjct  4    ELLALMQTKQSTPVPYRPNLLGLVERFHRTWKDMISL---------YDDFLPCALYAYNS  54

Query  89   GRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLLQTMKESHASAECAR  147
             +H+T    PNELMMGR+LR P ELLR +  +     L++YH   L+ ++++   AE A 
Sbjct  55   AKHATHGYQPNELMMGRKLRMPAELLRRSRLEYPHQTLDKYHEIPLKDLQKAQELAEVAL  114

Query  148  EREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDN  206
            ++EQARQA YY +R V QK  F+P   VW+++P RGP  +KF H+W GP +VIE +GY+N
Sbjct  115  QKEQARQAIYYNQRNVSQKSVFRPTQLVWLYRPTRGPGITKFGHRWRGPAQVIEASGYNN  174

Query  207  LLL  209
             L+
Sbjct  175  YLV  177

>PHYCA_70703
Length=126

 Score = 174 bits (440),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 94/120 (78%), Gaps = 0/120 (0%)

Query  94   VALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQAR  153
            V L PNELMMGRRLR+PNELLR T+  +AGEL EYH RLL+TM+ SH  AE AR REQ R
Sbjct  1    VLLTPNELMMGRRLRAPNELLRRTAVTEAGELAEYHTRLLKTMERSHKCAELARVREQER  60

Query  154  QASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLERED  213
            QA YY R VR +R F  G  VW + PPRGP+A+KFVHQW+GPLR+IE AGYDN LLERED
Sbjct  61   QAKYYNRNVRAQREFHVGVRVWFYNPPRGPKATKFVHQWMGPLRIIEPAGYDNFLLERED  120

>PHYRA_86556
Length=405

 Score = 179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 114/161 (71%), Gaps = 1/161 (1%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M+ VVL +GP RE++ DGAPEL G V+E LV +LQA+Q  PVPYRP L+GLVERF+RTWK
Sbjct  246  MEKVVLVYGPVREIVMDGAPELNGAVVEALVSMLQAKQITPVPYRPALLGLVERFHRTWK  305

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D+VAI +++  Q DWDRW+  A YAYN  +HS     PNELMMGRRLR+PNELLR +   
Sbjct  306  DMVAIYVSEA-QDDWDRWLSCAAYAYNGAKHSGTGFSPNELMMGRRLRAPNELLRSSGVT  364

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERK  161
              G   ++ R L+  +  +  +A+ A  +EQ R+A YY+R+
Sbjct  365  QVGAFADFERALVSNLARATTAAKKALVKEQQRRARYYDRR  405

>PHYCA_40812
Length=99

 Score = 168 bits (425),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 84/99 (85%), Gaps = 0/99 (0%)

Query  7    KFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAIS  66
             FGPFRELLTDGAPELTG+VIE LV LLQAQQTNPVPYRPQ++GLVERF+RTWKD  A  
Sbjct  1    SFGPFRELLTDGAPELTGKVIEGLVRLLQAQQTNPVPYRPQMIGLVERFHRTWKDCAATY  60

Query  67   MNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGR  105
            M+   Q DW  WV FAVYAYNSG+HSTVAL PNELMMGR
Sbjct  61   MSDERQCDWGNWVNFAVYAYNSGKHSTVALTPNELMMGR  99

>PHYCA_129340
Length=193

 Score = 171 bits (434),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 0/107 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M++VVLKFG FRE+LTDGAPELTG+ +++LV LLQA Q NPVPYRPQ +GLVERFNRTWK
Sbjct  87   MQNVVLKFGTFREILTDGAPELTGKAMDQLVVLLQAYQRNPVPYRPQHIGLVERFNRTWK  146

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D VA  MN  +Q DWD WV FA YAYNSG+HSTV L PNELMMGR+L
Sbjct  147  DCVATYMNTEEQHDWDVWVDFATYAYNSGQHSTVKLSPNELMMGRKL  193

>PHYCA_129900
Length=198

 Score = 168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 130/217 (60%), Gaps = 28/217 (13%)

Query  17   DGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWD  76
            DG  E   +V  EL+ L+Q +Q+ PVPYRP L+GLVERF+R WKD++++           
Sbjct  2    DGVREFGSKVTAELLALMQTKQSTPVPYRPNLLGLVERFHRMWKDMISL-----------  50

Query  77   RWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRD-AGELNEYHRRLLQT  135
             +V  A+YAYN  RH+     PNELMMGR+LR+P        + D +  L+EYH  L+Q 
Sbjct  51   -YVDDALYAYNPSRHTAHGYQPNELMMGRKLRTPQS---CYGEADWSSTLDEYHEVLMQE  106

Query  136  MKESHASAECAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIG  194
            +K         R ++QARQA YY +R VR    F+ G  VW+++P + P  +KF H+W G
Sbjct  107  LK---------RHKKQARQAMYYNQRNVRGGSKFRDGQLVWVYRPAKAPGITKFGHRWRG  157

Query  195  PLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYH  231
            P +++E AGY N L++    E  + L+ H SFL+SY+
Sbjct  158  PGKIVEAAGYGNYLVQML--ELGQELVIHCSFLLSYY  192

>PHYCA_70637
Length=166

 Score = 164 bits (416),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 118/167 (71%), Gaps = 3/167 (2%)

Query  46   PQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGR  105
            P L+GLVERF+RTWKD++++ +++  Q DWD ++P A+YAYNS RH+T    PNELMMGR
Sbjct  1    PNLLGLVERFHRTWKDMISLYVDE-QQDDWDDFLPSALYAYNSSRHTTHGYQPNELMMGR  59

Query  106  RLRSPNELLRVTS-QRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYY-ERKVR  163
            +LR+P ELLR +  +     L+EYH  L+Q +K++   A  A  +EQARQA YY +R VR
Sbjct  60   KLRTPAELLRRSRLEFPHSTLDEYHEILMQDLKKAQKLAAVALGKEQARQAMYYNQRNVR  119

Query  164  QKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLE  210
            +   F+ G  VW+++P +GP  +KF H+W G  +++E AGYDN L++
Sbjct  120  RGNKFRDGQLVWVYRPAKGPGIAKFGHRWRGTGKIVEAAGYDNYLVQ  166

>PHYCA_122305
Length=164

 Score = 163 bits (413),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 120/195 (62%), Gaps = 33/195 (17%)

Query  17   DGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWD  76
            DGA E   +V  EL+ LLQ +Q+ PVPYRP L+GLVERF+RTWKD++++ +++  Q DWD
Sbjct  2    DGAREFGSKVTAELLALLQTKQSTPVPYRPNLLGLVERFHRTWKDMISLYVDE-QQDDWD  60

Query  77   RWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTM  136
             ++P A+YAYNS RH+T                                +EYH  L+Q +
Sbjct  61   DFLPSALYAYNSSRHTT-------------------------------HDEYHEVLMQDL  89

Query  137  KESHASAECAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            K++   A  A E+EQARQA YY +R VR+   F+ G  VW+++P +GP  +KF H+W GP
Sbjct  90   KKAQELAAVALEKEQARQAMYYNQRNVRRGSKFRDGQLVWVYRPAKGPGITKFGHRWRGP  149

Query  196  LRVIEDAGYDNLLLE  210
             +++E AGYDN L++
Sbjct  150  GKIVEAAGYDNYLVQ  164

>PHYSO_520168
Length=177

 Score = 163 bits (413),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 107/178 (60%), Gaps = 7/178 (4%)

Query  72   QRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRR  131
            Q DWDRW+P A Y+YN  RHS     PNELM+     +PNELLR +     G   EYHR 
Sbjct  7    QSDWDRWLPCAAYSYNGARHSGTGYSPNELML-----APNELLRASGVTQVGVFAEYHRA  61

Query  132  LLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQ  191
            L++ M  +  + + A  ++Q R+A YY+R+VR    F  GD VW+ +PPRG   +K  H+
Sbjct  62   LVRNMATATEAVKKALGKDQLRRARYYDRQVRAHNEFAVGDSVWVLRPPRGKGITKLAHK  121

Query  192  WIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTTATDIVTELE  249
            W+GP R++ DAG+DN  + RED  N ER+I H SFLV    P+D L   A  ++ EL 
Sbjct  122  WLGPARIVADAGFDNWEVLRED--NDERVITHCSFLVKCSCPSDSLGVVAERMLRELS  177

>PHYCA_80433
Length=122

 Score = 161 bits (408),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 96/134 (72%), Gaps = 12/134 (9%)

Query  42   VPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNEL  101
            VPYRPQLVGLVERFNRTWKDIVA  M +             +YAYNSG+HSTV L  NEL
Sbjct  1    VPYRPQLVGLVERFNRTWKDIVATCMQE------------EIYAYNSGQHSTVKLSLNEL  48

Query  102  MMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERK  161
            MMGR+LRSPN+LLR  +  +AGEL+EYH++L+  MK S   AE AR +EQ RQA YY R+
Sbjct  49   MMGRKLRSPNDLLRKLNVTEAGELSEYHKKLVAAMKSSQRCAEAARVKEQERQARYYNRR  108

Query  162  VRQKRAFKPGDHVW  175
            VR+K+  + GD VW
Sbjct  109  VRKKKELRAGDRVW  122

>PPTG_21901
Length=1089

 Score = 174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 135/236 (57%), Gaps = 25/236 (11%)

Query  75    WDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQ  134
             WD WV FAVYAYNSGRH TV L PN+LMMGR+LRSPN+LLR     + GEL  YHRRLL 
Sbjct  809   WDVWVDFAVYAYNSGRHLTVVLSPNDLMMGRQLRSPNDLLRRVGVAETGELTSYHRRLLA  868

Query  135   TMKE--SHASAECAREREQARQASYYER--KVRQKRAFKPGDHVWMFKPPRGPRASKFVH  190
              M+E  +HA  E   E    R +    +          +P   VWM++PPRGP+ASKFVH
Sbjct  869   AMREPVTHAPNEHENENNDDRLSITIAKYGGSGGGGGIEPNGRVWMYRPPRGPKASKFVH  928

Query  191   QWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTTATDIVTELER  250
             QW+GP+ VIE AGYDN LLERED E +                       A DI  +LE 
Sbjct  929   QWVGPMSVIEQAGYDNHLLEREDDEGSP---------------------VAADIKMQLEY  967

Query  251   ENAGDNgehataaettsgtttasvhataavRGTKRSRETVANEEPTERTSEVVVEL  306
             E+A ++    TAA    G T   VHAT A R  KR+ +TVA+ +     +E++VE 
Sbjct  968   ESALEHANDDTAAGEIMGATKVPVHATVASRSQKRNAQTVASADSGGGQNEILVEF  1023

>PPTG_05705
Length=176

 Score = 156 bits (395),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 100/151 (66%), Gaps = 0/151 (0%)

Query  21   ELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVP  80
            E+TGRVIE+LV LLQA+Q N  PYRPQ++ LVE ++RTW++ V+  M    Q DW  W  
Sbjct  4    EMTGRVIEQLVVLLQAKQRNSTPYRPQMIDLVECYHRTWRECVSTFMADERQNDWCAWAK  63

Query  81   FAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESH  140
            + V+A+NS +HSTV L PN LMMGRRLR PNELLR T   + G+L +YHR+L+  M+   
Sbjct  64   YVVFAHNSAQHSTVVLSPNVLMMGRRLRPPNELLRETELTEPGDLMDYHRQLMVAMERGC  123

Query  141  ASAECAREREQARQASYYERKVRQKRAFKPG  171
               E A+ +EQARQ  YY RK +      P 
Sbjct  124  ECEERAQRKEQARQVYYYGRKSQTTTNISPA  154

>PHYCA_132485
Length=193

 Score = 155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 105/164 (64%), Gaps = 1/164 (1%)

Query  144  ECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAG  203
            E AREREQ RQA YY R+ R KR FK  D VWMFKPPRG +ASKFVHQW+GPL+++E+AG
Sbjct  4    EQAREREQKRQARYYNRRERHKRTFKVHDRVWMFKPPRGSKASKFVHQWLGPLKIVENAG  63

Query  204  YDNLLLEREDGE-NAERLIAHVSFLVSYHHPADFLTTTATDIVTELERENAGDNgehata  262
            YDN +LERED E   ER+IAHVSFL SYH+PAD L T   DI  EL  +++   G+   +
Sbjct  64   YDNYVLEREDTEIKGERMIAHVSFLNSYHYPADLLRTVPADITEELAYKDSWRPGDDEAS  123

Query  263  aettsgtttasvhataavRGTKRSRETVANEEPTERTSEVVVEL  306
                       V A       KRSR+ VA E     +S V+VEL
Sbjct  124  RPDAVSAAAVPVLAAIPRNERKRSRDAVARERVLGDSSGVLVEL  167

>PHYCA_104563
Length=247

 Score = 156 bits (395),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 95/124 (77%), Gaps = 1/124 (1%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGR LR+PNELLR TS  +AG+L EYH++L++ +++  A AE ARE+EQ RQA YY ++ 
Sbjct  1    MGRILRTPNELLRATSVTEAGDLTEYHQKLVKALEDGVACAEEAREKEQRRQAKYYNKRT  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGEN-AERLI  221
            RQ+R FK GD VWMF+PPRG +ASK VH WIGPLRV+E AG+DN LL RED     E +I
Sbjct  61   RQRREFKVGDRVWMFRPPRGAKASKLVHNWIGPLRVMEPAGFDNFLLRREDQYGVGELII  120

Query  222  AHVS  225
            AH++
Sbjct  121  AHLA  124

>PITG_04521
Length=312

 Score = 153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 117/172 (68%), Gaps = 1/172 (1%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            MK+S+  AE AREREQ RQA YY RK R +R F+PGD VW+++PPRG +ASK VHQW+GP
Sbjct  1    MKKSYEVAESAREREQLRQAHYYNRKARNRREFQPGDQVWLYRPPRGAKASKLVHQWMGP  60

Query  196  LRVIEDAGYDNLLLEREDGENA-ERLIAHVSFLVSYHHPADFLTTTATDIVTELERENAG  254
            +++IE AG++N L+ERED     ER IAHVSFL+++++PAD L   A DI  +LE E+  
Sbjct  61   VKIIEPAGFENFLVEREDQNGVPERFIAHVSFLITHYYPADLLKRAAVDITRQLEYEDPS  120

Query  255  DNgehataaettsgtttasvhataavRGTKRSRETVANEEPTERTSEVVVEL  306
            + GE    + TT+G  TASV A A  R  KR   TV  +E    TS  +VE+
Sbjct  121  EPGEDVPPSSTTAGAATASVQAAAGARMAKRKARTVGRDEAWRVTSGAMVEI  172

>PHYCA_97812
Length=269

 Score = 151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 101/151 (67%), Gaps = 1/151 (1%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGR LR+PNELLR T   +AGEL +YH  LL+T+K SH  AE AR REQ RQA YY RK 
Sbjct  1    MGRTLRTPNELLRRTHVTEAGELADYHANLLKTLKASHECAEEARRREQERQAKYYNRKT  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERL-I  221
            R K  FKPGD   +F+ PRG +ASKFVH W+ P +++E AGYDN L+ RED +    L I
Sbjct  61   RSKCEFKPGDRFGVFRLPRGAKASKFVHSWVVPTKILEPAGYDNFLIRREDLDGCGELKI  120

Query  222  AHVSFLVSYHHPADFLTTTATDIVTELEREN  252
            AHVSFLV Y HP   L     D++ ELE E 
Sbjct  121  AHVSFLVKYQHPGQLLQRIGDDLIEELEDEG  151

>PHYCA_131451
Length=166

 Score = 146 bits (369),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 1/102 (1%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            MKESH  A+ AR+REQ RQA YY RK ++   FKPGD VW+F+PPRGP+ASKFVH WIGP
Sbjct  1    MKESHKCADIARQREQERQAKYYNRKTKKMYDFKPGDRVWLFRPPRGPKASKFVHSWIGP  60

Query  196  LRVIEDAGYDNLLLEREDGEN-AERLIAHVSFLVSYHHPADF  236
             +++E AGYDN L+ RED +   E +IAHVSFLV YHHP  F
Sbjct  61   TKIVEPAGYDNFLIRREDLDGQGELIIAHVSFLVKYHHPGQF  102

>PHYCA_102147
Length=282

 Score = 149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 104/171 (61%), Gaps = 1/171 (1%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            M+ S   AE AR +EQ RQA YY R+VR+K+  + GD VWMF+PPRG  ASKFVHQW+GP
Sbjct  1    MESSQRCAEAARVKEQERQARYYNRRVRKKKELRAGDRVWMFRPPRGAEASKFVHQWVGP  60

Query  196  LRVIEDAGYDNLLLEREDGEN-AERLIAHVSFLVSYHHPADFLTTTATDIVTELERENAG  254
            +RV+E  GYDN L++RED +  +E+ IAHVSFL+SYH P D L   A D+  +LE E+ G
Sbjct  61   MRVVEPVGYDNWLVKREDVDGESEKHIAHVSFLISYHKPIDLLKRAALDLERQLEYEDTG  120

Query  255  DNgehataaettsgtttasvhataavRGTKRSRETVANEEPTERTSEVVVE  305
                   AA              A+ R  KR R+T         +S+++VE
Sbjct  121  KGMSEGEAAAKVVRAAEVPTTTPASSRVRKRDRQTARGAAAWRDSSDILVE  171

>PHYSO_375184
Length=147

 Score = 145 bits (365),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 95/149 (64%), Gaps = 2/149 (1%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGRRLR+PNELLR +     G   +YHR L+ +M+ +  + + A   +Q R+A YY+R+V
Sbjct  1    MGRRLRAPNELLRSSGVTQVGPFADYHRALVDSMQRATEATKAALAIDQRRRAKYYDRRV  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIA  222
            RQ   F  GD VW+ +PPRG   +K  HQW+GP R++ DAG+DN  +ERED    E LI 
Sbjct  61   RQHAEFDVGDRVWVLRPPRGKGLTKLTHQWLGPARIVVDAGFDNWKVERED--TGEHLIV  118

Query  223  HVSFLVSYHHPADFLTTTATDIVTELERE  251
            H SFLVS H P+D L + A  I+ E+  E
Sbjct  119  HCSFLVSCHCPSDSLGSVAERILREMAEE  147

>PHYCA_133010
Length=177

 Score = 144 bits (363),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 105/161 (65%), Gaps = 4/161 (2%)

Query  75   WDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLL  133
            WD ++P A+YAYNS  H+T    PNELM+GR+LR+P  LLR +  +     L  YH  L+
Sbjct  3    WDEFLPRALYAYNSANHATHGYQPNELMVGRKLRTPAGLLRRSRLEYSHSNLETYHEALI  62

Query  134  QTMKESHASAECAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQW  192
            + +K +   A  A ++EQARQA YY  R  R+K  F+ G  VW+++P RGP  +KF H+W
Sbjct  63   EYLKRAQKVASLALQKEQARQAMYYNHRNDRRKSEFRIGQLVWVYRPARGPGITKFGHRW  122

Query  193  IGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHP  233
             GP +++EDAGYDN L+   + ++   LI H SFL+SY++P
Sbjct  123  RGPAKILEDAGYDNYLVRMLESDH--ELITHCSFLLSYYYP  161

>PHYSO_513804
Length=206

 Score = 144 bits (364),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 112/174 (64%), Gaps = 1/174 (1%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            M+ S A AE AR REQ RQ  YY+RKVR+KR F+ GD VW +KPPRGP+A+K VH+W+ P
Sbjct  1    MESSRACAETARRREQERQERYYDRKVRRKRVFEVGDRVWFYKPPRGPKATKLVHKWLAP  60

Query  196  LRVIEDAGYDNLLLEREDGE-NAERLIAHVSFLVSYHHPADFLTTTATDIVTELERENAG  254
            +R++E  GYDN L+ERED E + E+ +AH SFLVSYH PA  L   A DI  +LE E A 
Sbjct  61   VRIVEPVGYDNYLVEREDVEHDPEQYLAHASFLVSYHQPATLLEEAAADIEAQLEHEGAL  120

Query  255  DNgehataaettsgtttasvhataavRGTKRSRETVANEEPTERTSEVVVELRR  308
            +   +      + G  TA V A  A   TKR R TVA+    +R  E VVELRR
Sbjct  121  ELDGNDETDGASGGAATAPVRAAPAAGTTKRRRRTVASTTTKQRPDEDVVELRR  174

>PHYCA_60929
Length=76

 Score = 137 bits (344),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)

Query  35   QAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTV  94
            QAQQT PVPYRPQ+VGLVERFNRTWKD+VA  +N   QRDWD+WV FAVYAYNSGRHSTV
Sbjct  1    QAQQTTPVPYRPQMVGLVERFNRTWKDMVATYINDELQRDWDQWVDFAVYAYNSGRHSTV  60

Query  95   ALIPNELMMGRRLRSP  110
            AL PNELMMGR+LRSP
Sbjct  61   ALSPNELMMGRKLRSP  76

>PYVX_23138
Length=130

 Score = 136 bits (343),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 86/125 (69%), Gaps = 1/125 (1%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGRRLR+PNELL   +   AGEL EY+ +L+Q M  +   +  A ++EQ RQA++Y RK 
Sbjct  1    MGRRLRAPNELLHQENITVAGELREYYNKLIQQMAVACELSRKATDKEQLRQATFYNRKA  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENA-ERLI  221
            +  R F+PGD VWM++PPRG   +KF HQW+GPL ++E AGYDN L+ RED + + E  I
Sbjct  61   KATREFRPGDKVWMYRPPRGKGITKFAHQWLGPLAIVEPAGYDNFLVRREDNDGSPEEFI  120

Query  222  AHVSF  226
            AH + 
Sbjct  121  AHTTI  125

>PHYCA_99042
Length=174

 Score = 136 bits (343),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 80/104 (77%), Gaps = 1/104 (1%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            M+ S+  AE AR REQ RQA +Y R VR++R F+ GD VW++ PPRGPRA+KFVHQW+GP
Sbjct  1    MERSNRCAEVARLREQERQAKFYNRNVRKRREFRVGDRVWLYNPPRGPRATKFVHQWMGP  60

Query  196  LRVIEDAGYDNLLLEREDG-ENAERLIAHVSFLVSYHHPADFLT  238
            LR++E AGY+N LL+REDG    E +IAHVSFLVSY+ P   L+
Sbjct  61   LRILEPAGYENFLLKREDGLGKVETIIAHVSFLVSYYKPTSPLS  104

>PHYSO_320761
Length=124

 Score = 134 bits (337),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 86/126 (68%), Gaps = 7/126 (6%)

Query  72   QRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELL---RVTSQRDAGELNEY  128
            Q DWD W+P A+YAYN  +HST    PNELMMGR+LRSPNELL   RVT+  + G   EY
Sbjct  2    QDDWDDWLPAALYAYNGAKHSTTNFSPNELMMGRQLRSPNELLLSHRVTTIDNYG---EY  58

Query  129  HRRLLQTMKESHASAECAREREQARQASYYERK-VRQKRAFKPGDHVWMFKPPRGPRASK  187
            H+ L++ M  +   A+    +EQARQA YY+R  VR+K  FKPG  VW++KPPRG   +K
Sbjct  59   HKSLVEQMDRTRNLADVFTAQEQARQAKYYDRSTVRKKEHFKPGMLVWLYKPPRGNGVTK  118

Query  188  FVHQWI  193
             VH+W+
Sbjct  119  LVHRWV  124

>PHYCA_128371
Length=157

 Score = 135 bits (339),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 92/151 (61%), Gaps = 2/151 (1%)

Query  98   PNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASY  157
            PNELMMGRRLRSPNELLRV   ++     EYH++L++ +  +   A  A ER+Q R+  Y
Sbjct  2    PNELMMGRRLRSPNELLRVNRVKEIQGWPEYHKKLVEHLAAAATIAREALERDQLRRERY  61

Query  158  YERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENA  217
            Y  +VR +  FK GD  W+F+PPRG   +K  HQW+GP  ++ D G+DN L+ RED    
Sbjct  62   YNLRVRDRLKFKVGDRAWIFRPPRGTGVTKLAHQWVGPAELMADVGFDNWLVIRED--TK  119

Query  218  ERLIAHVSFLVSYHHPADFLTTTATDIVTEL  248
            E L+ H SF  S + P   L   A  ++ EL
Sbjct  120  EELVVHCSFQTSSYCPTSRLAMVADTLLEEL  150

>PHYCA_40777
Length=136

 Score = 131 bits (330),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 1/107 (1%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M  VVL FGP RE++ DGA E   ++  EL+ L+Q +Q+ PVPYRP L+GLVERF+RTWK
Sbjct  31   MDKVVLVFGPMREVMMDGAREFGSKMTAELLALMQTKQSTPVPYRPNLLGLVERFHRTWK  90

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D++++ +++  Q DWD ++P A+YAYNS +H+T    PNELMMGR+L
Sbjct  91   DMISLYVDET-QDDWDDFLPCALYAYNSAKHATHGYQPNELMMGRKL  136

>PHYSO_422151
Length=147

 Score = 129 bits (323),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 90/147 (61%), Gaps = 2/147 (1%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGR+LR+P+ELLR +     G   EY+R+L+  M  +  +A  A  ++Q R+  YY R+V
Sbjct  1    MGRKLRAPSELLRSSGVTQTGPFAEYYRKLVDDMTRATEAAHAALAKDQLRRERYYNRRV  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIA  222
            RQ   F+ GD VW+ KPPRG   +K  HQW+GP R ++ AG+DN  + R+D +  E  I 
Sbjct  61   RQDTTFEVGDLVWVLKPPRGQGITKLAHQWVGPTRTVQSAGFDNWEVVRDDTD--EHSIV  118

Query  223  HVSFLVSYHHPADFLTTTATDIVTELE  249
            H SFLV    P+D L   A  I+TELE
Sbjct  119  HCSFLVPSRCPSDSLGVIAEKIITELE  145

>PHYSO_372996
Length=153

 Score = 129 bits (323),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 87/146 (60%), Gaps = 2/146 (1%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGR+LR+PNELLR       GE   YHR L+Q M    A+A+ A  ++Q ++A YY R  
Sbjct  1    MGRQLRTPNELLRTAGVTQVGEFAAYHRALVQQMARCAAAAKAALAKDQLQRAKYYNRWQ  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIA  222
            R    F  GD VW+  PPRG   +K  HQW+GP R++EDAG+DN  + RED    E L+ 
Sbjct  61   RTTTEFGVGDLVWVLGPPRGKGITKLAHQWVGPARIVEDAGFDNWRVVRED--TGEHLVV  118

Query  223  HVSFLVSYHHPADFLTTTATDIVTEL  248
            H SFLV+   P+D L   A  I+ EL
Sbjct  119  HCSFLVTSRCPSDSLGHVADRILREL  144

>PHYCA_40454
Length=136

 Score = 128 bits (321),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 80/107 (75%), Gaps = 1/107 (1%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M+ V+  +GP RE++ DGA E    +I EL+ L+Q +Q+ P PYRP L+GLVERF+RTWK
Sbjct  31   MEKVIFVYGPMREVMMDGAREFGSAMIAELLVLMQTKQSTPAPYRPNLLGLVERFHRTWK  90

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            D++++ +N+  Q DWD ++P A+YAYNS +H+T    PNELMMGR+L
Sbjct  91   DMISLYVNE-LQDDWDEFLPAALYAYNSAKHATHGYQPNELMMGRKL  136

>PHYCA_113013
Length=216

 Score = 129 bits (324),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 75/106 (71%), Gaps = 1/106 (1%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            +K SH  AE AR REQ RQA YY RK ++K  FKPGD VW+F+PPRGP+ASKFVH WIGP
Sbjct  1    VKRSHECAEEARRREQDRQAKYYNRKSKKKSDFKPGDRVWVFRPPRGPKASKFVHSWIGP  60

Query  196  LRVIEDAGYDNLLLEREDGEN-AERLIAHVSFLVSYHHPADFLTTT  240
             +++E AGYDN LL RED +   E +IAHVSFL       +  TTT
Sbjct  61   TKIVEPAGYDNFLLRREDLDGRGELIIAHVSFLDEGMFEQESSTTT  106

>PHYSO_501270
Length=226

 Score = 128 bits (322),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 93/150 (62%), Gaps = 2/150 (1%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            M R+LR+P+E LR +     G   EY+R+L+  M  +  +A  A  ++Q R+  YY R+V
Sbjct  1    MERKLRAPSEPLRSSGVTQTGPFAEYYRKLVDNMARATEAAHAALAKDQLRRERYYNRRV  60

Query  163  RQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIA  222
            RQ   F+ GD VW+ KPPRG   +K  HQW+GP R+++ AG+DN  + R+D +  E  IA
Sbjct  61   RQDTTFEVGDLVWVLKPPRGKGITKLAHQWVGPARIVQSAGFDNWEVVRDDTD--EHSIA  118

Query  223  HVSFLVSYHHPADFLTTTATDIVTELEREN  252
            H SFLVS   P+D L   A  I+TELE E+
Sbjct  119  HCSFLVSSRCPSDSLGMIAEKIITELELED  148

>PHYCA_49670
Length=136

 Score = 124 bits (312),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 86/127 (68%), Gaps = 2/127 (2%)

Query  85   AYNSGRHSTVALIPNELMMGRRLRSPNELLRVTS-QRDAGELNEYHRRLLQTMKESHASA  143
            AYNS +H+T    PNELMMGR+LR+P ELLR +  +    +L  YH  L+  +K++   A
Sbjct  1    AYNSAKHATHGFQPNELMMGRKLRTPAELLRRSRLEYPHQDLETYHEALIDDLKKAQELA  60

Query  144  ECAREREQARQASYY-ERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDA  202
              A ++EQARQA YY  R VR+K  F+ G  VW+++P RGP  +KF H+W GP +++EDA
Sbjct  61   ALALQKEQARQAMYYNHRNVRKKSEFRIGQLVWVYRPARGPGITKFGHRWRGPAKILEDA  120

Query  203  GYDNLLL  209
            GYDN L+
Sbjct  121  GYDNYLV  127

>PHYCA_52563
Length=92

 Score = 120 bits (301),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 1/92 (1%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            M+ S   AE AR REQ RQA +Y +  R+KR F+ GD VW++ P RGP+A+KFVHQWIGP
Sbjct  1    MERSRQCAEIARAREQERQAKFYNKNARKKREFQVGDRVWLYNPQRGPKATKFVHQWIGP  60

Query  196  LRVIEDAGYDNLLLEREDGENAER-LIAHVSF  226
            LR++E AGY+N LL+REDG   E  +IAHVSF
Sbjct  61   LRILESAGYENFLLKREDGLGKEEAIIAHVSF  92

>PHYSO_435623
Length=154

 Score = 119 bits (299),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 87/153 (57%), Gaps = 14/153 (9%)

Query  103  MGRRLRSPNELLRVTSQRDA--GELNEYHRRLLQTMKESHASAECAREREQARQASYYER  160
            MGRRLR+PN+LLR  +   A  G   E++R L+  +  +      A  ++Q R+  YY R
Sbjct  1    MGRRLRAPNKLLRTRTSSAARTGAFAEHYRALVDRLTRASEVTRTALAKDQLRRKKYYNR  60

Query  161  KVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERL  220
            +VR+   F  GD VW+ KPPRG   +K  HQW+GP R++ DAGYD            ERL
Sbjct  61   RVRETTPFGVGDLVWVLKPPRGKDITKLAHQWVGPARIVPDAGYD------------ERL  108

Query  221  IAHVSFLVSYHHPADFLTTTATDIVTELERENA  253
            I H SFLVS   P+  L T A  I+ EL RE+A
Sbjct  109  IVHCSFLVSSSCPSSSLGTVAEQILQELAREDA  141

>PHYCA_133014
Length=210

 Score = 114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 74/118 (63%), Gaps = 5/118 (4%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            M  +   AE AR REQ RQA YY+R VR +R FK  D VW++ PPRGP+A+KFVHQW+GP
Sbjct  1    MTRAQQCAEQARAREQERQARYYDRNVRSRREFKTSDRVWLYNPPRGPKATKFVHQWMGP  60

Query  196  LRVIEDAGYDNLLLEREDGENA-ERLIAHVSFLVSYHHPADFLTTTATDIVTELEREN  252
            +R++E  GYDN  L+RED     E +IAH+ +  +  H A    T A  I T    EN
Sbjct  61   MRILEPVGYDNFRLKREDQMGVPEEMIAHLRYEEAEQHDA----TAAASIRTATAVEN  114

>PITG_04102
Length=255

 Score = 115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 65/92 (71%), Gaps = 1/92 (1%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            MK SH  AE  R++EQARQA YY R+ R  R F  GD VWM++PPRG +A+K VH WIGP
Sbjct  1    MKISHECAEQVRQKEQARQARYYNRRARMTRVFSTGDRVWMYRPPRGTKATKLVHVWIGP  60

Query  196  LRVIEDAGYDNLLLERED-GENAERLIAHVSF  226
            LR+IE AGYDN ++ RED  E  E  IAH+ +
Sbjct  61   LRIIEPAGYDNYVVRREDQNEEPEEFIAHLEY  92

>PHYRA_78588
Length=394

 Score = 114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 107/189 (57%), Gaps = 13/189 (7%)

Query  51   LVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSP  110
            LVERF+RTWKD+V++ +N+  Q DWD ++P A+YAYN  RH+T    PNELMMGR+LR+P
Sbjct  48   LVERFHRTWKDMVSLYVNEA-QDDWDDFLPSALYAYNGSRHATHGYQPNELMMGRKLRTP  106

Query  111  NELLRVTS-QRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFK  169
             ELLR    +     L +YH  LLQ ++++   A  A ++EQARQA YY ++    R   
Sbjct  107  AELLRRNRLEHPHSTLQDYHEVLLQDLRKARELAAVALQKEQARQAMYYNQRNCMTRN-A  165

Query  170  PGDHVWMFKPPRGPRASKFVHQW--IGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            P D V  F    G   +K +  W   G  +  +    D LL+   DG+  E LI    ++
Sbjct  166  PVDIVEGF----GGGTNKVLRVWRFAGTTQYQQRIVVDALLV---DGQGDELLIGE-DWM  217

Query  228  VSYHHPADF  236
            V +    DF
Sbjct  218  VEHQVKIDF  226

>PHYSO_471543
Length=213

 Score = 108 bits (269),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 2/104 (2%)

Query  149  REQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLL  208
            ++Q R+  YY+R+VRQ   F  GD VW+ +PPRG   +K  HQW+GP+ ++  AG+DN  
Sbjct  14   KDQRRRVKYYDRRVRQHAEFDVGDRVWVLRPPRGKGLTKLTHQWLGPVHIVVGAGFDNWK  73

Query  209  LEREDGENAERLIAHVSFLVSYHHPADFLTTTATDIVTELEREN  252
            +ERED    E LI H SFLVS H P+D L++ A  I+ E+  E+
Sbjct  74   VERED--TGEHLIVHCSFLVSCHCPSDSLSSVAERILREMAEED  115

>PHYCA_101244
Length=51

 Score = 100 bits (249),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 50/51 (98%), Gaps = 0/51 (0%)

Query  8   FGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRT  58
           FGPFRELLTDGAPELTGRVIEELV LLQAQQTNPVPYRPQ++GLVERF+RT
Sbjct  1   FGPFRELLTDGAPELTGRVIEELVNLLQAQQTNPVPYRPQMIGLVERFHRT  51

>PPTG_15814
Length=697

 Score = 108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 77/117 (66%), Gaps = 2/117 (2%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            M+ +   A+ A +++Q R+  YY  +VR +  FK G+ VW+ KPPRG   +K  HQW+GP
Sbjct  1    MERAAVLAKIALQQDQRRRERYYNPQVRCRTNFKTGELVWVLKPPRGKGVTKLAHQWVGP  60

Query  196  LRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTTATDIVTELEREN  252
             ++ E  G+DN L+ER+D +  E LI H SFLVSY++P D L T A  I+TEL+ ++
Sbjct  61   AKLAESVGFDNWLVERQDLQ--ESLIVHTSFLVSYYYPKDRLGTLADRILTELDEDD  115

>PHYCA_101667
Length=215

 Score = 100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 95/172 (55%), Gaps = 24/172 (14%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            MKESH  AE AR REQ RQA YY RK R +  FKPGD VW+F+PPRGP+ASKFVH WIGP
Sbjct  1    MKESHECAEEARRREQERQAKYYNRKARSRYEFKPGDRVWVFRPPRGPKASKFVHSWIGP  60

Query  196  LRVIEDAGYDNLLLEREDGEN-AERLIAHVSFLVSYHHPADFLTTTATDIVTELERENAG  254
             ++IE AGYDN L+ RED +   E +IAH                       ELE E A 
Sbjct  61   TKIIEPAGYDNFLIRREDLDGRGELIIAH-----------------------ELEDERAI  97

Query  255  DNgehataaettsgtttasvhataavRGTKRSRETVANEEPTERTSEVVVEL  306
            +  +  TA      TTTA V A    R  KR+  T+ +E        ++VEL
Sbjct  98   EQVQGTTAVGAAVETTTAPVSAVTTGRVPKRTERTIPSESEQSAQRGMLVEL  149

>PHYCA_51264
Length=99

 Score = 97.4 bits (241),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 72/117 (62%), Gaps = 19/117 (16%)

Query  46   PQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGR  105
            P L+GLVERF+RTWKD++++                  YAYNS RH+T    PNELMMGR
Sbjct  1    PNLLGLVERFHRTWKDMISL------------------YAYNSSRHTTHGYQPNELMMGR  42

Query  106  RLRSPNELLRVTS-QRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERK  161
            +LR+P ELLR +  +     L+EYH  L+Q +K++   A  A  +EQARQA YY ++
Sbjct  43   KLRTPAELLRRSRLEFPHSTLDEYHEILMQDLKKAQKLAAVALGKEQARQAMYYNQR  99

>PHYCA_132841
Length=216

 Score = 100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 61/91 (67%), Gaps = 3/91 (3%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            M  +   AE AR R Q RQA YY R VR +R FK GD VW++ PPRG +A+KFVH+W GP
Sbjct  1    MTRAQQCAEQARIRVQERQARYYNRNVRNRREFKVGDRVWLYNPPRGQKATKFVHRWKGP  60

Query  196  LRVIEDAGYDNLLLERED--GENAERLIAHV  224
            LR+ E  GYDN  L RED  GE  E +IAH+
Sbjct  61   LRIAEPVGYDNFRLIREDQTGE-TEEMIAHL  90

>PHYRA_85713
Length=363

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 90/185 (49%), Gaps = 52/185 (28%)

Query  62   IVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTS-QR  120
            +V++ +N+  Q DWD ++P A+YAYN  RH+T    PNELMMGR+LR+P ELLR    + 
Sbjct  1    MVSLYVNEA-QDDWDDFLPSALYAYNGSRHATHGYQPNELMMGRKLRTPAELLRRNRLEH  59

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
                L +YH  LLQ ++++   A  A ++EQARQA YY ++                   
Sbjct  60   PHSTLQDYHEVLLQDLRKARELAAVALQKEQARQAMYYNQR-------------------  100

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTT  240
                                     N+L      E+ + LI H SFL+SY++P + L   
Sbjct  101  -------------------------NML------ESGKELIVHCSFLLSYYYPTNLLEQM  129

Query  241  ATDIV  245
            A DI 
Sbjct  130  AKDIA  134

>PHYSO_257212
Length=952

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 75/132 (57%), Gaps = 10/132 (8%)

Query  122  AGELNEYHR-RLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPP  180
            A EL+E  R  L Q+   + A  +  RER       YY R+VR+   F+ GD VW+ KPP
Sbjct  2    APELSEISRISLAQSAHAALAIDQLLRER-------YYNRRVRKDTTFEVGDLVWVLKPP  54

Query  181  RGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTT  240
            RG   +K  HQW+GP R++  AG DN  + R+D +  E  I H SFLVS   P+D L   
Sbjct  55   RGKGITKSAHQWVGPARIVLSAGVDNWEVVRDDTD--EHSIVHCSFLVSSRCPSDSLGVI  112

Query  241  ATDIVTELEREN  252
            A  I+TELE E+
Sbjct  113  AEKIITELELED  124

>PPTG_23524
Length=156

 Score = 91.3 bits (225),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 61/99 (62%), Gaps = 2/99 (2%)

Query  150  EQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLL  209
            +Q R+  YY ++VRQ   FK  D VW+ +PPRG   +K  H+W+GP ++++ AG+DN  +
Sbjct  15   DQVRRERYYNKRVRQATTFKVRDLVWVLRPPRGQGVTKLAHRWVGPAKIVQSAGFDNWEV  74

Query  210  EREDGENAERLIAHVSFLVSYHHPADFLTTTATDIVTEL  248
             RED  N ER++   SFLVS    ++ L   A  I+ EL
Sbjct  75   VRED--NGERMVVPCSFLVSSRCSSNSLGVVADRILAEL  111

>H257_03305
Length=189

 Score = 91.7 bits (226),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 85/164 (52%), Gaps = 10/164 (6%)

Query  49   VGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLR  108
            +GLVERFNRT KD+VAI ++   Q DWD W+    YAY++  H T      ELMMG   +
Sbjct  1    MGLVERFNRTIKDMVAIDVSP-TQNDWDEWLATLTYAYSTATHGTHGFPLMELMMGCVGK  59

Query  109  SPNELLRVTSQRDAGELNE----YHRRLLQTMKESHASAECAREREQARQASYYERKVRQ  164
            S  +L     Q  A  + E    ++RR +  +    A A+      Q   A +Y +    
Sbjct  60   SVLDL-----QFPAAPIVESIPVWNRRFVAKLTRICAIAKSTLAPAQEETARHYNKGALD  114

Query  165  KRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLL  208
            +   +PG  VW+ +  R    SK  H++ GP R++E+AG+DN +
Sbjct  115  RVKLRPGMWVWIARVSRDKGTSKLKHRFRGPARLVENAGFDNCV  158

>PHYSO_262016
Length=707

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 1/85 (1%)

Query  52   VERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPN  111
            VERF+R+WKD+VA+ + +  Q DWD+W+  + YAYN  RHS     PNELMMGR+LR+P+
Sbjct  618  VERFHRSWKDMVAMYVAEA-QDDWDQWLHCSAYAYNGARHSGTGYSPNELMMGRKLRAPS  676

Query  112  ELLRVTSQRDAGELNEYHRRLLQTM  136
            ELLR +     G    Y+R+L+  M
Sbjct  677  ELLRSSGVTQTGPFAVYYRKLVDNM  701

>PHYCA_101149
Length=227

 Score = 88.6 bits (218),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 0/73 (0%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKV  162
            MGR+LR+PNELLR T   +A EL E+HR+LL+ +K  H  AE AR REQ RQA YY RK 
Sbjct  1    MGRKLRTPNELLRQTHVTEADELTEHHRKLLEALKAGHECAEEARRREQDRQAKYYNRKT  60

Query  163  RQKRAFKPGDHVW  175
            ++   FKPGD VW
Sbjct  61   KKVSEFKPGDRVW  73

>PPTG_21604
Length=148

 Score = 82.4 bits (202),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 58/99 (59%), Gaps = 1/99 (1%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            ++ +V  FGP RE++     E  G+  EEL+EL QA Q     YRP L+G  ERF+RT K
Sbjct  49   VEKIVFAFGPMREMMMYDVAEFNGKATEELLELAQAIQAILGLYRPNLLGRFERFHRTLK  108

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPN  99
            D++++ ++ G   DWD  +P A YA NS  H+     PN
Sbjct  109  DMISLYVD-GQHGDWDVLLPAARYACNSCVHTAHGFQPN  146

>PHYSO_434316
Length=77

 Score = 80.1 bits (196),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 2/78 (3%)

Query  149  REQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLL  208
            ++Q R+  YY R+VRQ   F+ GD VW+ KPPRG   SK  HQW+GP R++  AG DN  
Sbjct  2    KDQLRRERYYNRRVRQDTTFEVGDLVWVLKPPRGKVISKLAHQWVGPARIVLSAGVDNWE  61

Query  209  LEREDGENAERLIAHVSF  226
            + R+D +  E  I H SF
Sbjct  62   VVRDDTD--EHSIVHCSF  77

>PHYSO_409529
Length=73

 Score = 76.6 bits (187),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 0/71 (0%)

Query  143  AECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDA  202
            A+ A  ++Q+R+  YY R+VR+   F  GD VW+ +PP+G   +K  HQW+GP ++++DA
Sbjct  3    AKAALAKDQSRRDRYYNRRVRETTRFTVGDLVWVLRPPKGKGITKLPHQWVGPPKIVQDA  62

Query  203  GYDNLLLERED  213
            GYDN  + RED
Sbjct  63   GYDNWDVVRED  73

>PYAR_22794
Length=760

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 55/98 (56%), Gaps = 21/98 (21%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M+ V+ + G FRELLTDGA EL  + I++LV +LQA+QT PVPYRP L+GL         
Sbjct  660  MERVIFQHGRFRELLTDGASELQSKTIKQLVIVLQAKQTIPVPYRPNLMGLT--------  711

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIP  98
                         DWD W+P   YAYN+ +H+     P
Sbjct  712  -------------DWDDWLPALAYAYNAAQHTVTGFSP  736

 Score = 38.5 bits (88),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 0/24 (0%)

Query  179  PPRGPRASKFVHQWIGPLRVIEDA  202
            PPRGP  +K  H W+GP RV+E A
Sbjct  737  PPRGPGVTKLRHHWLGPCRVLESA  760

>PHYSO_288655
Length=84

 Score = 75.1 bits (183),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 0/84 (0%)

Query  91   HSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECARERE  150
            HS     PNELMMGRRLR+PNELLR +     G   EYHR L++ M  +  +A+ A  ++
Sbjct  1    HSGTGYSPNELMMGRRLRAPNELLRASGATQVGVFAEYHRALVRNMATATEAAKKALVKD  60

Query  151  QARQASYYERKVRQKRAFKPGDHV  174
            Q R+A YY+R+VR    F  GD V
Sbjct  61   QLRRARYYDRQVRAHNEFAVGDSV  84

>PHYRA_82899
Length=821

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 96/206 (47%), Gaps = 9/206 (4%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            VV + G    LL+D        + +   E L  ++     Y PQ  GLVERFN T   ++
Sbjct  459  VVSRHGVPERLLSDRGSNFISELAQSFYETLGIKKRFGAAYHPQTQGLVERFNGTLMSML  518

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRD--  121
             + +N+  Q DWD  +P A++AY +  H  +   P   + GR    P +L  + +  D  
Sbjct  519  GMLLNES-QSDWDLHLPRALFAYRTSYHEALGDSPFFSLYGRDPVLPLDLAFLNTSNDWK  577

Query  122  AGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPR  181
            + E+  Y RRL  +M+++    E    + Q + A   + +V    +F+ G+ VW+++  R
Sbjct  578  SNEIAAYRRRLYLSMRDTRRMVERQLLKAQDKHARRLDDQV--AVSFEVGEAVWVYQYLR  635

Query  182  GPRA----SKFVHQWIGPLRVIEDAG  203
              R      K    W GP RV+ + G
Sbjct  636  ARRGEKKTKKLAFAWHGPYRVVGNLG  661

>PHYSO_284505
Length=90

 Score = 73.9 bits (180),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 0/84 (0%)

Query  91   HSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECARERE  150
            HS     PNELMMGRRLR+PNELL  +     G   EYHR L++ M  +  +A+ A  ++
Sbjct  1    HSGTGYSPNELMMGRRLRAPNELLWASGVTQVGVFAEYHRALVRNMATATEAAKKALVKD  60

Query  151  QARQASYYERKVRQKRAFKPGDHV  174
            Q R+A+YY+R+VR    F  GD V
Sbjct  61   QLRRATYYDRQVRAHNEFAVGDSV  84

>PHYSO_483971
Length=170

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 9/81 (11%)

Query  182  GPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAE--RLIAHVSFLVSYHHPADFLTT  239
            G +A+KFVH+W+GP+R++  AG DN L+ RED +N E    IAHVSFL +Y+ P D L  
Sbjct  1    GRKATKFVHRWMGPIRIVSGAGCDNYLVRRED-KNGELREFIAHVSFLTTYNEPTDELQK  59

Query  240  TATDIVTEL------ERENAG  254
             A DI  +L      ERE AG
Sbjct  60   AAADIEAQLNYEGEVEREAAG  80

>PYIW_24812
Length=196

 Score = 75.1 bits (183),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 2/120 (2%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGP  195
            MK +  +A+ A  REQ R++  Y ++      F   D VW  +PPRG  A+K  H+W GP
Sbjct  1    MKANTEAAKAAITREQKRRSREYNKRASATHKFAMSDCVWFLRPPRGAAANKLDHRWQGP  60

Query  196  LRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADFLTTTATDIVTELERENAGD  255
              +  +AGYDN   ++ D    E L+ +VSF   Y  P         DI+ +L  E  G+
Sbjct  61   AVIKSNAGYDNFTAKKLD--TGELLLMYVSFFWRYDGPRARRDRMVADIMVDLAEEKRGE  118

>H257_03310
Length=526

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 10/151 (7%)

Query  48   LVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRL  107
            ++GLVERFNRT KD+VAI ++   Q DWD W+    YAY++  H T      ELMMGR  
Sbjct  1    MMGLVERFNRTIKDMVAIDVSP-TQNDWDEWLATLTYAYSTATHGTHGFPLMELMMGRVG  59

Query  108  RSPNELLRVTSQRDAGELNE----YHRRLLQTMKESHASAECAREREQARQASYYERKVR  163
            +S  +L     Q  A  + E    ++RR +  +    A A+      Q   A +Y +  R
Sbjct  60   KSVLDL-----QFPAAPIVESIPVWNRRFVAKLTRICAIAKSTLAPAQEETARHYNKGPR  114

Query  164  QKRAFKPGDHVWMFKPPRGPRASKFVHQWIG  194
             +   +PG  VW+ +  R    SK  H++ G
Sbjct  115  DRMKLRPGMWVWIARDWRDKGTSKLKHRFRG  145

>PITG_03025
Length=118

 Score = 71.2 bits (173),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)

Query  72   QRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDA  122
            +++WD WV   VYAYNSG+HSTV   PNELMMGRRL SP+ELLR  S  +A
Sbjct  4    KKNWDIWVDCTVYAYNSGQHSTVKSSPNELMMGRRLGSPSELLRRASVAEA  54

>PHYCA_133275
Length=138

 Score = 70.9 bits (172),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFN  56
            M  VVL FGP RE++ DGA E   ++  EL+ L+Q +Q+ PVPYRP L+GLVERF+
Sbjct  83   MDKVVLVFGPMREVMMDGAREFGSKMTAELLALMQTKQSTPVPYRPNLLGLVERFH  138

>PPTG_19342
Length=220

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 36/60 (60%), Gaps = 0/60 (0%)

Query  67   MNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELN  126
            M   DQ DWD WV F VYAYNSG+HSTVA  PN LM+GRR  +          + A +LN
Sbjct  1    MQSEDQNDWDNWVDFVVYAYNSGKHSTVAFSPNGLMIGRRNETGERSKHDKQTKAAADLN  60

>PHYSO_326852
Length=260

 Score = 64.7 bits (156),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 0/61 (0%)

Query  101  LMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYER  160
            LMMGRRLR+ NELLR  S  + G L  Y++RL   M+ +H  A+ A  REQARQA YY+R
Sbjct  13   LMMGRRLRALNELLRRASVAEEGPLLIYYQRLFDAMRSAHECAKNAWRREQARQACYYDR  72

Query  161  K  161
            K
Sbjct  73   K  73

>PHYRA_86947
Length=668

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 86/214 (40%), Gaps = 26/214 (12%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V   FG    L  D  P     V     ELL ++Q   + YRPQ  G  ER  +T    V
Sbjct  374  VFRSFGASSMLRHDQDPRFMSEVFTRFRELLGSKQRATLAYRPQANGQQERSVQTIMRSV  433

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRS---------PNELL  114
               + + DQ DWD      ++A N+   +T    P  L+ G   R          P+ L 
Sbjct  434  KAYVAEADQTDWDDHAERLMFALNTSFDATRLDTPFYLVHGWDARGTVSSMLGPKPSSLP  493

Query  115  RVTSQRDAGELNEYHRRLLQTMKESHASAEC-------AREREQARQASYYERKVRQKRA  167
              T+        E+ R+  +    + A AE        AR  EQ R+  + E   R K  
Sbjct  494  ERTA-------YEWRRKFQRDYSYAQACAEDLQKMAKRARSDEQTRK--WRELSERLKAG  544

Query  168  FKPGDHVWMFKPPRGPRAS-KFVHQWIGPLRVIE  200
            F+ GD VW++ P   P  S K  H W GP R+ E
Sbjct  545  FEQGDAVWLYIPRVQPGLSRKLAHMWHGPFRIDE  578

>PHYSO_285775
Length=85

 Score = 58.2 bits (139),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 11/86 (13%)

Query  87   NSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECA  146
            +  RHS     PNELMMGRRLR+PNEL             EYHR L++ M  +  +A+ A
Sbjct  10   HGARHSGTGYSPNELMMGRRLRAPNEL-----------SAEYHRALVRNMATATEAAKKA  58

Query  147  REREQARQASYYERKVRQKRAFKPGD  172
              ++Q R+A YY+ +VR    F  GD
Sbjct  59   LVKDQLRRARYYDWQVRAHNEFAIGD  84

>PHALS_12004
Length=640

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 99/236 (42%), Gaps = 12/236 (5%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            MK  V   G  + +L+D   + T +  + ++  +  Q      +RPQ  G  ER NR   
Sbjct  332  MKSYVKDHGLPKTILSDRDSKFTSKFWQAVITAMGTQHILSSAFRPQTDGQTERTNRFIG  391

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D +   +N   Q DWD ++ +A +AYN   H+T+ + P E  +G     P++   V S  
Sbjct  392  DYLRGVINPA-QNDWDEFLHWAEFAYNRRVHATIGMSPFEADLGYIPYMPDD---VVSDP  447

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWM----  176
            +  +L +  R  L   +     A+      Q R   YY++  R  + FK GD V +    
Sbjct  448  EFKKLEKAAREFLLRQEAFLKVAQDRMSEAQERMKHYYDKN-RFVQDFKIGDMVLLDGKN  506

Query  177  --FKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSY  230
               +     ++ K   ++IGP  V +    D+  L          +  H S L +Y
Sbjct  507  LDIRHKGYAQSKKLAPRFIGPFLVQKKVSRDSYELGLSKNLKLHPVF-HTSLLKTY  561

>PHYRA_86130
Length=2300

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 90/229 (39%), Gaps = 8/229 (3%)

Query  4     VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
             V  +FG    +  D  P           +L+  +Q   + YRPQ  G  ER  +T    +
Sbjct  1948  VFRRFGASEAIRHDREPGFMSDFFRAFNKLMGQRQRATLAYRPQANGAAERMVQTITRAI  2007

Query  64    AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNE---LLRVTSQR  120
              + +   DQRDWD +     +A N+    T    P  L+ G   RS  E    +  TS R
Sbjct  2008  KMYITDVDQRDWDEYAERLTFALNTAHDRTRNETPFYLVHGWDPRSTLEASLAIGNTSHR  2067

Query  121   DAGELNEYHRRLLQTMKESHASA-ECAREREQARQASYYERKVRQKRAFKPGDHVWMFKP  179
             D  E   +  R+ +  K + A A E  R+   AR     E     +   + G  VW++  
Sbjct  2068  DV-EAKRWRLRIQRHYKMARAQALELVRDAVDARARLRNEDAT--EHPIQAGSQVWLYLD  2124

Query  180   PRGP-RASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
                P  A K  H W GP RV E      + LE +        I H+S L
Sbjct  2125  RVKPGYARKLAHMWHGPFRVAELVSTYAVRLETDGTPYQLYPIVHISKL  2173

>PHYRA_82502
Length=3061

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 85/214 (40%), Gaps = 26/214 (12%)

Query  4     VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
             V   FG    L  D  P     V     ELL ++Q   + YRPQ  G  ER  +T    V
Sbjct  2717  VFRSFGASSMLRHDQDPRFMSEVFTRFRELLGSKQRATLAYRPQANGQQERSVQTIMRSV  2776

Query  64    AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRS---------PNELL  114
                + + DQ DWD      ++A N+   +T    P  L+ G   R          P+ L 
Sbjct  2777  KAYVAEADQTDWDDHAERLMFALNTSFDATHLDTPFYLVHGWDARGTVSSMLGPKPSSLP  2836

Query  115   RVTSQRDAGELNEYHRRLLQTMKESHASAEC-------AREREQARQASYYERKVRQKRA  167
               T+        E+ R+  +    + A AE        AR  EQ R+  + E   R K  
Sbjct  2837  ERTAY-------EWRRKFQRDYSYAQACAEDLQKMAKRARSDEQTRK--WRELSERLKAG  2887

Query  168   FKPGDHVWMFKPPRGPRAS-KFVHQWIGPLRVIE  200
             F+ GD VW++ P   P  S K  H W G  R+ E
Sbjct  2888  FEQGDAVWLYIPRVQPGLSRKLAHMWHGLFRIDE  2921

>PHYRA_75602
Length=1319

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 91/207 (44%), Gaps = 19/207 (9%)

Query  7     KFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAIS  66
             +FG   E ++D       +V++EL   L A Q     + P + G VER NR    ++ + 
Sbjct  1006  RFGLPEEWVSDNGSHFKAQVMKELAGRLHATQKFVPVHTPWINGTVERVNRDILQVLRVM  1065

Query  67    MN--KGDQRDWDRWVPFAVYAYNS------GRHSTVALIPNELMMGRRLRSPNELLRVTS  118
             +   + D  +W   +P      N       GRH+     P EL  G    SP + + V  
Sbjct  1066  LLELQLDTGNWLYLLPIIQANLNHAAVESLGRHA-----PVELFAGLPAASPLDCVVVPD  1120

Query  119   QRDAGELNEYHRRLLQTMKESHAS-----AECAREREQARQASYYERKVRQKRAFKPGDH  173
              R    L+    RL + +   HA      +E   ER++ ++ +   R     R F+PGD+
Sbjct  1121  GRTPRVLSLDLERLSEQLDNLHAHFREMHSEVV-ERKERKRLTNMARSKGSTRNFEPGDY  1179

Query  174   VWMFKPPRGPRASKFVHQWIGPLRVIE  200
             V   +  +  ++SK + +W+GP RV E
Sbjct  1180  VLWLRVDKRLQSSKLLVRWVGPFRVTE  1206

>PHYRA_78074
Length=1098

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 100/232 (43%), Gaps = 16/232 (7%)

Query  7    KFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAIS  66
            ++G  + L++D A     +++EEL    Q  Q+  + Y P + G VER NR    ++ + 
Sbjct  737  RYGMPQLLISDTATHFKNQLLEELCHKTQMTQSVTLAYCPWINGSVERLNRDILQVLRVM  796

Query  67   M--NKGDQRDWDRWVPFAVYAYNSGRHSTVALI----PNELMMGRRLRSPNELLR--VTS  118
            +   K +Q +W   +P      N   HS VA +    P E+ +G+ L   + +    VT+
Sbjct  797  LLEYKVEQDNWAALLPLIQANLN---HSPVASLANHAPAEVFLGKILIGSDAIAANVVTT  853

Query  119  QRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFK  178
               +  + E    L  ++   H     A+E++  R  S  +R  R    F  GD+V   +
Sbjct  854  GDFSPGVREAVGNLRASLDGMHREVATAKEKQTKRNQS-NQRGARSVN-FHVGDYVLWSR  911

Query  179  PPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSY  230
                 + +K    W+GP RVI   G +    E E    A    AH S L  Y
Sbjct  912  VDAKKKGNKLSVTWVGPYRVI---GANANSFEIEHLITATTKFAHASRLKMY  960

>PITG_20362
Length=249

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)

Query  136  MKESHASAECAREREQARQASYYERKVRQKRAFKPGDHV  174
            M++S+ +AE AREREQ RQASYY RKV+ +RAFKPGD  
Sbjct  1    MRKSYEAAESAREREQRRQASYYNRKVKNRRAFKPGDRT  39

>PHYRA_85542
Length=304

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 81/188 (43%), Gaps = 6/188 (3%)

Query  44   YRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMM  103
            YRPQ  G  ER  +T    + + +   +Q+DWD +     +A N+ +       P  L+ 
Sbjct  3    YRPQTNGTAERMVQTLTRALKMYVADVNQQDWDEYAERLTFALNTAQDRVRGDTPFYLIH  62

Query  104  GRRLRSPNEL-LRVTSQRDAGELNEYHRRLLQTM--KESHASAECAREREQARQASYYER  160
            G   RS  E  L V S R     +   R  +Q+   +      E  RE  Q+ QA  + +
Sbjct  63   GWDPRSTLEAALPVGSTRRRDHESRRWRFHMQSQYRRAREQVNEWLREAIQS-QADEHNQ  121

Query  161  KVRQKRAFKPGDHVWMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAER  219
             VR +   + G HVW++    +   A K VH W GP RV+E  G     LE    E    
Sbjct  122  NVRSQE-IEAGTHVWLYLDRVKEGYARKLVHMWHGPFRVVEMVGNHAARLESAGTEYRLF  180

Query  220  LIAHVSFL  227
             I HVS L
Sbjct  181  PIVHVSML  188

>PHYRA_77065
Length=1091

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 95/221 (43%), Gaps = 20/221 (9%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
              +V+  +G    + +D  P+ T R    LV L+  +      +R Q  G  ER NRT +
Sbjct  677  FNNVIRYYGIPSTITSDRDPKFTSRFWTALVNLMMIKAAMTSAHRAQADGQTERQNRTLE  736

Query  61   DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
            D +  S++     DW+  +P   YA+ +   S+  L P  +  GR+  +P     + +  
Sbjct  737  DSLRCSISYHGN-DWNEHLPMIEYAHATLVSSSSTLSPFFVDTGRKPTNP-----LDTGA  790

Query  121  DAGELN----EYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWM  176
            DA  +     E+  R +Q  +E    A       QA Q  +Y+++ R +  FK GDH  +
Sbjct  791  DAASVPRSRVEHASRFVQHRQEVIERARKNLLDAQAAQKKFYDKR-RAENPFKVGDHALL  849

Query  177  ---------FKPPRGPRASKFVHQWIGPLRVIEDAGYDNLL  208
                            R+ KF+  +IGP  ++E  G   LL
Sbjct  850  STQDLNISHATAETTLRSRKFIPCFIGPYTILEIRGNVALL  890

>PHYRA_77063
Length=1574

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 96/221 (43%), Gaps = 20/221 (9%)

Query  1     MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
               +V+  +G    +++D  P+ T R    LV L+  +      +R Q  G  ER NRT +
Sbjct  1140  FNNVIRYYGIPSTIISDRDPKFTSRFWTALVNLMMIKAAMTSAHRAQADGQTERQNRTLE  1199

Query  61    DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
             D +  S++     DW+  +P   YA+ +   S+  L P  +  GR+   P  LL   +  
Sbjct  1200  DSLRCSISYHGN-DWNEHLPMIEYAHATLVSSSSKLSPFFVDTGRK---PTYLLDTGA--  1253

Query  121   DAGELN----EYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWM  176
             DA  +     E+  R +Q  +E    A        A Q  +Y+++ R +  FK GD   +
Sbjct  1254  DAASVPHSRVEHASRFVQHRQEVIERARKNLLDAHATQKKFYDKR-RAENPFKVGDLALL  1312

Query  177   ----FKPPRGP-----RASKFVHQWIGPLRVIEDAGYDNLL  208
                  K          R+ KF+ ++IGP  ++E  G   LL
Sbjct  1313  STQDLKISHATAETTLRSRKFIPRFIGPYAILEIRGNVALL  1353

>PPTG_24441
Length=65

 Score = 48.1 bits (113),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  103  MGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQAS  156
            MG  LRSPNE+LR     +AGEL  YH +LL+ M+ S   AE AR  EQAR ++
Sbjct  1    MGPCLRSPNEILRRPVLTEAGELPVYHAKLLRAMERSERFAERARRMEQARPST  54

>PHYRA_85959
Length=390

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 63/234 (27%), Positives = 88/234 (38%), Gaps = 18/234 (8%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G VER  +T    +
Sbjct  49   VFRRFGASEAIRHDREPGFMSDFFRAFSRIVGQRQRATMAYRPQANGTVERMVQTLTRAL  108

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
             + +   +Q+DWD +     +A N+         P  L+ G   RS  E    L  T  R
Sbjct  109  KMYVADVNQQDWDEYAERLTFAINTAHDRVRGETPFYLVHGWDPRSTLEASLPLGSTRHR  168

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQAR-QASYYERKVRQKRAFKP-----GDHV  174
            D  E   +  R+ Q  +        ARE   AR + +   R  R     +P     G  V
Sbjct  169  DR-EPRRWRYRIQQQYQR-------AREEVNARLKEAIQARADRHNDGIRPHQIEAGSQV  220

Query  175  WMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            W++    +   A K  H W GP RV E  G     LE    E     I HVS L
Sbjct  221  WLYLDRVKEGYARKLAHMWHGPFRVREMIGPYAARLEVAGTEYRLFPIVHVSKL  274

>PHYSO_247331
Length=1460

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 77/169 (46%), Gaps = 20/169 (12%)

Query  42    VPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNEL  101
             V +R Q  G +ER NRT ++ +   +    Q DWD  +  A +A NS  +S+  L P E 
Sbjct  1194  VAHRAQGDGQMERMNRTLEEYLRCFVGPL-QDDWDVHLANAEFAVNSTVNSSTKLAPFEA  1252

Query  102   MMGRRLRSP-----NELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQAS  156
              +G    +P      +L  V   R   E +E    +L   +E+ A A       Q R   
Sbjct  1253  DLGYIPLNPLQLASEQLESVPKSRRGAEFHERQAAILLRCREALAQA-------QERMRD  1305

Query  157   YYERKVRQKRAFKPGDHVWM----FKPPRG--PRASKFVHQWIGPLRVI  199
              Y+R  R ++ F+ GD V++      P     P ++KF  +WIGP  V+
Sbjct  1306  VYDRN-RVEQIFEVGDRVYLSTQNLNPKHSGLPNSTKFGPKWIGPYTVV  1353

>PHYRA_86797
Length=697

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 61/228 (27%), Positives = 89/228 (39%), Gaps = 6/228 (3%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  356  VFRRFGASEAIRHDREPGFMSDFFRAFSRIVGQKQRATMAYRPQANGTAERMVQTLTRAL  415

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNE-LLRVTSQRDA  122
             + +   +Q+DWD +     +A N+         P  L+ G   RS  E  L V S R  
Sbjct  416  KMYVADVNQQDWDEYAERLTFAINTAHDRVRGDTPFYLIHGWDPRSTLEAALPVGSTRRR  475

Query  123  GELNEYHRRLLQTM--KESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMF-KP  179
                   R  +Q+   +      E  RE  Q+R A  + + VR +   + G  VW++   
Sbjct  476  DREPRRWRFHMQSQYRRAREQVNERLREAIQSR-ADEHNQNVRSQE-IEAGAQVWLYLDR  533

Query  180  PRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
             +   A K  H W GP RV+E  G     LE    E     I HVS L
Sbjct  534  VKEGYARKLAHMWHGPFRVVEMIGNHAARLETAGTEYRLFPIVHVSKL  581

>PHYCA_110676
Length=1314

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/211 (26%), Positives = 85/211 (40%), Gaps = 20/211 (9%)

Query  4     VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
             V  +FG    +  D  P            ++  +Q+  + YRPQ  G  ER  +T    +
Sbjct  989   VFRRFGASEVIRHDREPGFMADFFRAFNRIIGHKQSPTMAYRPQSNGSAERKVQTLTRSL  1048

Query  64    AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
              + +   DQRDWD +     +A N+    T    P  L  G   RS  E    + +T  R
Sbjct  1049  KMYVADVDQRDWDEYAERLTFALNTAHDRTRGDTPFYLAHGWDPRSTLEAALPIGITGHR  1108

Query  121   D------AGELNEYHRRLLQTMKESHASAECAREREQAR-QASYYERKVRQKRAFKPGDH  173
             D         + E+++R  + + E        R R+  R +A  +  +VR  +  + G  
Sbjct  1109  DRDARRWRNHIQEHYQRAREHVNE--------RLRDAIRSRADRHNEEVRPHK-IETGSQ  1159

Query  174   VWMF-KPPRGPRASKFVHQWIGPLRVIEDAG  203
             VW++    +   A K  H W GP RV E  G
Sbjct  1160  VWLYLDRVKVGYAKKLAHMWHGPFRVAELIG  1190

>H257_13890
Length=142

 Score = 48.9 bits (115),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 9/61 (15%)

Query  4   VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
           VV  FGP REL++D A       +++L         +PV YRP L+GLVERFN+  KD++
Sbjct  17  VVCVFGPCRELMSDRASFGVSPNVKQL---------HPVAYRPALMGLVERFNKAVKDML  67

Query  64  A  64
           +
Sbjct  68  S  68

>PYU1_G015063
Length=580

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (44%), Gaps = 1/110 (1%)

Query  14   LLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQR  73
            +++D  P  T     +L  LL           P+     ER NR  +DI+  S+     R
Sbjct  34   IVSDRDPRFTAAFWYKLFRLLGTDLALSTADHPETDEQTERVNRVVEDILR-SIAVDHPR  92

Query  74   DWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAG  123
            DW RW+P+A +A NS  H++ A+ P      R  R P  L     +  AG
Sbjct  93   DWSRWLPYAEFAINSSEHASTAVTPFYFNSLRHPRVPATLFEGIERSAAG  142

>PYU1_G014831
Length=889

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (44%), Gaps = 1/110 (1%)

Query  14   LLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQR  73
            +++D  P  T     +L  LL           P+     ER NR  +DI+  S+     R
Sbjct  34   IVSDRDPRFTAAFWYKLFRLLGTDLALSTADHPETDEQTERVNRVVEDILR-SIAVDHPR  92

Query  74   DWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAG  123
            DW RW+P+A +A NS  H++ A+ P      R  R P  L     +  AG
Sbjct  93   DWSRWLPYAEFAINSSEHASTAVTPFYFNSLRHPRVPATLFEGIERSAAG  142

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (44%), Gaps = 1/110 (1%)

Query  14   LLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQR  73
            +++D  P  T     +L  LL           P+     ER NR  +DI+  S+     R
Sbjct  669  IVSDRDPRFTAAFWYKLFRLLGTDLALSTADHPETDEQTERVNRVVEDILR-SIAVDHPR  727

Query  74   DWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAG  123
            DW RW+P+A +A NS  H++ A+ P      R  R P  L     +  AG
Sbjct  728  DWSRWLPYAEFAINSSEHASTAVTPFYFNSLRHPRVPATLFEGIERSAAG  777

>PHYRA_86197
Length=528

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 63/236 (27%), Positives = 86/236 (36%), Gaps = 22/236 (9%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  185  VFRRFGASEVIRHDREPGFMSDFFRAFSRIVGQKQRATMAYRPQANGTAERMVQTLTRSL  244

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
             + ++  +QRDWD +     +A N+ +       P  L  G   RS  E    L  T +R
Sbjct  245  KMYVSDVNQRDWDEYAERLTFALNTAQDRVRGDTPFYLAHGWDPRSTLEAALPLGSTRRR  304

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQ---ASYYERKVRQKRAFKP-----GD  172
            D     +  RR        H      R REQ R+    +   R  R     +P     G 
Sbjct  305  D-----QEPRRW-----RYHVQGHYQRAREQVRERLREAIRGRANRHNENLRPHNIAAGA  354

Query  173  HVWM-FKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
             VW+     +   A K  H W GP RV E  G     LE    E     I HVS L
Sbjct  355  QVWLHLDRVKEGFARKLAHLWHGPFRVAEMIGDHAARLEIAGSEYRIFPIVHVSKL  410

>PHYRA_85544
Length=317

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/275 (23%), Positives = 104/275 (38%), Gaps = 48/275 (17%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P     V +   E++Q++    + YRPQ  G  ER  +T    V
Sbjct  21   VYRRFGAPTLIRHDRDPRFMSEVFQAFAEMMQSRSRATLSYRPQANGQQERSVKTVMQSV  80

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAG  123
             +      Q+DWD      ++A N+ +  T    P  L+ G   +S    +  + +R  G
Sbjct  81   RVYAEDPLQQDWDVIAERLIFAINNSQDGTRKDTPFYLVHGWDAQSTLRAMSSSLKRGFG  140

Query  124  ----------ELNEYHRRLLQTMKESHASAECAR--------------------------  147
                      E+N   + +   M   + S E AR                          
Sbjct  141  GQTDALAWRREVNR-QQEISWKMAMEYQSVEKARRAREHNESLERRERAAVPNVDEDETP  199

Query  148  EREQARQASYYERKVRQKRA-FKPGDHVWMFKPPRGPRAS-KFVHQWIGPLRV---IEDA  202
            +  Q    +  +  V   R+ F+PG  VW++     P  + K  H+W GP R+   IE+ 
Sbjct  200  DESQVETTATSDSTVEGPRSLFQPGSRVWLYMERVKPGLTKKLAHRWHGPFRIKKKIEEF  259

Query  203  GYDNLLLEREDGENAERL--IAHVSFLVSYHHPAD  235
             Y+  L +R    +  R   + HVS L + +   D
Sbjct  260  AYELELPDR----SGYRFYPVVHVSRLKAVNESGD  290

>PHYCA_133059
Length=248

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 74/199 (37%), Gaps = 2/199 (1%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q+  + YRPQ  G  ER  +T    +
Sbjct  49   VFRRFGASEVIRHDREPGFMSDFFRAFNRIVGQRQSATMAYRPQANGTAERMVQTSTRAL  108

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNE-LLRVTSQRDA  122
             + +   DQRDWD +     +A N+         P  L+ G   RS  E  + + S R  
Sbjct  109  KMYVEDLDQRDWDEYAERLTFAINTAHDRIRDDTPFFLVHGWDPRSTLEATIPIGSTRRQ  168

Query  123  GELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMF-KPPR  181
                   R  +Q   +        R RE     +    +  +    +PG  VW++    +
Sbjct  169  DRDPRRWRNQIQRYYQQAREQVNDRLREAISDRAARHNEELRPHQIEPGSRVWLYLDRVK  228

Query  182  GPRASKFVHQWIGPLRVIE  200
               A K  H W GP RV E
Sbjct  229  EGYARKLAHLWHGPFRVAE  247

>PHYRA_79389
Length=390

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 87/234 (37%), Gaps = 18/234 (8%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  49   VFRRFGASEAIRHDREPGFMSDFFRAFSRIVGQRQRATMAYRPQANGTAERMVQTLTRAL  108

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
             + +   +Q+DWD +     +A N+         P  L+ G   RS  E    L  T  R
Sbjct  109  KMYVADVNQQDWDEYAERLTFAINTAHDRVRGETPFYLVHGWDPRSTLEASLPLGSTRCR  168

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQAR-QASYYERKVRQKRAFKP-----GDHV  174
            D  E   +  R+ Q  +        ARE   AR + +   R  R     +P     G  V
Sbjct  169  DR-EPRRWRYRIQQQYQR-------AREEVNARLKEAIPTRADRHNDGIRPHQIEAGSQV  220

Query  175  WMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            W++    +   A K  H W GP RV E  G     LE    E     I HVS L
Sbjct  221  WLYLDRVKEGYARKLAHMWHGPFRVREMIGPYAARLEVAGTEYRLFPIVHVSKL  274

>PHYRA_87083
Length=395

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 84/234 (36%), Gaps = 18/234 (8%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  52   VFRRFGASEIIRHDREPGFMLDFFRAFSGIVGQKQRATMAYRPQANGTAERMVQTLTRSL  111

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAG  123
             + ++  +QRDWD +     +A N+ +       P  L  G   RS  E         A 
Sbjct  112  KMYVSDVNQRDWDEYAERLTFALNTAQDRVRGDTPFYLAHGWDPRSTLEA--------AQ  163

Query  124  ELNEYHRRLLQTMK-ESHASAECAREREQARQ---ASYYERKVRQKRAFKP-----GDHV  174
             L    RR  +  +   H      R REQ R+    +   R  R     +P     G  V
Sbjct  164  PLGSTRRRDQEPRRWRYHVQEHYQRAREQVRERLREAIRGRANRHNEDLRPHNIAVGAQV  223

Query  175  WM-FKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            W+     +   A K  H W GP RV E  G     LE    E     I HVS L
Sbjct  224  WLHLDRVKEGYARKLAHLWHGPFRVAEMIGDHAARLEIAGSEYRIFPIVHVSKL  277

>PHYRA_85739
Length=971

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 88/231 (38%), Gaps = 12/231 (5%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  630  VFRRFGASEAIRHDREPGFMSDFFRAFNRIMGQRQRATMAYRPQANGTAERMVQTLTRAL  689

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL-LRVTSQRDA  122
             + +   +Q+DWD +     +A N+         P   + G   RS  E  L + S R  
Sbjct  690  KMYVADTNQQDWDEYAERLTFAINTAHDRVRGDTPFYFVHGWDPRSTLEASLPLGSTR--  747

Query  123  GELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKP-----GDHVWMF  177
               +   RR    +++ +  A   +E  +  +A+   R  +     +P     G  VW++
Sbjct  748  -RCDHEPRRWRYHIQQQYQRAR--KEVNERVKAAIQARADQHNEGVRPHEIEAGTRVWLY  804

Query  178  -KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
                +   A K  H W GP RVIE  G     LE    E     I HVS L
Sbjct  805  LDRVKEGYARKLAHMWHGPFRVIEMVGRYAARLEVAHTEYRLFPIVHVSKL  855

>PHYCA_41909
Length=82

 Score = 44.7 bits (104),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 41/75 (55%), Gaps = 1/75 (1%)

Query  14  LLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQR  73
           +++D   + T    ++L ELL  QQ     +RPQ  G+ ER N+T ++ +  + +  D  
Sbjct  9   VVSDRDAKFTSTFWKKLCELLGVQQKMTTAFRPQGDGISERLNQTLENYLR-AFSNADSD  67

Query  74  DWDRWVPFAVYAYNS  88
           DWD  +  A +AYN+
Sbjct  68  DWDDHLCLAEFAYNA  82

>PHYRA_85813
Length=2392

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 88/231 (38%), Gaps = 12/231 (5%)

Query  4     VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
             V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  2051  VFRRFGASEAIRHDREPGFMSDFFRAFNRIMGQRQRATMAYRPQANGTAERMVQTLTRAL  2110

Query  64    AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL-LRVTSQRDA  122
              + +   +Q+DWD +     +A N+         P   + G   RS  E  L + S R  
Sbjct  2111  KMYVADTNQQDWDEYAERLTFAINTAHDRVRGDTPFYFVHGWDPRSTLEASLPLGSTR--  2168

Query  123   GELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKP-----GDHVWMF  177
                +   RR    +++ +  A   +E  +  +A+   R  +     +P     G  VW++
Sbjct  2169  -RCDHEPRRWRYHIQQQYQRAR--KEVNERVKAAIQARADQHNEGVRPHEIEAGTRVWLY  2225

Query  178   -KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
                 +   A K  H W GP RVIE  G     LE    E     I HVS L
Sbjct  2226  LDRVKEGYARKLAHMWHGPFRVIEMVGRYAARLEVAHTEYRLFPIVHVSKL  2276

>PHYRA_79467
Length=1349

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (43%), Gaps = 20/221 (9%)

Query  1     MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
               +V+  +G    + +D   + T R    LV L++ +      +R Q  G  ER NRT +
Sbjct  985   FNNVIRYYGIPSTITSDRDTKFTSRFWTVLVNLMKIKAAITTAHRAQADGQTERQNRTLE  1044

Query  61    DIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQR  120
             + +  S++     DW+  +P   YA+ +   S+  L P  +  GR+   P  LL   +  
Sbjct  1045  ESLRCSISYHGN-DWNEHLPMIEYAHATLVSSSSKLSPFFVDTGRK---PTYLLDTGA--  1098

Query  121   DAGELN----EYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWM  176
             DA  +     E+  R +Q  +E    A        A Q  +Y+++ R +  FK GD   +
Sbjct  1099  DAASVPHSRVEHASRFVQHRQEVIERARKNLLDAHATQKKFYDKR-RAENPFKVGDLALL  1157

Query  177   ----FKPPRGP-----RASKFVHQWIGPLRVIEDAGYDNLL  208
                  K          R+ KF+ ++IGP  ++E  G   LL
Sbjct  1158  STQDLKISHATAETTLRSRKFIPRFIGPYAILEIRGNVALL  1198

>PHYCA_116403
Length=311

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 75/199 (38%), Gaps = 55/199 (28%)

Query  7    KFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAIS  66
            +FG  R L++D        V+ ++ +LL+ +Q   + Y P + G VER NR   DI+ + 
Sbjct  45   RFGTPRLLISDQGSHFKNDVVSQVCKLLEIEQELVLVYAPWINGTVERLNR---DILQVV  101

Query  67   MNKGDQRDWDRWVPFAVYAYNSGRHSTVALI----PNELMMGRRLRSPNELLRVTSQRDA  122
                      RWV        +  H+ V  +    P EL  G R  +P E +        
Sbjct  102  ----------RWVYVLPLVQGNLNHTPVTSLGNRTPAELFTGLRRSTPFEPI--------  143

Query  123  GELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRG  182
                    R LQ M+ S  +  C                      F  GD V   +  + 
Sbjct  144  --------RRLQNMQRSKGTP-C---------------------NFSVGDFVLWSRIDKR  173

Query  183  PRASKFVHQWIGPLRVIED  201
               +K + +WIGP  VIED
Sbjct  174  LSTNKLLARWIGPFEVIED  192

>PHYRA_71960
Length=375

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 72/166 (43%), Gaps = 6/166 (4%)

Query  14   LLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQR  73
            +++D  P+   +    L +L+         YR Q  G  ER N   +D +   ++     
Sbjct  59   IISDRDPKFIPKFWSSLTKLMGISLHMTTSYRAQADGQTERQNLILEDALRCRVSYHGS-  117

Query  74   DWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLR---VTSQRDAGELNEYHR  130
            DW   +    YA+ +   ++  + P EL  GR+ R+P   L    + +Q   G + EY +
Sbjct  118  DWSEHLGTIEYAHPTLVSASTGMSPFELDTGRKERNPINPLNNPTIVTQMQQG-IGEYAK  176

Query  131  RLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWM  176
            R  +        A+    R Q RQ +YY++K+     FK GD V +
Sbjct  177  RFQEQRPVIIQQAKTQLRRAQERQKNYYDQKI-TAITFKTGDLVML  221

>PHYCA_111946
Length=853

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 87/234 (37%), Gaps = 14/234 (6%)

Query  2    KDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKD  61
            + V  +FG    +  D  P     V      ++  +Q+  + YRPQ  G  ER  +T   
Sbjct  507  ESVFRRFGASEVIRHDREPGFMADVFRAFNRIVGQRQSPTMAYRPQANGTAERMVQTLTR  566

Query  62   IVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRD  121
             + + +   +Q+DWD +     +A N+ +       P  L+ G   RS  E     +   
Sbjct  567  SIKMYVADMNQKDWDEYAERLTFALNTAQDRVRGDTPFFLVHGWDPRSTLE-----ASLP  621

Query  122  AGELNEYHRRLLQTMKESHASAECARE--REQARQASYYERKVRQKRAFKP-----GDHV  174
             G      R   +         + ARE   E+ R+A    R  R     +P     GD V
Sbjct  622  VGNTRSRDRDPRRWRNRVQGHYQRAREEVNERLREA-IQSRADRHNEDLRPHNIVAGDQV  680

Query  175  WMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            W++    +   A K  H W GP RV E        LE    E     I HVS L
Sbjct  681  WLYLDRVKVGYARKLAHLWHGPFRVAEMIDQHAAKLEIAGTEYRIFPIVHVSKL  734

>PHYCA_82778
Length=69

 Score = 43.1 bits (100),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 1/62 (2%)

Query  44   YRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMM  103
            Y PQ  GLVERFN T   ++ + +++  Q DWD ++P  ++AY +  H  +   P   + 
Sbjct  9    YHPQTQGLVERFNGTLLGMLRMYVSE-SQDDWDLYLPRVLFAYRTSYHEALVDSPFFSLY  67

Query  104  GR  105
            GR
Sbjct  68   GR  69

>PHYRA_81147
Length=682

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 95/230 (41%), Gaps = 18/230 (8%)

Query  1    MKDVVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWK  60
            M D   +FG  +  ++D        ++ EL + L+  QT    Y P + G VER NR   
Sbjct  364  MIDWYKRFGMLQIWMSDQGTHFKNELMAELSQRLKGVQTFVPVYTPWVNGTVERLNRDIL  423

Query  61   DIV-AISMN-KGDQRDWDRWVPFAVYAYNSGRHSTV----ALIPNELMMGRRLRSPNELL  114
             +V A+ +  + D ++W+  +P      N   H+ V     + P EL  G     P + L
Sbjct  424  HVVRALLLEMQLDTKNWEYLLPVVQANLN---HTPVLSLGGVAPVELFTGLSCPPPLDTL  480

Query  115  RVTSQRDA---GELNEYHRRLLQ---TMKESHASAECAREREQARQASYYERKVRQKRAF  168
             +          +L   H  L+Q   ++ E H      +ER +  Q S  +  +     F
Sbjct  481  LLPGADKPLQHIDLANVHNELVQLRASLAEMHGEVTDKKERRRMYQLSEKQGTLCN---F  537

Query  169  KPGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAE  218
              GD+V   +     R  K + +W+GP RV E   Y  ++    +G+  E
Sbjct  538  VVGDYVLWSRVDSRLRGGKLLVRWVGPFRVTEARPYSFMVQHLINGKEYE  587

>PYU1_G014832
Length=529

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query  52   VERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPN  111
             ER NR  +DI+  S+     RDW RW+P+A +A NS  H++ A+ P      R  R P 
Sbjct  21   TERVNRVVEDILR-SIAVDHPRDWSRWLPYAEFAINSSEHASTAVTPFYFNSLRHPRVPA  79

Query  112  ELLRVTSQRDAG  123
             L     +  AG
Sbjct  80   TLFEGIERSAAG  91

>PHYRA_86012
Length=304

 Score = 46.6 bits (109),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 78/190 (41%), Gaps = 6/190 (3%)

Query  42   VPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNEL  101
            + YRPQ  G  ER  +T    + + +   +Q+DWD +     +A N+         P  L
Sbjct  1    MAYRPQANGTAERMVQTLTRALKMYVADVNQQDWDEYAERLTFAINTAHDRVRGDTPFYL  60

Query  102  MMGRRLRSPNE-LLRVTSQRDAGELNEYHRRLLQTM--KESHASAECAREREQARQASYY  158
            + G   RS  E  L V S R         R  +Q+   +      E  RE  Q+R A  +
Sbjct  61   IHGWDPRSTLEAALPVGSTRRRDREPRRWRFHMQSQYRRAREQVNERLREAIQSR-ADEH  119

Query  159  ERKVRQKRAFKPGDHVWMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENA  217
             + VR +   + G  VW++    +   A K  H W GP RV+E  G     LE    E  
Sbjct  120  NQNVRSQE-IEAGAQVWLYLDRVKEGYARKLAHMWHGPFRVVEMVGNHAARLETAGTEYR  178

Query  218  ERLIAHVSFL  227
               I HVS L
Sbjct  179  LFPIVHVSKL  188

>PHYRA_86072
Length=913

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 88/236 (37%), Gaps = 22/236 (9%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  570  VFRRFGASEVIRHDREPGFMSDFFRAFSRIVGQKQRATMAYRPQANGTAERMVQTLTRSL  629

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
             + ++  +QRDWD +     +A N+ +       P  L  G   RS  E    L  T +R
Sbjct  630  KMYVSDVNQRDWDEYAERLTFALNTAQDRVRGDTPFYLAHGWDPRSTLEAALPLGSTRRR  689

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQ---ASYYERKVRQKRAFKP-----GD  172
            D     +  RR    ++E +      R REQ R+    +   R  R     +P     G 
Sbjct  690  D-----QEPRRWRYHVQEHY-----QRAREQVRERLREAIRGRANRHNEDLRPHNIAVGA  739

Query  173  HVWM-FKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
             VW+     +   A K  H W GP RV E        LE    E     I HVS L
Sbjct  740  QVWLHLDRVKEGYARKLAHLWHGPFRVAEMIDDHAARLEIAGSEYRIFPIVHVSKL  795

>PHYRA_85955
Length=390

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 86/234 (37%), Gaps = 18/234 (8%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  49   VFRRFGASEAIRHDREPGFMSNFFRAFSRIVGQRQRATMAYRPQANGTAERMVQTLTCAL  108

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
             + +   +Q+DWD +     +A N+         P  L+ G   RS  E    L  T +R
Sbjct  109  KMYVADVNQQDWDEYAERLTFAINTAHDRVRGETPFYLVHGWDPRSTLEASLPLGSTRRR  168

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQAR-QASYYERKVRQKRAFKP-----GDHV  174
            D       +R   Q  +        ARE   AR + +   R  R     +P     G  V
Sbjct  169  DREPRRWRYRIQQQYQR--------AREEVNARLKEAIQARADRHNDGIRPHQIEVGSQV  220

Query  175  WMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            W++    +   A K  H W GP RV E  G     LE    E     I HVS L
Sbjct  221  WLYLDRVKEGYARKLAHVWHGPFRVREMIGPYAARLEVAGTEYRLFPIVHVSKL  274

>PHYRA_85793
Length=501

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 95/235 (40%), Gaps = 32/235 (14%)

Query  7    KFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV--A  64
            +FG     ++D        V+ EL   L+ QQT    Y P + G +ER NR    +V   
Sbjct  45   RFGIPPVWVSDNGTHFKNEVVAELSRRLRTQQTFTPAYSPWVNGSIERVNRDILQVVRAM  104

Query  65   ISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALI----PNELMMGRRLRSP---------N  111
            I   K   +DW   VP      N   H+ V  +    P EL  G +  +P         N
Sbjct  105  ILSYKISYKDWVYLVPIIQSNLN---HTAVPSLGNRAPVELFTGLQCPTPLSEFYLPNSN  161

Query  112  ELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRA--FK  169
            EL +V   +   +++ Y   L  ++ E H    C  E ++ +Q    +++ R +    F 
Sbjct  162  ELQQVPPSQ---QIDSYLTDLRNSLHEMH----CKVEDQRLKQRLLNKKRERGENLVNFA  214

Query  170  PGDHVWMFKPPRGPRASKFVHQWIGPLRVIEDAGYD----NLLLEREDGENAERL  220
             GD V   +       +K    WIGP RVI    +     +L+ E E   +A RL
Sbjct  215  VGDFVLRSRVDEK-NGNKLQVTWIGPYRVIRADSHSFRVQHLVTEDELDVHASRL  268

>PHYRA_86364
Length=1384

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 88/236 (37%), Gaps = 22/236 (9%)

Query  4     VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
             V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  1041  VFRRFGASEVIRHDREPGFMSDFFRAFSRIVGQKQRATMAYRPQANGTAERMVQTLTRSL  1100

Query  64    AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
              + ++  +QRDWD +     +A N+ +       P  L  G   RS  E    L  T +R
Sbjct  1101  KMYVSDVNQRDWDEYAERLTFALNTAQDRVRGDTPFYLAHGWDPRSTLEAALPLGSTRRR  1160

Query  121   DAGELNEYHRRLLQTMKESHASAECAREREQARQ---ASYYERKVRQKRAFKP-----GD  172
             D     +  RR    ++E +      R REQ R+    +   R  R     +P     G 
Sbjct  1161  D-----QEPRRWRYHVQEHY-----QRAREQVRERLREAIRGRANRHNEDLRPHDIAVGA  1210

Query  173   HVWM-FKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
              VW+     +   A K  H W GP RV E        LE    E     I HVS L
Sbjct  1211  QVWLHLDRVKEGYARKLAHLWHGPFRVAEMIDDHAARLEIAGSEYRIFPIVHVSKL  1266

>PHYRA_74987
Length=306

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 73/196 (37%), Gaps = 18/196 (9%)

Query  42   VPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNEL  101
            + YRPQ  G  ER  +T    + + ++  +QRDWD +     +A N+ +       P  L
Sbjct  1    MAYRPQANGTAERMVQTLTRSLKMYVSDVNQRDWDEYAERLTFALNTAQDRVRGDTPFYL  60

Query  102  MMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMK-ESHASAECAREREQARQ---ASY  157
              G   RS  E         A  L    RR  +  +   H      R REQ R+    + 
Sbjct  61   AHGWDPRSTLEA--------ALPLGSTRRRDQEPRRWRYHVQEHYQRAREQVRERLREAI  112

Query  158  YERKVRQKRAFKP-----GDHVWM-FKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLER  211
              R  R     +P     G  VW+     +   A K  H W GP RV E  G     LE 
Sbjct  113  RGRANRHNEDLRPHNIAVGAQVWLHLDRVKEGYARKLAHLWHGPFRVAEMIGDHAARLEI  172

Query  212  EDGENAERLIAHVSFL  227
               E     I HVS L
Sbjct  173  AGSEYRIFPIVHVSKL  188

>PHYRA_85373
Length=1188

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 88/228 (39%), Gaps = 6/228 (3%)

Query  4     VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
             V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +     +
Sbjct  911   VFRRFGASEAIRHDREPGFVSDFFRAFSRIVGQKQRATMAYRPQANGTAERMVQMLTRAL  970

Query  64    AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNE-LLRVTSQRDA  122
              + +   +Q+DWD +     +A N+         P  L+ G   RS  E  L V S R  
Sbjct  971   KMYVADVNQQDWDEYAERLTFAINTAHDRVRGDTPFYLIHGWDPRSTLEAALPVGSTRRR  1030

Query  123   GELNEYHRRLLQTM--KESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMF-KP  179
                 +  R  +Q+   + +    E  RE  Q+R    + + VR +   + G  VW++   
Sbjct  1031  DREPKRWRFHMQSQYRRATEQVNERLREAIQSRDDE-HNQNVRSQE-IEAGAQVWLYLDR  1088

Query  180   PRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
              +   A K  H W G  RV+E  G     LE    E     I HVS L
Sbjct  1089  VKEGYARKLAHMWHGLFRVVEMVGNHAARLETAGTEYRLFPIVHVSKL  1136

>PHYRA_78326
Length=742

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 85/228 (37%), Gaps = 6/228 (3%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  401  VFRRFGASEAIRHDREPGFMSDFFRAFSRIVGQRQRATMAYRPQANGTAERMVQTLTRAL  460

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
             + +   +Q+DWD +     +A N+         P  L+ G   RS  E    L  T +R
Sbjct  461  KMYVADVNQQDWDEYAERLTFAINTAHDRVRGETPFYLVHGWDPRSTLEASLPLGSTRRR  520

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMF-KP  179
            D       +R   Q  +         +E  Q R A  +   +R  +  + G  VW++   
Sbjct  521  DREPRRWRYRIQQQYQRAREEVNALLKEAIQTR-ADRHNDGIRPHQ-IEAGSQVWLYLDR  578

Query  180  PRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
             +   A K  H W GP RV E  G     LE    E     I HVS L
Sbjct  579  VKEGYARKLAHMWHGPFRVREMIGPYAARLEVAGTEYRLFPIVHVSKL  626

>PHYRA_75588
Length=631

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 55/137 (40%), Gaps = 2/137 (1%)

Query  13   ELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQ  72
            ++++D  P  T R  +E+  LL  Q +      PQ  G  ER NR   D +    +   Q
Sbjct  413  DIVSDRDPRFTARFWQEVFTLLGTQLSMSTADHPQTDGQTERVNRVLVDTMKSYAHSFHQ  472

Query  73   RDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRL  132
              W   +P A +A N+  H +    P  +   R  R P+ L  V      G      ++ 
Sbjct  473  --WSDCLPMAEFAINNSVHVSTGHTPFYVNAMRHPRVPSVLGAVAPSLSGGGYPVNSKQP  530

Query  133  LQTMKESHASAECARER  149
             +    S+ SA   RER
Sbjct  531  DKHANTSNVSAVTTRER  547

>PHYRA_79617
Length=1240

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 77/207 (37%), Gaps = 22/207 (11%)

Query  14    LLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQR  73
              ++D  P         L  LL  +        PQ  G  ER NR  +D++  S+   D  
Sbjct  918   FVSDRDPRFVSHFWTHLFRLLGTRLDMSTADHPQTDGQTERVNRVLEDVLR-SICTEDPT  976

Query  74    DWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNE------  127
              W   +P   +A N+  HS+    P  +   R  R+P  L   +S      + E      
Sbjct  977   KWSTLLPQVEFALNNAVHSSTGFTPFYVNGLRHPRTPLSLPPASSLGGGEAIAEDSRGLQ  1036

Query  128   -----YHRRLLQTMKESHASAECAREREQARQASYYERKVRQKR----AFKPGDHVWM--  176
                    R LL  ++ S A  +  R+   A Q +  E   RQ R     FK GD V +  
Sbjct  1037  GLRSSVKRNLLTFIETSEAVRQRVRDAMAATQDTQKEHSDRQGRKNTHVFKLGDQVLLNA  1096

Query  177   ----FKPPRGPRASKFVHQWIGPLRVI  199
                  +      ++K   +++GP  VI
Sbjct  1097  KNLPIQAVTAVGSTKLRPRFVGPFTVI  1123

>PHYRA_85651
Length=808

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 77/192 (40%), Gaps = 25/192 (13%)

Query  22   LTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPF  81
             +GR++ +       +Q   + YRPQ  G  ER  +T    + + +   +Q+DWD +   
Sbjct  506  FSGRIVGQ-------RQRATMAYRPQANGTAERMVQTLTRALKMYVADVNQQDWDEYAGR  558

Query  82   AVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQRDAGELNEYHRRLLQTMKE  138
              +A N+         P  L+ G   RS  E    L  T +RD  E   +  R+ Q  + 
Sbjct  559  LTFAINTAHDRVQGETPFYLVHGWDPRSTLEASLPLGSTRRRDH-EPRRWRYRIQQQYQR  617

Query  139  SHASAECAREREQAR-QASYYERKVRQKRAFKP-----GDHVWMF-KPPRGPRASKFVHQ  191
                   ARE   AR + +   R  R     +P     G  VW++    +   A K  H 
Sbjct  618  -------AREEVNARLKEAIQARADRHNDGIRPHQIEAGSQVWLYLDRVKEGYARKLTHM  670

Query  192  WIGPLRVIEDAG  203
            W GP RV E  G
Sbjct  671  WHGPFRVREMIG  682

>PHYRA_86634
Length=374

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 78/207 (38%), Gaps = 22/207 (11%)

Query  14   LLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQR  73
             ++D  P         L  LL  +        PQ  G  ER NR  +D++  S+   D  
Sbjct  60   FVSDRDPRFVSHFWTHLFRLLGTRLDMSTADHPQTDGQTERVNRVLEDVLR-SICTEDPT  118

Query  74   DWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSP-----------NELLRVTSQRDA  122
             W   +P   +A N+  HS+    P  +   R  R+P            E +   S+   
Sbjct  119  KWSTLLPQVEFALNNAVHSSTGFTPFYVNGLRHPRTPLSLPPASRLGGGEAIAEDSRGLQ  178

Query  123  GELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKR----AFKPGDHVWM--  176
            G  +   R LL  ++ S A  +  R+   A Q +  E   RQ R     FK GD V +  
Sbjct  179  GLRSSVKRNLLTFIETSEAVRQRVRDAMAAAQDTQKEHSDRQGRKNTHVFKLGDQVLLNA  238

Query  177  ----FKPPRGPRASKFVHQWIGPLRVI  199
                 +      ++K   +++GP  VI
Sbjct  239  KNLPIQAVTAVGSTKLRPRFVGPFTVI  265

>PHYRA_87161
Length=217

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 79/190 (42%), Gaps = 6/190 (3%)

Query  42   VPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNEL  101
            + YRPQ  G  ER  +T    + + +   +Q++WD +      A N+ +       P  L
Sbjct  1    MAYRPQANGTAERMVQTLTRALKMYVADVNQQNWDEYAERLTIAINTAQDRVRGDTPFYL  60

Query  102  MMGRRLRSPNEL-LRVTSQRDAGELNEYHRRLLQTM--KESHASAECAREREQARQASYY  158
            + G   RS  E  L V S R     +   R  +Q+   +      E  RE  Q+R A  +
Sbjct  61   IHGWDPRSTLEAALPVGSTRRRDRESRRWRFHMQSQYRRAREQVNERLREAIQSR-ADEH  119

Query  159  ERKVRQKRAFKPGDHVWMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENA  217
             + VR +   + G  VW++    +   A K  H W GP RV+E  G     LE    E  
Sbjct  120  NQNVRSQE-IEAGAQVWLYLDRVKEGYARKLAHMWHGPFRVVEMVGNHAARLEIAGTEYR  178

Query  218  ERLIAHVSFL  227
               I HVS L
Sbjct  179  LFPIVHVSKL  188

>PHYRA_84372
Length=1429

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 80/212 (38%), Gaps = 22/212 (10%)

Query  4     VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
             V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  1137  VFRRFGASEVIRHDREPGFMSDFFRAFSRIVGQKQRATMAYRPQANGTAERMVQTLTRSL  1196

Query  64    AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
              + ++  +QRDWD +     +A N+ +       P  L  G   RS  E    L  T +R
Sbjct  1197  KMYVSDVNQRDWDEYAERLTFALNTAQDRVRGDTPFYLAHGWDPRSTLEAALPLGSTRRR  1256

Query  121   DAGELNEYHRRLLQTMKESHASAECAREREQARQ---ASYYERKVRQKRAFKP-----GD  172
             D     +  RR    ++E +      R REQ R+    +   R  R     +P     G 
Sbjct  1257  D-----QEPRRWRYHVQEHY-----QRAREQVRERLREAIRGRANRHNEDLRPHNIAVGA  1306

Query  173   HVWM-FKPPRGPRASKFVHQWIGPLRVIEDAG  203
              VW+     +   A K  H W GP R  E  G
Sbjct  1307  QVWLHLDRVKEGYARKLAHLWHGPFRAAEMIG  1338

>PHYRA_87789
Length=544

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 60/234 (26%), Positives = 85/234 (36%), Gaps = 18/234 (8%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  203  VFRRFGASEAIRHDREPGFMSDFFRAFSRIVGQRQRATMAYRPQANGTAERMVQTLTRAL  262

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
             + +   +Q+DW  +     +A N+         P  L+ G   RS  E    L  T +R
Sbjct  263  KMYVADVNQQDWHEYAERLTFAINTAHDRVRGETPFYLVHGWDPRSTLEASLPLGSTRRR  322

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQAR-QASYYERKVRQKRAFKP-----GDHV  174
            D       +R   Q  +        ARE   AR + +   R  R     +P     G  V
Sbjct  323  DREPRRWRYRIQQQYQR--------AREEVNARLKEAIQTRADRHNDGIRPHQIEAGSQV  374

Query  175  WMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            W++    +   A K  H W GP RV E  G     LE    E     I HVS L
Sbjct  375  WLYLDRVKEGYARKLAHMWHGPFRVREMIGPYAARLEVAGTEYRLFPIVHVSKL  428

>PHYRA_74385
Length=995

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 85/234 (36%), Gaps = 18/234 (8%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  701  VFRRFGASEAIRHDREPGFMSDFFRAFSRIVGQRQRATMVYRPQANGTTERMVQTLTRAL  760

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL---LRVTSQR  120
             + +   +Q+DWD +     +A N+         P  L+ G   RS  E    L  T +R
Sbjct  761  KMYVADVNQQDWDEYAERLTFAINTAHDRVRGETPFYLIHGWDPRSTLEASLPLGSTRRR  820

Query  121  DAGELNEYHRRLLQTMKESHASAECAREREQAR-QASYYERKVRQKRAFKP-----GDHV  174
            D       +R   Q  +        ARE   AR   +   R  R     +P     G  V
Sbjct  821  DREPRRWRYRIQQQYQR--------AREEVNARLMEAIQARADRHNDGIRPHQIEAGSQV  872

Query  175  WMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            W++    +   A K  H W GP RV E  G     LE    E     I HVS L
Sbjct  873  WLYLDRVKEGYARKLAHMWHGPFRVREMIGPYAARLEVAGTEYRLFPIVHVSKL  926

>PHYRA_85899
Length=627

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 76/205 (37%), Gaps = 18/205 (9%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            ++  +Q   + YRPQ  G  ER  +T    + + ++  +QRDWD +     +A N+ +  
Sbjct  362  IVGQKQRAMMAYRPQANGTAERMVQTLTRSLKMYVSDVNQRDWDEYAERLTFALNTAQDR  421

Query  93   TVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMK-ESHASAECAREREQ  151
                 P  L  G   RS  E         A  L    RR  +  +   H      R REQ
Sbjct  422  VRDDTPFYLAHGWDPRSTLEA--------ALPLGSTRRRDQEPRRWRYHVQGHYQRAREQ  473

Query  152  ARQ---ASYYERKVRQKRAFKP-----GDHVWM-FKPPRGPRASKFVHQWIGPLRVIEDA  202
             R+    +   R  R     +P     G  VW+     +   A    H W GP RV E  
Sbjct  474  VRERLREAIRGRANRHNEDLRPHNIEAGAQVWLHLDRVKEGYARMLAHLWHGPFRVAEMI  533

Query  203  GYDNLLLEREDGENAERLIAHVSFL  227
            G     LE    E     I HVS L
Sbjct  534  GDHAARLEIAGSEYRIFPIVHVSKL  558

>PHYRA_85442
Length=576

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 46/111 (41%), Gaps = 2/111 (2%)

Query  13   ELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQ  72
            ++++D  P  T R  +E+  LL  Q +      PQ  G  ER NR   DI+    +   Q
Sbjct  412  DIVSDRDPRFTARFWQEVFTLLGTQLSMSTGDHPQTDGQTERVNRVLVDIMKSYAHSFHQ  471

Query  73   RDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAG  123
              W   +P A +A N+  H +    P  +   R  R P+ L  V      G
Sbjct  472  --WSDGLPMAEFAINNSVHVSTGHTPFYVNAMRHPRVPSVLGAVAPSLSGG  520

>PHYRA_78350
Length=1190

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 52/237 (22%), Positives = 95/237 (40%), Gaps = 11/237 (5%)

Query  7     KFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAIS  66
             +FG     ++D        V+  L E L A       Y P + G VER NR    ++ + 
Sbjct  881   RFGAPPTWMSDNGSHFKSEVVGLLAERLGASHQFAPVYTPWINGTVERVNRDILQVLRVM  940

Query  67    M--NKGDQRDWDRWVPFAVYAYN-SGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAG  123
             +  ++ D R+W   +P      N +  +S     P EL  G    S  +++   ++R   
Sbjct  941   LLESRLDTRNWVYLLPTIQANLNHTPVYSLGNCAPVELFTGLPAVSALDIVATPTERVLR  1000

Query  124   ELNEYHRRLLQTMKES----HASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKP  179
              L      L + ++E     H      R+R + ++ +   R       F  GD+V   + 
Sbjct  1001  NLPMEKAALREAVEELRRSLHGLHRVVRDRREQQRVAAMARSNGTVCNFSEGDYVLWSRV  1060

Query  180   PRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFLVSYHHPADF  236
              +  + +K + +W+GP +V +   +  L+     G   +    H S L  ++H AD 
Sbjct  1061  DKRLQGNKLLVRWVGPFQVTKALPHSFLIRHLLTGAEYD---VHGSRL-KFYHDADL  1113

>PHYKE_5745
Length=159

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 45/105 (43%), Gaps = 8/105 (8%)

Query  12   RELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV---AISMN  68
            RE+++D  P  T     E+  LL  + +      PQ  G +ER N    DI+   A S N
Sbjct  58   REIVSDRDPRFTAAFWREVFSLLGTRLSTSTADHPQTDGQIERVNHVLGDILKSYAHSFN  117

Query  69   KGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL  113
                 +W   +P A +A N+  H++    P  +   R  R P  L
Sbjct  118  -----EWSDCLPMAEFAINNSVHASTGHTPFYVNGMRHPRVPTML  157

>PPTG_17092
Length=289

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/197 (23%), Positives = 74/197 (38%), Gaps = 30/197 (15%)

Query  32   ELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRH  91
            +++  +Q   + YRPQ  G  ER  +T    + + +   +Q+DWD +     +A N+ + 
Sbjct  10   KIVSQKQRATMAYRPQANGTAERMVQTLTRALKMCVADVNQKDWDEYAERLTFALNTAQD  69

Query  92   STVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQ  151
                 + N    G  + S N  +R+        +NE  R  +Q   + H  A        
Sbjct  70   RDRLDVENP--AGGVIISRNTTIRL--------VNERLREAIQERADRHNEAA-------  112

Query  152  ARQASYYERKVRQKRAFKPGDHVWMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLE  210
                        Q    + G  VW++    +   A K  H W GP RV E      + LE
Sbjct  113  ------------QPHKIEVGSQVWLYLDRVKEGYARKLAHMWHGPFRVAEVVDSHAVRLE  160

Query  211  REDGENAERLIAHVSFL  227
                +     + HVS L
Sbjct  161  IAGSDYHVFPVVHVSKL  177

>PYAR_25247
Length=329

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 87/217 (40%), Gaps = 24/217 (11%)

Query  33   LLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHS  92
            +L ++Q   + YRPQ  G  ER   T    +   +++ DQ DW+  V   ++  N+   +
Sbjct  1    MLGSRQRATLAYRPQANGQQER--STVSRSIKAYVSRPDQEDWEDVVYRLMFVLNTSYDA  58

Query  93   TVALIPNELMMGRRLRSPNELLRVT--SQRDAGELNEYHRRLLQTMKESHASA------E  144
            T    P  L+ G   +S  E +     S+R   +   Y  R+       +A A      +
Sbjct  59   TRRETPFYLVHGWDAKSTVEAMTAQPPSKRRGNQYEAYLWRVKMQRDYQYALAWARDLQD  118

Query  145  CAREREQARQASYYER-------------KVRQKRAFKPGDHVWMFKPPRGPR-ASKFVH  190
             A++R  A QA+ +E                R K   + GD V ++     P  A K  H
Sbjct  119  NAKKRRAAEQAANWEALPAPEQTADWEALPARAKTGLEVGDAVRLYLARVKPGLAKKLAH  178

Query  191  QWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
             W GP R++E A    + L+ E          HVS L
Sbjct  179  HWHGPFRILEKANDHRVKLKTEGTMYRVNPWVHVSRL  215

>PHYKE_7081
Length=329

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 58/143 (41%), Gaps = 4/143 (3%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P           +L+  +Q   + YRPQ  G  ER  +T     
Sbjct  134  VFRRFGASEAIRHDREPGFMSDFFRAFNKLMGQRQRATLAYRPQANGAAERMVQTITRAT  193

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSP-NELLRV--TSQR  120
             + +   DQR WD +     +A N+    T +  P  L+ G   RS   E L V  TS R
Sbjct  194  KMYIADIDQRGWDEYAERLTFALNTAHDRTRSETPFYLVHGWDPRSTLEESLAVGNTSHR  253

Query  121  DAGELNEYHRRLLQTMKESHASA  143
            D  E   +  R+ +  K + A A
Sbjct  254  DV-EAKHWRLRIQRHYKIARAQA  275

>PHYRA_87505
Length=306

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 72/196 (37%), Gaps = 18/196 (9%)

Query  42   VPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNEL  101
            + YRPQ  G  ER  +T    + + ++  +QRDWD +     +A N+ +       P  L
Sbjct  1    MAYRPQANGTAERMVQTLTRSLKMYVSDVNQRDWDEYAERLTFALNTAQDRVRGDTPFYL  60

Query  102  MMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMK-ESHASAECAREREQARQ---ASY  157
              G   RS  E         A  L    RR  +  +   H      R REQ R+    + 
Sbjct  61   AHGWDPRSTLEA--------ALPLGSTRRRDQEPRRWRYHVQEHYQRAREQVRERLREAI  112

Query  158  YERKVRQKRAFKP-----GDHVWM-FKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLER  211
              R  R     +P     G  VW+     +   A K  H W GP RV E        LE 
Sbjct  113  RGRANRHNEDLRPHNIAVGAQVWLHLDRVKKGYARKLAHLWHGPFRVAEMIDDHAARLEI  172

Query  212  EDGENAERLIAHVSFL  227
               E     I HVS L
Sbjct  173  AGSEYRIFPIVHVSKL  188

>PHALS_14436
Length=238

 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query  14   LLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKD-IVAISMNKGDQ  72
            L++D   E T  VIE   +       N +P    ++G ++RF RT K  +  +    G +
Sbjct  51   LMSDNGYEFTNNVIERFFDKNSITHANSIPGDHTVLGKIDRFIRTIKARLTKMQDTMGFK  110

Query  73   RDWDRWVPFAVYAYNSGRHSTVALIPNELMMGR  105
            +   + +  A+  YN   HS++   PNE M GR
Sbjct  111  KLTQKRLNEAISNYNDTTHSSIKATPNE-MEGR  142

>PHYSO_341850
Length=1354

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 76/187 (41%), Gaps = 5/187 (3%)

Query  44   YRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMM  103
            YRPQ  G  +R  +T    + + +   DQRDWD +     +A N+ +       P  L+ 
Sbjct  3    YRPQANGTADRMVQTATRALNMFVEDLDQRDWDEYAERLTFAINTAQDRVCGDSPFYLVH  62

Query  104  GRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQ-ARQASYYERKV  162
            G   RS  E       R     +   R  +Q + +   S   AR RE    +A  +  +V
Sbjct  63   GWDPRSTLEAAIPLGTRTRDRDHRRWRYRIQKLYDQARSQVNARLREAITDRADRHNEEV  122

Query  163  RQKRAFKPGDHVWMF--KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERL  220
            R  ++ + G  VW++  +   G  A K  H W  P RV E      + L+    +     
Sbjct  123  R-PQSIEAGSQVWLYLDRVKEG-YARKLAHLWHSPFRVAEKVNEYTMNLQIAGTDYHLFP  180

Query  221  IAHVSFL  227
            I HVS L
Sbjct  181  IVHVSKL  187

>PHYRA_81866
Length=265

 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 72/196 (37%), Gaps = 18/196 (9%)

Query  42   VPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNEL  101
            + YRPQ  G  ER  +T    + + ++  +QRDWD +     +A N+ +       P  L
Sbjct  1    MAYRPQANGTAERMVQTLTRSLKMYVSDVNQRDWDEYAERLTFALNTAQDRVRGDTPFYL  60

Query  102  MMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMK-ESHASAECAREREQARQ---ASY  157
              G   RS  E         A  L    RR  +  +   H      R REQ R+    + 
Sbjct  61   AHGWGPRSTLEA--------ALPLGSTRRRDQEPRRWRYHVQEHYQRAREQVRERLREAI  112

Query  158  YERKVRQKRAFKP-----GDHVWM-FKPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLER  211
              R  R     +P     G  VW+     +   A K  H W GP RV E        LE 
Sbjct  113  RGRANRHNEDLRPHNIAVGAQVWLHLDRVKEGYARKLAHLWHGPFRVAEMIDDHAARLEI  172

Query  212  EDGENAERLIAHVSFL  227
               E     I HVS L
Sbjct  173  AGSEYRIFPIVHVSKL  188

>PHYSO_262200
Length=957

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (43%), Gaps = 3/122 (2%)

Query  3    DVVLKF-GPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKD  61
            D+V K  G   ++++D  P  T  + +E+  LL +Q +      PQ  G  ER NR   D
Sbjct  727  DMVFKHHGMPIDIVSDRDPRFTAHLWQEVFTLLGSQLSMSTADHPQTDGQTERVNRVLVD  786

Query  62   IVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRD  121
            ++    +      W   +P A +A N+  H++    P  +   R  R P+ L  V     
Sbjct  787  VLKSYAHSFQH--WSECLPMAEFAINNSVHASTGHTPFYVNAIRHPRLPSLLGMVAPSLS  844

Query  122  AG  123
             G
Sbjct  845  GG  846

>PPTG_01238
Length=68

 Score = 38.1 bits (87),  Expect = 0.004, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 5/53 (9%)

Query  88   SGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESH  140
            SG +S++     EL++GR LRS  EL       +AGEL  YH++LL  ++ +H
Sbjct  20   SGAYSSI-----ELVIGRILRSLCELSYEMRVSEAGELTTYHKKLLMGIRSAH  67

>PYIW_26681
Length=276

 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 55/221 (25%), Positives = 89/221 (40%), Gaps = 40/221 (18%)

Query  34   LQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISM--NKGDQRDWDRWVPFAVYAYNSGRH  91
            L+ +Q   V Y     G VER NR    ++ + +   K +++DW   +     + N  + 
Sbjct  1    LKPEQRFLVAYCLWKSGTVERANRDVIQVLKVLLLEFKLNEKDWPYLILVVQASLNHSQA  60

Query  92   STVAL-IPNELMMG-------RRLRSPNELLRVTSQRDAGE-LNEYHRRLLQTMKESHAS  142
             ++A   P EL  G       R + SP  + +V +    G+   E  R+L  +++  H  
Sbjct  61   VSLAHRAPVELFTGLMCPSPLRAVVSPMAVEKVVAVEQFGQQAEEKLRKLRASLRAMHLK  120

Query  143  AECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPRASKFVHQWIGPLRVIE--  200
             +  RE E+ R  S          +F  GD+V   +      + K +  WIGP RVI+  
Sbjct  121  TK--REVEKGRGKSV---------SFSVGDYVLRSRVDEKRGSGKLMMTWIGPFRVIDVF  169

Query  201  ---------------DAGYDNLLLEREDGENAER-LIAHVS  225
                           D     L L R+D  N  + LI HV+
Sbjct  170  EYHFVVEHLITKDHADVHASQLKLYRDDSLNVTKELIEHVA  210

>PHYRA_87279
Length=304

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 75/196 (38%), Gaps = 18/196 (9%)

Query  42   VPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNEL  101
            + YRPQ  G  ER  +T    + + +   +Q+DWD +     +A N+         P  L
Sbjct  1    MAYRPQANGTAERMVQTLTCALKMYVADVNQQDWDEYAERLTFAINTAHDRVRGETPFYL  60

Query  102  MMGRRLRSPNEL---LRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQAR-QASY  157
            + G   RS  E    L  T +RD       +R   Q  +        ARE   AR + + 
Sbjct  61   VHGWDPRSTLEASLPLGSTRRRDREPRRWRYRIQQQYQR--------AREEVNARLKEAI  112

Query  158  YERKVRQKRAFKP-----GDHVWMF-KPPRGPRASKFVHQWIGPLRVIEDAGYDNLLLER  211
              R  R     +P     G  VW++    +   A K  H W GP RV E  G     LE 
Sbjct  113  QTRADRHNDGIRPHQIEAGSQVWLYLDRVKEGYARKLAHMWHGPFRVREMIGPYAARLEV  172

Query  212  EDGENAERLIAHVSFL  227
               E     I HVS L
Sbjct  173  AGTEYRLFPIVHVSKL  188

>PHYRA_85181
Length=304

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 67/169 (40%), Gaps = 18/169 (11%)

Query  42   VPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNEL  101
            + YRPQ  G  ER  +T    + + +   +Q+DWD +     +A N+ +       P  L
Sbjct  1    MAYRPQANGTAERMVQTLTRALKMYVADVNQQDWDEYAERLTFALNTAQDRVRGDTPFYL  60

Query  102  MMGRRLRSPNE----LLRVTSQRDAGELNEYH-----RRLLQTMKESHASAECAREREQA  152
            + G   RS  E    L     +        YH     RR  + + ES       RE  Q 
Sbjct  61   IHGWDPRSTLEASLPLGSTRRRDRDPRRWRYHIQSHYRRAREEVNES------LREAIQG  114

Query  153  RQASYYERKVRQKRAFKPGDHVWMF-KPPRGPRASKFVHQWIGPLRVIE  200
            R A  +  +VR     +    VW++    +   A K  H W GP RVIE
Sbjct  115  R-ADGHNDQVR-PHGIEANMQVWLYLDRVKEGYARKLAHMWHGPFRVIE  161

>PHYRA_84637
Length=1730

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 47/104 (45%), Gaps = 8/104 (8%)

Query  13    ELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV---AISMNK  69
              +++D  P  T     +L +LL  + +      P+  G  ER NR  +D++   A S   
Sbjct  1391  SIVSDRDPRFTSAFWRQLFQLLGTRLSMSTASHPETDGQTERANRVVEDVLRSFATSF--  1448

Query  70    GDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNEL  113
                + W  ++P   +A N+  H++  L P  +  GR  R P+ L
Sbjct  1449  ---QSWSTFLPMVEFALNNAVHASTGLTPFFVNFGRHPRVPDLL  1489

>PHYRA_73994
Length=841

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 48/117 (41%), Gaps = 9/117 (8%)

Query  13   ELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQ  72
            ++++D  P  T +  +E+  LL  Q +      PQ  G  ER NR   D +    +   Q
Sbjct  700  DIVSDRDPRFTAQFWQEVFTLLGTQLSMSTADHPQTDGQTERVNRVLVDTMKSYAHSFHQ  759

Query  73   RDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYH  129
              W   +P A +A N+  H +    P  +   R  R P+ L       D    NE+H
Sbjct  760  --WSDCLPMAEFAINNSVHVSTRHTPFYVNAMRHPRVPSVL-------DTSNDNEHH  807

>PHYRA_74389
Length=919

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 55/137 (40%), Gaps = 3/137 (2%)

Query  13   ELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQ  72
            ++++D     T R  +E+  LL  Q +      PQ  G  E  NR   D +    +   Q
Sbjct  779  DIVSDRDSRFTARFWQEVFTLLGTQLSMSTTDHPQTDGQTECVNRVLVDTMKSYAHSFHQ  838

Query  73   RDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRL  132
              W   +P A +A N+  H +    P  +   R  R P+ L+  T   D    NE+H + 
Sbjct  839  --WSDCLPMAEFAINNSVHVSTGHTPFYVNAMRHPRVPSVLVSTTGV-DTSNDNEHHAQA  895

Query  133  LQTMKESHASAECARER  149
                 + H   +  R++
Sbjct  896  GPAANKEHELNQGTRQK  912

>PPTG_16139
Length=1002

 Score = 40.4 bits (93),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 49/208 (24%), Positives = 87/208 (42%), Gaps = 23/208 (11%)

Query  7    KFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAIS  66
            +FG     ++         V+ EL + L++QQ   + Y P + G VER NR    ++ + 
Sbjct  683  RFGAPPVWVSGNGSHFKNEVVAELSKRLKSQQNFILAYCPWINGSVERVNRDILQVLRVM  742

Query  67   M--NKGDQRDWDRWVPFAVYAYNSGRHSTVALI----PNELMMGRRLRSP---------N  111
                K   +DW+  VP    + N   H+ +  +    P EL  G +  SP          
Sbjct  743  TLEYKVSTKDWEYLVPLVQASLN---HTALPSLGNRAPVELFTGLQCPSPLAEFYHPGSK  799

Query  112  ELLRVTSQRDAGELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPG  171
            +L+ V    DA  ++++  +L Q++   H       +R + R  +  + +      F  G
Sbjct  800  KLVIVPKNSDA--IDKHLAQLRQSLCTMHQPI--VDQRLKQRLLNKKKDRGDNVVNFDVG  855

Query  172  DHVWMFKPPRGPRASKFVHQWIGPLRVI  199
            D+V   +     R +K +  W GP RV+
Sbjct  856  DYVLRSRVDEKKR-NKLLVTWQGPYRVV  882

>PHYRA_80538
Length=1148

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 42/98 (43%), Gaps = 0/98 (0%)

Query  7     KFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAIS  66
             +FG    +  D  P     V +   E++Q++    + YRPQ  G  ER  +T    V + 
Sbjct  981   RFGAPTLIRHDRDPRFMSEVFQAFAEMMQSRSRATLSYRPQANGQQERSVKTVMQSVQVY  1040

Query  67    MNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMG  104
                  Q+DWD      ++A N+ +  T    P  L+ G
Sbjct  1041  AEDPLQQDWDEIAERLIFAINNSQDGTRKDTPFYLVHG  1078

>PHYRA_72395
Length=144

 Score = 38.1 bits (87),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 2/79 (3%)

Query  13   ELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQ  72
            ++++D  P  T R  +E+  LL  Q +      PQ  G  ER NR   D +    +   Q
Sbjct  59   DIVSDRDPRFTARFWQEVFTLLGTQLSMSTADHPQTDGQTERVNRVLVDTMKSYAHSFHQ  118

Query  73   RDWDRWVPFAVYAYNSGRH  91
              W   +P A +A N+  H
Sbjct  119  --WSDCLPMAEFAINNSVH  135

>PHYRA_76817
Length=1115

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 73/224 (33%), Gaps = 41/224 (18%)

Query  4    VVLKFGPFRELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV  63
            V  +FG    +  D  P            ++  +Q   + YRPQ  G  ER  +T    +
Sbjct  817  VFRRFGASEAIRHDREPGFMSDFFRAFSRIVGQRQRATMAYRPQANGTAERMVQTLTRAL  876

Query  64   AISMNKGDQRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAG  123
             + +   +Q+DWD +     +A N+                          R   QR   
Sbjct  877  KMYVADVNQQDWDEYAERLTFAINTAHD-----------------------RQQYQRARE  913

Query  124  ELNEYHRRLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGP  183
            E+N   +  +QT  + H       + E   Q   Y  +V++                   
Sbjct  914  EVNARLKEAIQTRADRHNDGIRPHQIEAGSQVWLYLDRVKEG------------------  955

Query  184  RASKFVHQWIGPLRVIEDAGYDNLLLEREDGENAERLIAHVSFL  227
             A K  H W GP RV E  G     LE    E     I HVS L
Sbjct  956  YARKLAHMWHGPFRVREMIGPYAARLEVAGTEYRLFPIVHVSKL  999

>PHYCA_96236
Length=222

 Score = 38.9 bits (89),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 43/98 (44%), Gaps = 4/98 (4%)

Query  12   RELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGD  71
            R+++ D  PE TG+  +EL+     +        PQ   + ER +      +   +   +
Sbjct  38   RKVIHDKGPEFTGKEFQELLRSYGIKAKTITAKNPQANAICERVHLE----IGYVLRCHE  93

Query  72   QRDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRS  109
              DW + + +A +A  +  HS     P +++ G+ + S
Sbjct  94   GSDWRKVIYYAAFAVRASYHSIFNASPGQVVFGQDMTS  131

>CCA20400
Length=256

 Score = 38.9 bits (89),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 82/197 (42%), Gaps = 15/197 (8%)

Query  14   LLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMN-KGDQ  72
            +  D  P+ T    + L  L+  + +    +R Q  G  ER N   +D +   ++  GD 
Sbjct  59   VFNDRDPKFTSYFWKSLANLMGIKLSMTTFHRAQADGQTERKNFVLEDALRCMVSYHGD-  117

Query  73   RDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRS--PNELLRVTSQRDAGELNEYHR  130
             DW + +    YA+ +  + +  L P E+  GR++++    E     S     E+ E+ +
Sbjct  118  -DWIQHIGTIEYAHATLLNESTRLTPFEVATGRKVQNLIAQEFDMEDSNVHHMEVAEFTK  176

Query  131  RLLQTMKESHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMF--KPP-------R  181
                 ++E    A+   ++ Q RQ  Y +RK      F+  D V +    PP        
Sbjct  177  TFAVKLQEVIKLAQENLKQAQMRQKKYVDRKCL-AVTFRAVDFVMLDTRNPPLKTIAKCT  235

Query  182  GPRASKFVHQWIGPLRV  198
             P+ +K   + +GP  +
Sbjct  236  APQKAKLAAKKVGPFEI  252

>PHYRA_85980
Length=262

 Score = 38.9 bits (89),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 4/110 (4%)

Query  13   ELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQ  72
             +++D  P  T     +L +LL  + +      P+  G  ER NR  +D++  S     Q
Sbjct  59   SIVSDRDPRFTSAFWRQLFQLLGTRLSMSTASHPETDGQTERANRVVEDVLR-SFATSFQ  117

Query  73   RDWDRWVPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDA  122
              W  ++P   +A N+  H++  L P  +  GR L  P+ + RV   R A
Sbjct  118  -SWSTFLPMVEFALNNAVHASTGLTPFFVNFGRHL--PSLVWRVLRLRLA  164

>PHYCA_123307
Length=154

 Score = 38.1 bits (87),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 45/108 (42%), Gaps = 15/108 (14%)

Query  15   LTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIV--AISMNKGDQ  72
            ++D        V+ E+   L+ QQT    Y P + G VER NR    ++   I   K  Q
Sbjct  1    MSDQGTHFKNEVVAEISRRLRTQQTFTPAYCPWINGSVERVNRDILQVIRAMIITYKISQ  60

Query  73   RDWDRWVPFAVYAYNS------GRHSTVALIPNELMMGRRLRSPNELL  114
            +DW   VP      N       G HS     P EL  G  L++P  LL
Sbjct  61   KDWVYLVPMVQANLNHTAVPSLGNHS-----PLELFTG--LQNPTPLL  101

>PHYCA_131297
Length=181

 Score = 38.5 bits (88),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 38/153 (25%), Positives = 61/153 (40%), Gaps = 11/153 (7%)

Query  22   LTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQRDWDRWVPF  81
             T +  + ++  +         +R Q  G  ER NR  K I         + DWD ++ +
Sbjct  15   FTSKFWQAVITAMGTHHNLSSAFRQQTDGHTERTNRLSKII--------SENDWDEFLHW  66

Query  82   AVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKESHA  141
            A +AYN   H+T+ + P E  +G     P +   V S  +  +L +  +  L   +    
Sbjct  67   ANFAYNRRVHATIGMSPFEADLGYISYMPCD--DVASDPEFKKLEKAAKEFLLRQEAFLK  124

Query  142  SAECAREREQARQASYYERKVRQKRAFKPGDHV  174
             A+      Q R   YY+ K R    FK G  V
Sbjct  125  VAQDRMSEAQERMKHYYD-KNRLVMDFKNGGMV  156

>PYAR_23528
Length=275

 Score = 38.9 bits (89),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 56/150 (37%), Gaps = 10/150 (7%)

Query  79   VPFAVYAYNSGRHSTVALIPNELMMGRRLRSPNELLRVTSQRDAGELNEYHRRLLQTMKE  138
             PF +      + +  A+I       R  R    L R+  QRD      + R L    K+
Sbjct  15   TPFYLVHGWDAKSTVGAMIAQPPKNRRGNRYDAYLWRIKMQRDYQYALAWARDLQDAAKK  74

Query  139  SHASAECAREREQARQASYYERKVRQKRAFKPGDHVWMFKPPRGPR-ASKFVHQWIGPLR  197
              A+ + A          +     R K  F+ G+ VW++     P  A K  H W GP R
Sbjct  75   KRAAEQTA---------DWEALPDRSKTGFEVGNAVWLYLARVKPGLAKKLAHHWHGPFR  125

Query  198  VIEDAGYDNLLLEREDGENAERLIAHVSFL  227
            +IE A    + L+ E          HVS L
Sbjct  126  IIEKANDHRVKLKTEGTMYRVNPWVHVSRL  155

>PHYRA_74001
Length=710

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 37/86 (43%), Gaps = 2/86 (2%)

Query  13   ELLTDGAPELTGRVIEELVELLQAQQTNPVPYRPQLVGLVERFNRTWKDIVAISMNKGDQ  72
            ++++D  P  T R  +E+  LL  Q +      PQ  G  ER NR   D +    +   Q
Sbjct  604  DIVSDRDPRFTARFWQEVFTLLGTQLSMSTADHPQTDGQTERVNRVLVDTMKSYAHSFHQ  663

Query  73   RDWDRWVPFAVYAYNSGRHSTVALIP  98
              W   +P A +A N+  H +    P
Sbjct  664  --WSDCLPMAEFAINNSVHVSTGHTP  687

Lambda      K        H        a         alpha
   0.318    0.134    0.396    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 19072909638

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40