Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_104436101811819042e-125
PPTG_16671102092097414e-100
PITG_00012101851856682e-89
PHYRA_78819102002045824e-76
PHYSO_554653102202195646e-73
PHALS_10836102042014072e-49
HYAP_01509102082024063e-49
PPTG_07275203391841803835e-46
PHYCA_97367203391911933835e-46
PYVX_15869103311872612e-26
PYU1_G0032268196820680993e-04
PYIW_1915781968262104950.001
PYAP_203999980113564860.010
PYAR_194629980111678820.023
PYIR_144998196818695840.028
PYVX_158671118772780.16
PHYKE_7136906568994790.22
PYAR_20344906663087760.46
PITG_00011916067740.47
PYVX_19354906664372741.0
H257_0341812348453250731.2
SDRG_10804129647147172731.3
PYAP_15394906667696731.4
PPTG_02352906539294702.3
PHYSO_2965561113668672.9
PYU1_G003462906663887693.4
HYAP_06046906539294684.4
SPRG_1279212890028867684.6
PHYRA_93809906668571684.8
PPTG_16672928667675.2
PYVX_15863918156665.6
PITG_11012906539594676.9
PHYSO_478253916966657.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_104436

Length=181
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_104436                                                          352        2e-125
PPTG_16671                                                            290        4e-100
PITG_00012                                                            261        2e-89 
PHYRA_78819                                                           228        4e-76 
PHYSO_554653                                                          221        6e-73 
PHALS_10836                                                           161        2e-49 
HYAP_01509                                                            160        3e-49 
PPTG_07275                                                            152        5e-46 
PHYCA_97367                                                           152        5e-46 
PYVX_15869                                                            105        2e-26 
PYU1_G003226                                                          42.7       3e-04 
PYIW_19157                                                            41.2       0.001 
PYAP_20399                                                            37.7       0.010 
PYAR_19462                                                            36.2       0.023 
PYIR_14499                                                            37.0       0.028 
PYVX_15867                                                            34.7       0.16  
PHYKE_7136                                                            35.0       0.22  
PYAR_20344                                                            33.9       0.46  
PITG_00011                                                            33.1       0.47  
PYVX_19354                                                            33.1       1.0   
H257_03418                                                            32.7       1.2   
SDRG_10804                                                            32.7       1.3   
PYAP_15394                                                            32.7       1.4   
PPTG_02352                                                            31.6       2.3   
PHYSO_296556                                                          30.4       2.9   
PYU1_G003462                                                          31.2       3.4   
HYAP_06046                                                            30.8       4.4   
SPRG_12792                                                            30.8       4.6   
PHYRA_93809                                                           30.8       4.8   
PPTG_16672                                                            30.4       5.2   
PYVX_15863                                                            30.0       5.6   
PITG_11012                                                            30.4       6.9   
PHYSO_478253                                                          29.6       7.5   

>PHYCA_104436
Length=181

 Score = 352 bits (904),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/181 (100%), Positives = 181/181 (100%), Gaps = 0/181 (0%)

Query  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQSKTLs  60
            MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQSKTLS
Sbjct  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQSKTLS  60

Query  61   ssgsrsgssANSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVE  120
            SSGSRSGSSANSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVE
Sbjct  61   SSGSRSGSSANSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVE  120

Query  121  PMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYSPHLFKIAEQRTTRRSAGYYRFS  180
            PMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYSPHLFKIAEQRTTRRSAGYYRFS
Sbjct  121  PMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYSPHLFKIAEQRTTRRSAGYYRFS  180

Query  181  R  181
            R
Sbjct  181  R  181

>PPTG_16671
Length=209

 Score = 290 bits (741),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 171/209 (82%), Gaps = 28/209 (13%)

Query  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDV------  54
            MG+S FF  +WD V +PFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWE+DV      
Sbjct  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60

Query  55   --------------------QSKTLsssgsrsgssANSPLNYSYEEEDERQVQFLFYGGS  94
                                QSKTLSSSGSRSGS+++SP NYSYEEEDERQVQFLFYGGS
Sbjct  61   SRPPSSLPPFASSQVGTREHQSKTLSSSGSRSGSNSDSPSNYSYEEEDERQVQFLFYGGS  120

Query  95   DPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSA  154
            DPPTP S GGL+ NGYRSDMISNYVEPMSPAASIESPRI+HEMPCFFSPR+TP+QSPMSA
Sbjct  121  DPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMSA  180

Query  155  PIYSPHLFKIAEQRTTRRSAGYY--RFSR  181
            PIYSPHLFKI+EQRT+RRS GYY  R+SR
Sbjct  181  PIYSPHLFKISEQRTSRRSTGYYSMRYSR  209

>PITG_00012
Length=185

 Score = 261 bits (668),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 158/185 (85%), Gaps = 4/185 (2%)

Query  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQSKTLs  60
            MG+S FF  +WD V +PFEDCTSCCDVLDPDYYRKTSPGV RSPQMFNRWE+ V+    S
Sbjct  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITS  60

Query  61   ssgsrsgssANSPLNYSYEEEDE-RQVQFLFYGGSDPPTPNSVGGLH-QNGYRSDMISNY  118
            S    SGS ++SP NYSYEEE+E RQVQFLFYGGSDPPTP SVG L+   GYRSDMISNY
Sbjct  61   SRPPSSGSRSDSPSNYSYEEEEEERQVQFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNY  120

Query  119  VEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYSPHLFKIAEQRTTRRSAGYY-  177
            VEPMSPAASIESPRISHEMPCFFSPRNTP+QSPMSAPIYSPHLFKI+EQR +RRS GYY 
Sbjct  121  VEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSAPIYSPHLFKISEQRMSRRSTGYYN  180

Query  178  -RFSR  181
             R+SR
Sbjct  181  MRYSR  185

>PHYRA_78819
Length=200

 Score = 228 bits (582),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 153/204 (75%), Gaps = 27/204 (13%)

Query  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRW---EYDVQSK  57
            MGVS FF  +WDL+R+PFE+CTSCCDVLDP+YYRKTSPGVRRSPQMFNR+   +YD    
Sbjct  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFNDVKYDFSKS  60

Query  58   TLsssgsrsgssANS------------------PLNYSYEEEDE-RQVQFLFYGGSDPPT  98
               SS   S S++++                  P+NYSYEEE+E R VQFLFYGGSDPPT
Sbjct  61   RPPSSLPPSSSNSHADITQRSNMSSGSGSRSASPMNYSYEEEEEERHVQFLFYGGSDPPT  120

Query  99   PNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYS  158
            P S GG    GYRSDMISNYVEP+SPAA   SPRI+HEMPCFFSPRNTP QSPMSAPIYS
Sbjct  121  PTSAGG--PGGYRSDMISNYVEPISPAA-FASPRINHEMPCFFSPRNTPAQSPMSAPIYS  177

Query  159  PHLFKIAEQRTTRRSAGYY-RFSR  181
            PHLFKIAEQR  R SAG+Y R+SR
Sbjct  178  PHLFKIAEQR-HRHSAGHYSRYSR  200

>PHYSO_554653
Length=220

 Score = 221 bits (564),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 144/219 (66%), Gaps = 45/219 (21%)

Query  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWE----YDVQS  56
            MG+S FFR +WDLVR PFEDCTSCCDVLDPDYYRKTSPGVRR+PQMFNRW+    +DV S
Sbjct  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGS  60

Query  57   K---TLsssgsrsgssANSPLNYS--------------------------------YEEE  81
                 L  S S S   ++S    +                                YEEE
Sbjct  61   NPPSRLPPSFSFSPVISSSHAGRTQRSFTSPASLSGSSPSSGSGSASRSQSPSSYSYEEE  120

Query  82   DERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPA--ASIESPRISHEMPC  139
            DERQVQFLFYGGSDPPTP   GG + +GYRSDMIS Y++P  P   ASI SPRISHEMPC
Sbjct  121  DERQVQFLFYGGSDPPTPTG-GGAYPSGYRSDMISKYIQPTEPISPASIASPRISHEMPC  179

Query  140  FFSPRNTPIQSPMSAPIYSPHLFKIAEQRTTRRSAGYYR  178
            FFSPR TP  SPMSAPIYSPHLFKI EQRT  R+A YYR
Sbjct  180  FFSPRTTPT-SPMSAPIYSPHLFKITEQRT--RNAEYYR  215

>PHALS_10836
Length=204

 Score = 161 bits (407),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 114/201 (57%), Gaps = 31/201 (15%)

Query  3    VSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQSKTLsss  62
            +S F R +WDLV QPFE C +CCDVLDP YYRK SPG RR+PQMFN W+ D  + T S  
Sbjct  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60

Query  63   gsrsgssANSPLNYS---------------------------YEEEDERQVQFLFYGGSD  95
             S   + ++S L YS                           +EEE E Q+ FLFYGGSD
Sbjct  61   TSSFPTLSSSNLEYSCRANDNKFITLSTSRSRSVSSTPSESAHEEEGENQLHFLFYGGSD  120

Query  96   PPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAP  155
              +P +VG      YR D+IS+  EP SP  SIESPRI H+MPCFFS    P+Q PMS  
Sbjct  121  SLSPKAVG----KRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSDS  176

Query  156  IYSPHLFKIAEQRTTRRSAGY  176
            IYS +L    +Q+  R   G+
Sbjct  177  IYSANLLGDIDQQGQRSGTGH  197

>HYAP_01509
Length=208

 Score = 160 bits (406),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 120/202 (59%), Gaps = 36/202 (18%)

Query  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQ-----  55
            MGVS     I   V +PF DC+SC DVLD  YY KTSPGV  SPQMFNRWE DV+     
Sbjct  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYTR  60

Query  56   -----------------SKTLsssgsrsgssANSPLN--------YSYEEEDERQVQFLF  90
                              K L+   + S S   S  +        +  EEE +R+VQFLF
Sbjct  61   SRPLPSRLPPPPPPRTRKKGLTKRSTSSSSRPRSESSSNNPSYYSFEDEEERDRRVQFLF  120

Query  91   YGGSDPPTPNSVGGLHQN-GYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQ  149
            YGGSDPPTP S GGL  + GYRSDMIS+ V       SI SP+I+HE+PCFFSPR+TP +
Sbjct  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAVS----LTSIRSPQINHEIPCFFSPRDTP-R  175

Query  150  SPMSAPIYSPHLFKIAEQRTTR  171
            S +SA +YSPH+FKI EQ+  R
Sbjct  176  SSVSASMYSPHVFKITEQKQRR  197

>PPTG_07275
Length=184

 Score = 152 bits (383),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 121/180 (67%), Gaps = 22/180 (12%)

Query  10   IWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNR--WEYDVQSK-TLsssgsrs  66
            +WD +R+PFEDC S CDVLDP YY KTSPGVRR+P  F+R  WE D++   +LS      
Sbjct  1    MWDFLRRPFEDCKSYCDVLDPYYYSKTSPGVRRNPPKFDRACWENDLKYDFSLSRPPPSF  60

Query  67   gssANSPLNYS--------------YEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRS  112
             SS++  + ++              +EEE+E+QVQFLFYGGSD  TP SVG L  +GYRS
Sbjct  61   QSSSSGRMQFTLSRSRSQSRSASVLHEEEEEQQVQFLFYGGSDISTPVSVGKLCSSGYRS  120

Query  113  DMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYSPHLFKIAEQRTTRR  172
            D+I   +  +S     + PRISHE+PCFFSPR+TP+ SPMSAPIYSPHLF+I EQR   R
Sbjct  121  DVICTPMRLVS-----QPPRISHEIPCFFSPRDTPMMSPMSAPIYSPHLFQINEQRWRLR  175

>PHYCA_97367
Length=191

 Score = 152 bits (383),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 120/193 (62%), Gaps = 26/193 (13%)

Query  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLD----PDYYRKTSPGVRRSPQMFNR--WEYDV  54
            MGVS FF+ +WD V +PFEDC SC +VLD    P YY KTSPGVRR+P  F+R  W+ D+
Sbjct  1    MGVSDFFQDVWDFVCRPFEDCKSCSEVLDNVLDPYYYGKTSPGVRRTPPTFDRTRWDNDL  60

Query  55   QSKTLsssgsrsgssANSPLNY-----------SYEEEDERQVQFLFYGGSDPPTPNSVG  103
            +     S    S S ANS + +              EEDE Q+QFLFY GSD  T +   
Sbjct  61   KYDFSLSRPPPSQSPANSRVVFPLSRSRSLSASRSLEEDE-QIQFLFYSGSDISTSDR--  117

Query  104  GLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYSPHLFK  163
             L  +GYRSD IS  ++P++     E PR+SHE+PCFFSPR+ P+ +PMSAPIYSPHLF 
Sbjct  118  -LCSSGYRSDAISRPLQPIT-----EPPRLSHEIPCFFSPRDAPLMAPMSAPIYSPHLFM  171

Query  164  IAEQRTTRRSAGY  176
            I+EQR    S  Y
Sbjct  172  ISEQRGRSPSRHY  184

>PYVX_15869
Length=331

 Score = 105 bits (261),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 96/187 (51%), Gaps = 29/187 (16%)

Query  5    GFFRYIWD----LVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQ-----  55
            G     WD     +R PF DC + CD+  P      SPGV   PQ F R + D++     
Sbjct  139  GVLSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTA  198

Query  56   -------SKTLsssgsrsgssANSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQN  108
                   +   SS    + S  +S    SY++  ++  QFLFY GSDP TP S     +N
Sbjct  199  GPISSSAASKSSSPARSTRSKTSSDSFLSYDDPYDQPTQFLFYCGSDPLTPTSAQLAARN  258

Query  109  GYRSDMISNYVEPMSPAASIE--------SPRISHEMPCFFSPRNTPIQSPMSAPIYSPH  160
            G ++D IS Y    +P A  E        SPRISH++P FFSPRN P  SP +AP+YSPH
Sbjct  259  GLKTDTISGY----TPTAGAEPQVHTPLASPRISHQIPVFFSPRNAPT-SPAAAPLYSPH  313

Query  161  LFKIAEQ  167
            LF+I E+
Sbjct  314  LFRITER  320

>PYU1_G003226
Length=206

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 9/80 (11%)

Query  81   EDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIES--------PR  132
            E  +   F+FY GSD PT ++      NG  S   +      S AA + S        P+
Sbjct  93   ESFKNTDFMFYCGSDTPTSDAGQRNSFNGAASFSSTASASEFSEAAEVASEERAKVATPK  152

Query  133  ISHEMPCFFSPRNT-PIQSP  151
            ISH++P FFSPRN  P+ +P
Sbjct  153  ISHQIPVFFSPRNALPMPTP  172

>PYIW_19157
Length=262

 Score = 41.2 bits (95),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 49/104 (47%), Gaps = 13/104 (13%)

Query  77   SYEEEDERQVQ---FLFYGGSDPPTPNSVGGLHQNG---YRSDMISNYVEPMSPAASIE-  129
            SYE+E E  ++   F+FY G D  TP S  G  + G   + S    +        AS++ 
Sbjct  85   SYEQEYEASIKSTDFMFYCGFD--TPKSEHGRGEGGGFSFSSSTAPSEFSDDGERASMDR  142

Query  130  ----SPRISHEMPCFFSPRNTPIQSPMSAPIYSPHLFKIAEQRT  169
                +P++SH++P FFSPRN     P   P   P   +I+  R 
Sbjct  143  VHVTTPKLSHQIPVFFSPRNAVPMLPRPKPREKPRPLRISNTRA  186

>PYAP_20399
Length=135

 Score = 37.7 bits (86),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 38/64 (59%), Gaps = 8/64 (13%)

Query  87   QFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEP-----MSPAASIESPRISHEMPCFF  141
            QFLF+ GSD    + V    + GY+++   ++         S A+ I++P+ISH++P FF
Sbjct  68   QFLFFCGSDN---SGVAAGRRTGYQTNHDFSFANAEVQARASRASEIQAPQISHKIPVFF  124

Query  142  SPRN  145
            +P++
Sbjct  125  APQH  128

>PYAR_19462
Length=116

 Score = 36.2 bits (82),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 35/78 (45%), Gaps = 20/78 (26%)

Query  72   SPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESP  131
            + L  S E     + QFLF+ GSD            +  R+ + S+          IE+P
Sbjct  56   AALARSRESSVNERPQFLFFCGSDT-----------SAARASLKSSK---------IETP  95

Query  132  RISHEMPCFFSPRNTPIQ  149
             ISH MP FF+P+N  + 
Sbjct  96   MISHRMPVFFNPQNAMLH  113

>PYIR_14499
Length=186

 Score = 37.0 bits (84),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 44/95 (46%), Gaps = 14/95 (15%)

Query  77   SYEEEDE---RQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRI  133
            +YE+E E   ++  F+FY G D  TPNS          SD+     E    A+ + +P+I
Sbjct  85   TYEKEYEASIKKTDFMFYCGFD--TPNSTAP-------SDLDEEMHEER--ASLVATPKI  133

Query  134  SHEMPCFFSPRNTPIQSPMSAPIYSPHLFKIAEQR  168
            S  +P FFSPRN     P   P       ++A  R
Sbjct  134  SRNIPVFFSPRNAVPMLPRPKPREKRQPMRMASTR  168

>PYVX_15867
Length=187

 Score = 34.7 bits (78),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 39/72 (54%), Gaps = 10/72 (14%)

Query  87   QFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMS---PAASIESPRISHEMPCFFSP  143
            QFLF+ GSD  + +S  G   N   S  ++  +  ++   PAA    P ISH+MP FF+P
Sbjct  112  QFLFFCGSD--SRDSGRGWKNNSPESTELAQRLTSLNFPMPAA----PAISHKMPVFFTP  165

Query  144  RN-TPIQSPMSA  154
               T   SP++A
Sbjct  166  AQPTQATSPLAA  177

>PHYKE_7136
Length=689

 Score = 35.0 bits (79),  Expect = 0.22, Method: Composition-based stats.
 Identities = 26/94 (28%), Positives = 42/94 (45%), Gaps = 14/94 (15%)

Query  71   NSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIES  130
            NSPL+++  +  +  V+FL   G++P T N  G    +  + D I  Y+ P+        
Sbjct  94   NSPLHFAAAQSRDDAVKFLVSHGANPATRNRSGRTPYDVAKGDNIRQYLLPL--------  145

Query  131  PRISHEMPC----FFSPRNTPIQSPMSA-PIYSP  159
             +  HE P     F  P  TP   P +  P+ +P
Sbjct  146  -QFQHEDPAQATSFLPPGITPSVDPTAPRPVIAP  178

>PYAR_20344
Length=630

 Score = 33.9 bits (76),  Expect = 0.46, Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 38/87 (44%), Gaps = 13/87 (15%)

Query  71   NSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIES  130
            N+PL+++  +     V+FL   G++P T N  G    +  + D I  Y+ P+        
Sbjct  92   NTPLHFAASQSHFEAVKFLVGAGANPATRNRNGKTAYDVAKGDSIRQYLLPL--------  143

Query  131  PRISHEMP----CFFSPRNTPIQSPMS  153
             +  HE P     F  P  TP   P++
Sbjct  144  -QFRHEDPNLAKSFLPPGITPTADPLA  169

>PITG_00011
Length=160

 Score = 33.1 bits (74),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 26/67 (39%)

Query  84   RQVQFLFYGGSDPPT-------PNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHE  136
            ++V FLF+GGSD  +       P+ +  LHQN  R                   P +  +
Sbjct  93   QRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIR-------------------PSLQAK  133

Query  137  MPCFFSP  143
            MP FFSP
Sbjct  134  MPLFFSP  140

>PYVX_19354
Length=643

 Score = 33.1 bits (74),  Expect = 1.0, Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 7/72 (10%)

Query  70   ANSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPM-------  122
            +N+PL+++  +  E  V+FL   GS+P   N  G    +  + D I  Y+ P+       
Sbjct  67   SNTPLHFAASQGHEEAVKFLIGQGSNPALRNRNGRTAYDAAKGDRIRQYLLPLQFRHEDP  126

Query  123  SPAASIESPRIS  134
            S AA++  P I+
Sbjct  127  SQAAAMLPPGIT  138

>H257_03418
Length=532

 Score = 32.7 bits (73),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query  77   SYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDM--ISN-YVEPMS  123
            ++E+ DER V++LF  G  P +  SV  L     +SDM  IS  Y+ P+S
Sbjct  363  AFEQGDERDVRYLFETGHLPTSSKSVRKLVAKALQSDMANISQVYLGPLS  412

>SDRG_10804
Length=1471

 Score = 32.7 bits (73),  Expect = 1.3, Method: Composition-based stats.
 Identities = 20/72 (28%), Positives = 32/72 (44%), Gaps = 13/72 (18%)

Query  82   DERQVQFLFYGGSDPPT-----PNSVGGLHQNGYRSDMISNYVEP--MSPAASIESPRIS  134
            DER+          PPT     P+ +      GY+   + +  EP  +SP   + +PR +
Sbjct  96   DERKAM------RSPPTTMANVPSYMRQTVSRGYKEGTLQHPAEPSSVSPPKKVPTPRQA  149

Query  135  HEMPCFFSPRNT  146
            H++P  F P  T
Sbjct  150  HKVPTSFKPTTT  161

>PYAP_15394
Length=676

 Score = 32.7 bits (73),  Expect = 1.4, Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 44/96 (46%), Gaps = 8/96 (8%)

Query  71   NSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPM-------S  123
            N+PL+++  +     V+FL   G++P   N  G    +  + D I  Y+ P+       +
Sbjct  92   NTPLHFAASQSQFEMVKFLINSGANPAARNRNGKTPYDVAKGDNIRQYLLPLQFRHEDPN  151

Query  124  PAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYSP  159
             AAS+  P I+  +    +PR      PM+   Y+P
Sbjct  152  VAASMLPPGITPSVDP-LAPRPEIAPPPMAGMPYNP  186

>PPTG_02352
Length=392

 Score = 31.6 bits (70),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 41/94 (44%), Gaps = 14/94 (15%)

Query  71   NSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIES  130
            NSPL+Y+  +  +  V+FL   G++P   N  G    +  + D I  Y+ P+        
Sbjct  92   NSPLHYAAAQSRDEAVKFLVNHGANPALRNRSGRTPYDVAKGDNIRQYLLPL--------  143

Query  131  PRISHEMPC----FFSPRNTPIQSPMSA-PIYSP  159
             +  HE P        P  TP   PM+  P+ +P
Sbjct  144  -QFRHEDPAQAATMLPPGITPSVDPMAPRPVIAP  176

>PHYSO_296556
Length=136

 Score = 30.4 bits (67),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 31/68 (46%), Gaps = 4/68 (6%)

Query  87   QFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNT  146
            QFLF+ G+D     S      NG  + + S      +PA +   P I H MP FF P  +
Sbjct  68   QFLFFCGTDSSGSPSAELTAANG--TTLASRIASMNAPAPA--QPAIDHHMPVFFMPPLS  123

Query  147  PIQSPMSA  154
            P+   + A
Sbjct  124  PVAPELGA  131

>PYU1_G003462
Length=638

 Score = 31.2 bits (69),  Expect = 3.4, Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 38/87 (44%), Gaps = 13/87 (15%)

Query  71   NSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIES  130
            N+PL+++  +  E  V+FL   G++P   N  G    +  + D I  Y+ P+        
Sbjct  92   NTPLHFAASQGHEDAVRFLINSGANPALRNRNGKTPYDIAKGDRIRQYLLPL--------  143

Query  131  PRISHEMP----CFFSPRNTPIQSPMS  153
             +  HE P     +  P  TP   P++
Sbjct  144  -QFRHEDPQQAAAYLPPGITPSVDPLA  169

>HYAP_06046
Length=392

 Score = 30.8 bits (68),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 42/94 (45%), Gaps = 14/94 (15%)

Query  71   NSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIES  130
            NSPL+Y+  +  +  V+FL   G++P   N  G    +  + D I  Y+ P+        
Sbjct  92   NSPLHYAAAQSRDEAVRFLVDNGANPALRNRQGRTAYDVAKGDNIRQYLLPL--------  143

Query  131  PRISHEMPCFFS----PRNTPIQSPMSA-PIYSP  159
             +  HE P   +    P  TP   PM+  P+ +P
Sbjct  144  -QFRHEDPAQVASQLPPGITPSVDPMAPRPVIAP  176

>SPRG_12792
Length=288

 Score = 30.8 bits (68),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 16/67 (24%), Positives = 29/67 (43%), Gaps = 1/67 (1%)

Query  92   GGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQSP  151
            GG     P  +G  H    R+D      E  +   ++E   + HE+  F + +N P  +P
Sbjct  86   GGKAKKLPKPMGAAHAT-ERNDCFVMVSEAAASCLALEKRWMDHEVDAFLASKNVPQGAP  144

Query  152  MSAPIYS  158
            + A + +
Sbjct  145  VPAGLLT  151

>PHYRA_93809
Length=685

 Score = 30.8 bits (68),  Expect = 4.8, Method: Composition-based stats.
 Identities = 21/71 (30%), Positives = 34/71 (48%), Gaps = 7/71 (10%)

Query  71   NSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPM-------S  123
            NSPL+Y+  +     V+FL   G++P   N  G    +  + D I  Y+ P+       +
Sbjct  154  NSPLHYAAAQSRYDAVKFLVEKGANPALRNRSGRTAYDVAKGDNIRQYLLPLQFRHEDPT  213

Query  124  PAASIESPRIS  134
             AAS+  P I+
Sbjct  214  QAASMLPPGIT  224

>PPTG_16672
Length=286

 Score = 30.4 bits (67),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 29/67 (43%), Gaps = 26/67 (39%)

Query  84   RQVQFLFYGGSDPPT-------PNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHE  136
            ++V FLF+GGSD  +       P+ +  LH+N  R                   P +  +
Sbjct  219  QRVSFLFFGGSDVDSTFQPELRPSELDDLHENDIR-------------------PSLQAK  259

Query  137  MPCFFSP  143
            MP FFSP
Sbjct  260  MPLFFSP  266

>PYVX_15863
Length=181

 Score = 30.0 bits (66),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 30/56 (54%), Gaps = 12/56 (21%)

Query  87   QFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFS  142
            +FLFYGGSD      V G     ++ D+  ++++ + P+A    P +   MP FFS
Sbjct  116  EFLFYGGSD------VDG----AFKPDLRPSHLDLVQPSAI--RPVVKQHMPVFFS  159

>PITG_11012
Length=395

 Score = 30.4 bits (67),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 25/94 (27%), Positives = 41/94 (44%), Gaps = 14/94 (15%)

Query  71   NSPLNYSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIES  130
            NSPL+Y+  +  +  V++L   G++P   N  G    +  + D I  Y+ P+        
Sbjct  92   NSPLHYAAAQSRDEAVKYLVNHGANPALRNRSGRTPYDIAKGDNIRQYLLPL--------  143

Query  131  PRISHEMP----CFFSPRNTPIQSPMSA-PIYSP  159
             +  HE P        P  TP   PM+  P+ +P
Sbjct  144  -QFRHEDPSQAATMLPPGITPSMDPMAPRPVIAP  176

>PHYSO_478253
Length=169

 Score = 29.6 bits (65),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 26/66 (39%)

Query  85   QVQFLFYGGSDPPT-------PNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEM  137
            +V FLF+GGSD  +       P+ +  LH+N  R                   P +  +M
Sbjct  103  RVSFLFFGGSDVDSTFQPELRPSELDDLHENEIR-------------------PSLQVKM  143

Query  138  PCFFSP  143
            P FFSP
Sbjct  144  PLFFSP  149

Lambda      K        H        a         alpha
   0.319    0.135    0.428    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7377564909

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40