Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYCA_1044294084764564530980.0
PHYSO_344705926279865730590.0
PPTG_02122926265765730590.0
PHYRA_72463926265865830530.0
PITG_11244926266366330440.0
PHYSO_4800105698665365729770.0
PHYSO_485614926765365729690.0
PHYCA_104465926765365429590.0
PHYRA_724155698665565829580.0
PHYCA_1043356903565665429490.0
PHYSO_486085926565361529420.0
PYU1_G0139279729164965729320.0
PYAP_173349729165065729250.0
PITG_11249926765365729000.0
PITG_11247926565365728990.0
SPRG_04533926765265328230.0
SDRG_11899926765265328220.0
H310_0261014834765065328150.0
PYVX_15641926262965727870.0
PHYCA_5329125698662665427570.0
SDRG_1147312211563660827510.0
SPRG_0006812211564361227500.0
PYIW_16876926264361527290.0
CCI4322116052066061527280.0
PYU1_G013931926266361127150.0
CCI40249926766060726960.0
PYAP_192359943964361226940.0
CCA16153926766360726940.0
PITG_11252927065465726720.0
HYAP_01537927065161526580.0
PHYSO_482793927065865826540.0
PYAP_17333926265761126400.0
H310_09557926764460726150.0
H257_12958926764960726110.0
PHYRA_71655927065365726060.0
PHALS_09802927065161526040.0
PHYCA_104444927064465825930.0
PHYKE_7016927065061225800.0
H257_1732214834760659925800.0
CCA14967152039143160025600.0
PYAR_198079262161361425540.0
PYIR_15859926262661125210.0
CCI4024715245664365624800.0
PPTG_196902483756656124720.0
CCA1615115245664365524610.0
HYAP_015407534563462124350.0
PYVX_229818037761265624300.0
PYIR_158579729157765723240.0
PHALS_043303140378544521520.0
PHYKE_69845698645045021240.0
PYIW_168739729149649921060.0
PPTG_0212075345100148319940.0
H310_0943447865861718860.0
PYU1_G00409847865661118850.0
PHALS_0083347865261118830.0
PYVX_1673847865861618820.0
PYIW_2175547865861118800.0
PYAR_18354478108461118790.0
PYAP_1334147865761418780.0
PHALS_013383001738337818700.0
PHYSO_28637647866061118560.0
PYU1_G0040979399666360818510.0
PPTG_0824547865861118500.0
PHYCA_51069647865961118490.0
HYAP_0100547866061118480.0
HYAP_010049399666061118480.0
PHYRA_7104247865461618440.0
PHYKE_799247865761118350.0
PITG_0052747865661118260.0
CCI5023447866561318200.0
SDRG_0356447865861818170.0
CCA2493647866161618040.0
H257_0000712754278760717180.0
H310_1475912754278760717140.0
SDRG_05777976178660517070.0
CCA20828976178760517060.0
SPRG_1051912754278260517050.0
H257_18885976178660417020.0
CCI46091976178760517020.0
HYAP_12660976178660516990.0
PITG_11913976178660516850.0
PPTG_03121976178660516840.0
PYVX_18121976163360516810.0
PYIW_221448493763360516800.0
PYAP_222388493763360516800.0
PYIR_243878493763360516790.0
SPRG_0033347861561816770.0
PYU1_G0015408493763360516770.0
PHYRA_78193976178660516770.0
PHYKE_10815976178660516740.0
PYIW_2656716585556453716690.0
PHALS_02079976178660516690.0
PHYRA_418886871958634816640.0
PHYCA_509820976178660516580.0
SPRG_10477976176259916100.0
PHYRA_478736903539639915770.0
PYIR_1673747851149115180.0
H310_026044159331229814870.0
PHYRA_47865926738138014760.0
PHYRA_722386941960160814200.0
PYAP_197381272864857513326e-176
PYU1_G0037541272865057513282e-175
PYVX_150511272863257313254e-175
PHYKE_90081272865057512996e-171
H310_066311272865156112971e-170
H257_012771272865256712971e-170
PITG_157861272863358012916e-170
PPTG_182741272864858012901e-169
PHYCA_5411341272863358012863e-169
PHALS_076161272867757312903e-169
PHYRA_711231272863358012854e-169
PHYSO_5004801272863358012838e-169
SDRG_110431272864956112831e-168
PHYSO_5254295984561059912783e-168
CCI459821272866160812754e-167
CCA215141272865957912676e-166
SDRG_0581612754247948412392e-164
PYIR_196971272860855412452e-163
PYAR_221881272863458312439e-163
SPRG_022941272863454912072e-157
PHYSO_3396666941958560611962e-156
PPTG_021219729122221110925e-146
PITG_153701240847428810853e-141
PYAR_144875698646728810828e-141
PYAR_199308493762541710932e-140
PYAP_16216309756451710586e-136
HYAP_01993309756952710511e-134
PPTG_16727927021720710151e-134
PHYSO_552116309757051710473e-134
PYU1_G006940309756551710379e-133
PPTG_10122309756951710361e-132
PHYRA_71591309757051710335e-132
PHYKE_64309756951710203e-130
PYIR_24123309756751710187e-130
PITG_03546309756951710143e-129
SDRG_10038309756551210003e-127
PITG_0572148643022929745e-127
PHALS_0039030975695449849e-125
SPRG_111331278736764489912e-124
PHYCA_5322073097111852510109e-123
PYVX_1769230975515279653e-122
H310_1276530975605209533e-120
SPRG_1569530975815179511e-119
H257_0765030975634909385e-118
PYAR_2470430975254959347e-118
PYIR_16738939965553289175e-115
SDRG_057781275266182409218e-115
PHYKE_2977753452202208743e-113
CCI4758230975825538961e-111
PYIW_19165309711245169233e-110
CCA2022930975835538796e-109
PYAR_246871058826185478442e-103
PITG_15111122191861698043e-103
PYIW_17145127284433958083e-100
PHALS_1279092652141637691e-97
PHYSO_54956197613613667822e-97
PHYSO_493381133105625057974e-97
PITG_16528133105615057958e-97
PHYRA_79054133105635067871e-95
PHYCA_6458133105605087764e-94
PYAR_14579133105675077775e-94
PPTG_05819133105615067722e-93
PYU1_G002895133105615057722e-93
SDRG_171221278733613707385e-91
PHALS_02692133105575057512e-90
H310_03911133105705167523e-90
SPRG_01255133105665007479e-90
PYIW_17320133105634987442e-89
PYIR_13638133105434997372e-88
PHYRA_51904408471291276931e-87
CCI45261133105585077303e-87
H257_01680133105715187112e-84
PYVX_13615133105855287104e-84
SDRG_16621133105314937056e-84
CCA22305133105615107042e-83
PYAP_19903133105275047003e-83
H257_167751460792912486785e-83
HYAP_01857133104924676887e-82
SDRG_010681221786216196933e-81
PHALS_00667297021421426513e-81
PHYSO_5252361275422462246572e-80
SPRG_001831221796096106601e-76
SPRG_001821221786156186462e-74
SDRG_010671221796116126287e-72
PYVX_13288457648106796371e-71
PYAP_18643457648046786352e-71
PYAR_15468457647696486262e-70
PHALS_04095457648036746194e-69
CCA159131523708576936145e-68
SPRG_06720139304253905869e-68
CCI467091523708196936046e-67
H257_04453139304233885762e-66
SDRG_16559139304613905774e-66
HYAP_06818127283162985578e-65
PHYSO_249932300172321995471e-64
H310_12260139304243905622e-64
PHALS_09281139304653975644e-64
H257_164841261517956745834e-64
PYIW_142318611412435415925e-64
PYU1_G008851457647953935721e-62
PHYRA_53570139303953955462e-62
PHYCA_111740415938103915694e-62
SPRG_104761275262702765328e-62
PHYCA_120845139304443925461e-61
PPTG_09003139304493965461e-61
PYIR_21692139304683975461e-61
PPTG_19375457648093915651e-61
PHYRA_82545457648063915633e-61
H310_062291261518003925606e-61
PYIW_19956139304593965391e-60
PHALS_08498127148957245602e-60
PHYKE_6664457648043915554e-60
PHYSO_247517457647946435535e-60
PITG_17383139304383985335e-60
PYU1_G006843139304813975304e-59
PYU1_G000896861147116515417e-59
CCA27145139304634025214e-58
PPTG_04054314033243055089e-58
HYAP_015389267130934855e-57
SDRG_032661261517923915316e-57
SPRG_080601261517933915307e-57
HYAP_07918127148974045338e-57
PHYCA_504114127148875475284e-56
PPTG_17083237953042144921e-55
PYIR_25979861144383875003e-55
PYAP_19741127148854015204e-55
PHYRA_73661127148845515204e-55
PYAP_21865139304814105015e-55
PITG_15771127148834025179e-55
HYAP_04460457648183935061e-53
PHYSO_2555061271412285515112e-53
PYAR_16202127148935375082e-53
PHYSO_339667525751601524614e-53
PHYKE_9011127149024045046e-53
H310_014931481489094065037e-53
H310_01496127149044065011e-52
PPTG_14555167767035464952e-52
PPTG_18280242463843584753e-52
PHYSO_285382139303793534711e-51
HYAP_01856618952892894551e-50
CCA21519127149295454852e-50
H257_00287127148934064833e-50
PYIR_18381457647473934794e-50
PYIR_24220127149084064834e-50
SDRG_01828127148665574815e-50
PYVX_18450139303863684579e-50
PHYCA_55893426644894884649e-50
PYVX_15061127148914044799e-50
CCI11769139303723604472e-48
SPRG_06288127148695514702e-48
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYCA_104429

Length=645
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYCA_104429                                                          1197       0.0   
PHYSO_344705                                                          1182       0.0   
PPTG_02122                                                            1182       0.0   
PHYRA_72463                                                           1180       0.0   
PITG_11244                                                            1177       0.0   
PHYSO_480010                                                          1151       0.0   
PHYSO_485614                                                          1148       0.0   
PHYCA_104465                                                          1144       0.0   
PHYRA_72415                                                           1144       0.0   
PHYCA_104335                                                          1140       0.0   
PHYSO_486085                                                          1137       0.0   
PYU1_G013927                                                          1134       0.0   
PYAP_17334                                                            1131       0.0   
PITG_11249                                                            1121       0.0   
PITG_11247                                                            1121       0.0   
SPRG_04533                                                            1092       0.0   
SDRG_11899                                                            1091       0.0   
H310_02610                                                            1088       0.0   
PYVX_15641                                                            1078       0.0   
PHYCA_532912                                                          1066       0.0   
SDRG_11473                                                            1064       0.0   
SPRG_00068                                                            1063       0.0   
PYIW_16876                                                            1055       0.0   
CCI43221                                                              1055       0.0   
PYU1_G013931                                                          1050       0.0   
CCI40249                                                              1043       0.0   
PYAP_19235                                                            1042       0.0   
CCA16153                                                              1042       0.0   
PITG_11252                                                            1033       0.0   
HYAP_01537                                                            1028       0.0   
PHYSO_482793                                                          1026       0.0   
PYAP_17333                                                            1021       0.0   
H310_09557                                                            1011       0.0   
H257_12958                                                            1010       0.0   
PHYRA_71655                                                           1008       0.0   
PHALS_09802                                                           1007       0.0   
PHYCA_104444                                                          1003       0.0   
PHYKE_7016                                                            998        0.0   
H257_17322                                                            998        0.0   
CCA14967                                                              990        0.0   
PYAR_19807                                                            988        0.0   
PYIR_15859                                                            975        0.0   
CCI40247                                                              959        0.0   
PPTG_19690                                                            956        0.0   
CCA16151                                                              952        0.0   
HYAP_01540                                                            942        0.0   
PYVX_22981                                                            940        0.0   
PYIR_15857                                                            899        0.0   
PHALS_04330                                                           833        0.0   
PHYKE_6984                                                            822        0.0   
PYIW_16873                                                            815        0.0   
PPTG_02120                                                            772        0.0   
H310_09434                                                            731        0.0   
PYU1_G004098                                                          730        0.0   
PHALS_00833                                                           729        0.0   
PYVX_16738                                                            729        0.0   
PYIW_21755                                                            728        0.0   
PYAR_18354                                                            728        0.0   
PYAP_13341                                                            728        0.0   
PHALS_01338                                                           724        0.0   
PHYSO_286376                                                          719        0.0   
PYU1_G004097                                                          717        0.0   
PPTG_08245                                                            717        0.0   
PHYCA_510696                                                          716        0.0   
HYAP_01005                                                            716        0.0   
HYAP_01004                                                            716        0.0   
PHYRA_71042                                                           714        0.0   
PHYKE_7992                                                            711        0.0   
PITG_00527                                                            707        0.0   
CCI50234                                                              705        0.0   
SDRG_03564                                                            704        0.0   
CCA24936                                                              699        0.0   
H257_00007                                                            666        0.0   
H310_14759                                                            664        0.0   
SDRG_05777                                                            662        0.0   
CCA20828                                                              661        0.0   
SPRG_10519                                                            661        0.0   
H257_18885                                                            660        0.0   
CCI46091                                                              660        0.0   
HYAP_12660                                                            659        0.0   
PITG_11913                                                            653        0.0   
PPTG_03121                                                            653        0.0   
PYVX_18121                                                            652        0.0   
PYIW_22144                                                            651        0.0   
PYAP_22238                                                            651        0.0   
PYIR_24387                                                            651        0.0   
SPRG_00333                                                            650        0.0   
PYU1_G001540                                                          650        0.0   
PHYRA_78193                                                           650        0.0   
PHYKE_10815                                                           649        0.0   
PYIW_26567                                                            647        0.0   
PHALS_02079                                                           647        0.0   
PHYRA_41888                                                           645        0.0   
PHYCA_509820                                                          643        0.0   
SPRG_10477                                                            624        0.0   
PHYRA_47873                                                           612        0.0   
PYIR_16737                                                            589        0.0   
H310_02604                                                            577        0.0   
PHYRA_47865                                                           573        0.0   
PHYRA_72238                                                           551        0.0   
PYAP_19738                                                            517        6e-176
PYU1_G003754                                                          516        2e-175
PYVX_15051                                                            514        4e-175
PHYKE_9008                                                            504        6e-171
H310_06631                                                            504        1e-170
H257_01277                                                            504        1e-170
PITG_15786                                                            501        6e-170
PPTG_18274                                                            501        1e-169
PHYCA_541134                                                          499        3e-169
PHALS_07616                                                           501        3e-169
PHYRA_71123                                                           499        4e-169
PHYSO_500480                                                          498        8e-169
SDRG_11043                                                            498        1e-168
PHYSO_525429                                                          496        3e-168
CCI45982                                                              495        4e-167
CCA21514                                                              492        6e-166
SDRG_05816                                                            481        2e-164
PYIR_19697                                                            484        2e-163
PYAR_22188                                                            483        9e-163
SPRG_02294                                                            469        2e-157
PHYSO_339666                                                          465        2e-156
PPTG_02121                                                            425        5e-146
PITG_15370                                                            422        3e-141
PYAR_14487                                                            421        8e-141
PYAR_19930                                                            425        2e-140
PYAP_16216                                                            412        6e-136
HYAP_01993                                                            409        1e-134
PPTG_16727                                                            395        1e-134
PHYSO_552116                                                          407        3e-134
PYU1_G006940                                                          404        9e-133
PPTG_10122                                                            403        1e-132
PHYRA_71591                                                           402        5e-132
PHYKE_64                                                              397        3e-130
PYIR_24123                                                            396        7e-130
PITG_03546                                                            395        3e-129
SDRG_10038                                                            389        3e-127
PITG_05721                                                            379        5e-127
PHALS_00390                                                           383        9e-125
SPRG_11133                                                            386        2e-124
PHYCA_532207                                                          393        9e-123
PYVX_17692                                                            376        3e-122
H310_12765                                                            371        3e-120
SPRG_15695                                                            370        1e-119
H257_07650                                                            365        5e-118
PYAR_24704                                                            364        7e-118
PYIR_16738                                                            357        5e-115
SDRG_05778                                                            359        8e-115
PHYKE_2977                                                            341        3e-113
CCI47582                                                              349        1e-111
PYIW_19165                                                            360        3e-110
CCA20229                                                              343        6e-109
PYAR_24687                                                            329        2e-103
PITG_15111                                                            314        3e-103
PYIW_17145                                                            315        3e-100
PHALS_12790                                                           300        1e-97 
PHYSO_549561                                                          305        2e-97 
PHYSO_493381                                                          311        4e-97 
PITG_16528                                                            310        8e-97 
PHYRA_79054                                                           307        1e-95 
PHYCA_6458                                                            303        4e-94 
PYAR_14579                                                            303        5e-94 
PPTG_05819                                                            301        2e-93 
PYU1_G002895                                                          301        2e-93 
SDRG_17122                                                            288        5e-91 
PHALS_02692                                                           293        2e-90 
H310_03911                                                            294        3e-90 
SPRG_01255                                                            292        9e-90 
PYIW_17320                                                            291        2e-89 
PYIR_13638                                                            288        2e-88 
PHYRA_51904                                                           271        1e-87 
CCI45261                                                              285        3e-87 
H257_01680                                                            278        2e-84 
PYVX_13615                                                            278        4e-84 
SDRG_16621                                                            276        6e-84 
CCA22305                                                              275        2e-83 
PYAP_19903                                                            274        3e-83 
H257_16775                                                            265        5e-83 
HYAP_01857                                                            269        7e-82 
SDRG_01068                                                            271        3e-81 
PHALS_00667                                                           255        3e-81 
PHYSO_525236                                                          257        2e-80 
SPRG_00183                                                            258        1e-76 
SPRG_00182                                                            253        2e-74 
SDRG_01067                                                            246        7e-72 
PYVX_13288                                                            249        1e-71 
PYAP_18643                                                            249        2e-71 
PYAR_15468                                                            245        2e-70 
PHALS_04095                                                           243        4e-69 
CCA15913                                                              241        5e-68 
SPRG_06720                                                            230        9e-68 
CCI46709                                                              237        6e-67 
H257_04453                                                            226        2e-66 
SDRG_16559                                                            226        4e-66 
HYAP_06818                                                            219        8e-65 
PHYSO_249932                                                          215        1e-64 
H310_12260                                                            221        2e-64 
PHALS_09281                                                           221        4e-64 
H257_16484                                                            229        4e-64 
PYIW_14231                                                            232        5e-64 
PYU1_G008851                                                          224        1e-62 
PHYRA_53570                                                           214        2e-62 
PHYCA_111740                                                          223        4e-62 
SPRG_10476                                                            209        8e-62 
PHYCA_120845                                                          214        1e-61 
PPTG_09003                                                            214        1e-61 
PYIR_21692                                                            214        1e-61 
PPTG_19375                                                            222        1e-61 
PHYRA_82545                                                           221        3e-61 
H310_06229                                                            220        6e-61 
PYIW_19956                                                            212        1e-60 
PHALS_08498                                                           220        2e-60 
PHYKE_6664                                                            218        4e-60 
PHYSO_247517                                                          217        5e-60 
PITG_17383                                                            209        5e-60 
PYU1_G006843                                                          208        4e-59 
PYU1_G000896                                                          213        7e-59 
CCA27145                                                              205        4e-58 
PPTG_04054                                                            200        9e-58 
HYAP_01538                                                            191        5e-57 
SDRG_03266                                                            209        6e-57 
SPRG_08060                                                            208        7e-57 
HYAP_07918                                                            209        8e-57 
PHYCA_504114                                                          207        4e-56 
PPTG_17083                                                            194        1e-55 
PYIR_25979                                                            197        3e-55 
PYAP_19741                                                            204        4e-55 
PHYRA_73661                                                           204        4e-55 
PYAP_21865                                                            197        5e-55 
PITG_15771                                                            203        9e-55 
HYAP_04460                                                            199        1e-53 
PHYSO_255506                                                          201        2e-53 
PYAR_16202                                                            200        2e-53 
PHYSO_339667                                                          182        4e-53 
PHYKE_9011                                                            198        6e-53 
H310_01493                                                            198        7e-53 
H310_01496                                                            197        1e-52 
PPTG_14555                                                            195        2e-52 
PPTG_18280                                                            187        3e-52 
PHYSO_285382                                                          186        1e-51 
HYAP_01856                                                            179        1e-50 
CCA21519                                                              191        2e-50 
H257_00287                                                            190        3e-50 
PYIR_18381                                                            189        4e-50 
PYIR_24220                                                            190        4e-50 
SDRG_01828                                                            189        5e-50 
PYVX_18450                                                            180        9e-50 
PHYCA_558934                                                          183        9e-50 
PYVX_15061                                                            189        9e-50 
CCI11769                                                              176        2e-48 
SPRG_06288                                                            185        2e-48 
PYIW_19676                                                            181        5e-48 
PPTG_13159                                                            169        1e-47 
PYU1_G003764                                                          180        1e-46 
HYAP_10418                                                            168        4e-46 
PHYSO_321565                                                          176        9e-46 
PITG_21580                                                            175        1e-45 
CCI45987                                                              173        3e-44 
PITG_03068                                                            168        2e-43 
PHYSO_249902                                                          152        2e-42 
H310_10060                                                            152        6e-42 
PPTG_10700                                                            151        8e-42 
PYAR_22140                                                            157        1e-41 
H257_18082                                                            150        4e-41 
SPRG_11007                                                            156        1e-40 
PYU1_G004743                                                          144        5e-35 
PYIW_21045                                                            141        5e-34 
HYAP_01510                                                            129        6e-34 
HYAP_01511                                                            130        8e-34 
PPTG_22662                                                            135        9e-34 
PHYKE_7077                                                            139        2e-33 
PHALS_00479                                                           137        9e-33 
PYAR_13948                                                            134        9e-32 
PHYSO_353741                                                          133        2e-31 
PPTG_18422                                                            130        2e-30 
PITG_02259                                                            129        3e-30 
PYAP_23247                                                            128        7e-30 
SPRG_00713                                                            126        3e-29 
PYIR_14416                                                            125        6e-29 
H257_18435                                                            124        1e-28 
HYAP_00880                                                            124        2e-28 
PHYCA_502791                                                          123        3e-28 
SDRG_01561                                                            122        5e-28 
PHYKE_585                                                             122        6e-28 
PYVX_22905                                                            117        3e-26 
PHYRA_80453                                                           115        1e-25 
PHYRA_42335                                                           102        4e-25 
H310_05216                                                            113        4e-25 
PPTG_17863                                                            101        5e-24 
SPRG_17185                                                            92.4       1e-21 
PPTG_23878                                                            102        2e-21 
PYVX_22561                                                            96.3       8e-20 
HYAP_04461                                                            86.7       1e-18 
PYVX_17117                                                            91.3       7e-18 
PHYRA_46132                                                           82.4       1e-17 
PHYSO_342817                                                          82.4       6e-17 
PYAP_20766                                                            79.0       3e-14 
PYIW_19781                                                            76.3       2e-13 
CCI45196                                                              69.3       5e-13 
PHYCA_549822                                                          73.9       8e-13 
PPTG_04864                                                            73.9       9e-13 
PHYRA_81377                                                           70.5       1e-11 
PHYRA_82300                                                           69.3       5e-11 
PYU1_G008203                                                          68.6       5e-11 
PYIR_20734                                                            66.2       2e-10 
SPRG_08648                                                            64.3       1e-09 
SDRG_10651                                                            62.8       3e-09 
PHYKE_9691                                                            62.8       6e-09 
PHYSO_532708                                                          58.2       4e-08 
PITG_03970                                                            57.8       5e-08 
PHYSO_383637                                                          51.2       3e-07 
PHYSO_530254                                                          48.5       2e-06 
PPTG_17862                                                            50.4       3e-06 
H310_13261                                                            52.0       7e-06 
PHYRA_54751                                                           46.2       1e-05 
H257_09465                                                            50.4       2e-05 
PITG_11248                                                            46.6       3e-05 
PYAR_19707                                                            49.3       6e-05 
PPTG_09610                                                            43.5       7e-05 
PYIR_22849                                                            47.4       8e-05 
PPTG_23039                                                            41.6       0.002 
PPTG_03570                                                            42.0       0.002 
PYIW_26103                                                            43.5       0.003 
PPTG_22091                                                            37.4       0.011 
PPTG_05521                                                            37.4       0.011 
SDRG_11277                                                            35.8       0.064 
CCI47104                                                              36.6       0.38  
PYAR_14386                                                            35.0       1.9   
PYIW_26201                                                            33.9       3.1   
PYIW_17996                                                            33.9       3.5   
PYU1_G007045                                                          33.5       5.3   
PPTG_24969                                                            30.4       6.2   
PYAR_23626                                                            33.1       6.3   
CCI45203                                                              31.6       6.9   
H257_04365                                                            32.7       8.1   

>PHYCA_104429
Length=645

 Score = 1197 bits (3098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/645 (100%), Positives = 645/645 (100%), Gaps = 0/645 (0%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNKSINPDEAV  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNKSINPDEAV
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNKSINPDEAV  360

Query  361  AYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTF  420
            AYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTF
Sbjct  361  AYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKSQTF  420

Query  421  STYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNV  480
            STYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNV
Sbjct  421  STYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNV  480

Query  481  SAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYN  540
            SAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYN
Sbjct  481  SAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYN  540

Query  541  LRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANPILQ  600
            LRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANPILQ
Sbjct  541  LRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANPILQ  600

Query  601  KMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD
Sbjct  601  KMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  645

>PHYSO_344705
Length=798

 Score = 1182 bits (3059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/657 (98%), Positives = 645/657 (98%), Gaps = 12/657 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  142  MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  201

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQP
Sbjct  202  QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  261

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  262  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  321

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  322  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  381

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  382  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  441

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            K
Sbjct  442  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  501

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  502  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  561

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  562  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  621

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV+EAEKYKSEDEANKVRI
Sbjct  622  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVRI  681

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAI+DKVTETINWLDANQSAEKEEYEGKQ
Sbjct  682  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGKQ  741

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD
Sbjct  742  KELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  798

>PPTG_02122
Length=657

 Score = 1182 bits (3059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/657 (98%), Positives = 644/657 (98%), Gaps = 12/657 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK+TSG GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV+EAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAI+DKVTETINWLDANQSAEKEEYEGKQ
Sbjct  541  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD
Sbjct  601  KELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  657

>PHYRA_72463
Length=658

 Score = 1180 bits (3053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/658 (98%), Positives = 644/658 (98%), Gaps = 13/658 (2%)

Query  1    MAQS-VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59
            MAQ+  SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  360

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  480

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  540

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK
Sbjct  541  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  600

Query  588  QKELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            QKELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD
Sbjct  601  QKELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  658

>PITG_11244
Length=663

 Score = 1177 bits (3044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/663 (93%), Positives = 622/663 (94%), Gaps = 18/663 (3%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK+T+GAGDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITAGAGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKNALENYAYNLRNTLNDEKLKDQISEDDKK I+DKVTETINWLDANQSAEKEEYEGKQ
Sbjct  541  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKVIDDKVTETINWLDANQSAEKEEYEGKQ  600

Query  589  KELEGVANPILQKMY------aaaggapgaeggmpggmpggmpgagappagapDQGPKIE  642
            KELEGVANPILQKMY        A G                   GAPPAGAPDQGPKIE
Sbjct  601  KELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGGMPGAAGGAPPAGAPDQGPKIE  660

Query  643  EVD  645
            EVD
Sbjct  661  EVD  663

>PHYSO_480010
Length=653

 Score = 1151 bits (2977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/657 (92%), Positives = 623/657 (95%), Gaps = 16/657 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKNALENYAY+LRN+LNDEKLK++I E DKK ++DKVTETI WLDA+QS+EKEEYE KQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELEGVANP+LQK+Y     A G  GGMPGGMP G   + AP AG  DQGPKIEEVD
Sbjct  601  KELEGVANPVLQKVY----AAAGGMGGMPGGMPAGAGASAAPSAGGADQGPKIEEVD  653

>PHYSO_485614
Length=653

 Score = 1148 bits (2969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/657 (92%), Positives = 622/657 (95%), Gaps = 16/657 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPFK++SG GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFKISSGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKNALENYAY+LRN+LNDEKLK++I E DKK ++DKVTETI WLDA+QS+EKEEYE KQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELEGVANP+LQK+Y     A G  GGMPGGMP G   + AP AG  DQGPKIEEVD
Sbjct  601  KELEGVANPVLQKVY----AAAGGMGGMPGGMPAGAGASAAPSAGGADQGPKIEEVD  653

>PHYCA_104465
Length=653

 Score = 1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/654 (90%), Positives = 605/654 (93%), Gaps = 17/654 (3%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            + SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  123
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQPEEI
Sbjct  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA
Sbjct  125  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  185  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  245  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPN  351
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            KEPN
Sbjct  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  364

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  365  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  424

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  425  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  484

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK RIEAK
Sbjct  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  544

Query  532  NALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKEL  591
            NALENYAY+LRN+LNDEK+K++I E DKKA++DKVTE I WLDANQS EK+ YE KQKEL
Sbjct  545  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  604

Query  592  EGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            EGVANP+LQKMY     A G               A    +   DQGPKIEEVD
Sbjct  605  EGVANPVLQKMY-----ASGGGMAGGVPGGMPGADAAPTSSSGTDQGPKIEEVD  653

>PHYRA_72415
Length=655

 Score = 1144 bits (2958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/658 (91%), Positives = 614/658 (93%), Gaps = 16/658 (2%)

Query  1    MAQS-VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59
            MAQ+  SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANKVR
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEAKNALENYAY+LRN+LNDEKLK+QI E DKK ++DKVTETI WLDA+QSAE EEYE K
Sbjct  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600

Query  588  QKELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            QKELEGVANPILQKMY     A GA G   G   G      AP +G  DQGPKIEEVD
Sbjct  601  QKELEGVANPILQKMY---AAAGGAPGAEGGVPGGMPGAGAAPSSGGADQGPKIEEVD  655

>PHYCA_104335
Length=656

 Score = 1140 bits (2949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/654 (91%), Positives = 609/654 (93%), Gaps = 14/654 (2%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            + SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  123
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQPEEI
Sbjct  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA
Sbjct  125  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  185  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  245  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPN  351
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            KEPN
Sbjct  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  364

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  365  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  424

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  425  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  484

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK RIEAK
Sbjct  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  544

Query  532  NALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKEL  591
            NALENYAY+LRN+LNDEK+K++I E DKKA++DKVTE I WLDANQS EK+ YE KQKEL
Sbjct  545  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  604

Query  592  EGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            EGVANP+LQKMY  A                     GAPPAGA +QGPKIEEVD
Sbjct  605  EGVANPVLQKMY--AAAGGSPGAEGGMPGGVPGGMPGAPPAGAAEQGPKIEEVD  656

>PHYSO_486085
Length=653

 Score = 1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/615 (94%), Positives = 595/615 (97%), Gaps = 12/615 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDP+VQADI+HWPFK++SG GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPVVQADIQHWPFKISSGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V++F QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VEYFVQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKNALENYAY+LRN+LNDEKLK++I E DKK ++DKVTETI WLDA+QS+EKEEYE KQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600

Query  589  KELEGVANPILQKMY  603
            KELEGVANP+LQK+Y
Sbjct  601  KELEGVANPVLQKVY  615

>PYU1_G013927
Length=649

 Score = 1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/657 (91%), Positives = 618/657 (94%), Gaps = 20/657 (3%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQAVAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQAD KHWPF +++G GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADCKHWPFTVSAGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREV+EAFIGKEV+NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVSEAFIGKEVRNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF QEFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTI
Sbjct  241  VDHFVQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EP KSINPDEAVA+GATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLI+R
Sbjct  361  EPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLISR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV+EAEKYK+EDE+NKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKN LENYAYNLRNTL+DEKLK QISE+D+ AI DKVTETINWLDANQSAEKEE+E KQ
Sbjct  541  EAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELEGVANPILQKMY        A  G  GGMPGG P AGAPPAGAPDQGPKIEEVD
Sbjct  601  KELEGVANPILQKMY--------AAAGGAGGMPGGAPPAGAPPAGAPDQGPKIEEVD  649

>PYAP_17334
Length=650

 Score = 1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/657 (89%), Positives = 604/657 (92%), Gaps = 19/657 (3%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+VSG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQAVSGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPF ++ GAGDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFTVSPGAGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL KMREVAEAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLTKMREVAEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF  EFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFVSEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EP KSINPDEAVA+GATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLI R
Sbjct  361  EPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIPR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSA+EKSTGKENKITITNDKGRLSQADIDRMVSEAEKYK+EDEANK+RI
Sbjct  481  TFDIDANGILNVSAIEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKIRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKN LENYAYNLRNTLNDEKLK QI EDD+KAI+DKVTE INWLDA+Q++EKEE+E KQ
Sbjct  541  EAKNGLENYAYNLRNTLNDEKLKSQIPEDDRKAIDDKVTEVINWLDAHQASEKEEFEAKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELEG+ANPILQKMY        + G   G         G  P+   DQGPKIEEVD
Sbjct  601  KELEGIANPILQKMY-------ASAGAAGGMPGAAPGAPGPAPSAGGDQGPKIEEVD  650

>PITG_11249
Length=653

 Score = 1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/657 (88%), Positives = 605/657 (92%), Gaps = 16/657 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M Q+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGRKFSDP+VQADIKHWPFK+T+G GDKPQITVQFKGE+KTFQP
Sbjct  61   QVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+HF QEFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTI
Sbjct  241  VEHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+I+RMV+EAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSEDEANKVRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKNALENYAY+LRN+LNDEK+K++I E DKK ++DKVTE I W+DA+QS+EKEEYE KQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWMDAHQSSEKEEYESKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELE VANP+LQK+Y     + G  G    G            +   +QGPKIEEVD
Sbjct  601  KELESVANPVLQKVY----ASAGGAGDGMPGSMPNDMPGTDSRSSGAEQGPKIEEVD  653

>PITG_11247
Length=653

 Score = 1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/657 (88%), Positives = 604/657 (92%), Gaps = 16/657 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M Q+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGRKFSDP+VQADIKHWPFK+T+G GDKPQITVQFKGE+KTFQP
Sbjct  61   QVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+HF QEFKRKHRKD+T+NQRALRRLRTACERAKRTLSSS+QAYIEIDSLFDG+DFNSTI
Sbjct  241  VEHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+I+RMV+EAEKYKS DEANK RI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSADEANKARI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKNALENYAY+LRN+LNDEK+K++I E DKK ++DKVTE I WLDA+QS+EKEEYE KQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDAHQSSEKEEYESKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELE VANP+LQK+Y     + G  G    G   G        +   +QGPKIEEVD
Sbjct  601  KELESVANPVLQKVY----ASAGGAGDGMPGGMPGDMPGTDSRSSGAEQGPKIEEVD  653

>SPRG_04533
Length=652

 Score = 1092 bits (2823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/653 (88%), Positives = 599/653 (92%), Gaps = 16/653 (2%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            V G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKRLIGRKF+DP  QADIKHWPFK+T GAGDKPQITV+FKGESKTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEIS  123

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  243

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
            T EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR
Sbjct  244  TAEFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  303

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNK  352
            FEDMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIP            KEP K
Sbjct  304  FEDMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  363

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
            SINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTV
Sbjct  364  SINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTV  423

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQIDVTFDI
Sbjct  424  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDI  483

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGILNVSAVEKSTGKENKITITNDKGRL++ DI+RMV EAEKYKSEDEANK+RIEAKN
Sbjct  484  DANGILNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKN  543

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
             LENYAYNLRNTLNDEKL+ +I E DKKAI+DKVT+ INWLDANQSAEKEE+E KQKELE
Sbjct  544  GLENYAYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELE  603

Query  593  GVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            G+ANPI+QKMYAAAGGAPG   G    M G      A  A    QGPKIEEVD
Sbjct  604  GIANPIMQKMYAAAGGAPGGMPGGMPDMGGAGAPPPASHA----QGPKIEEVD  652

>SDRG_11899
Length=652

 Score = 1091 bits (2822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/653 (88%), Positives = 599/653 (92%), Gaps = 16/653 (2%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            V G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKRLIGRKF+DP  QADIKHWPFK+T GAGDKPQITV+FKGESKTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEIS  123

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  243

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
            T EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRAR
Sbjct  244  TAEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRAR  303

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNK  352
            FEDMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIP            KEP K
Sbjct  304  FEDMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  363

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
            SINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTV
Sbjct  364  SINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTV  423

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQIDVTFDI
Sbjct  424  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDI  483

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGILNVSAVEKSTGKENKITITNDKGRL++ DI+RMV EAEKYKSEDEANK+RIEAKN
Sbjct  484  DANGILNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKN  543

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
             LENYAYNLRNTLNDEKL+ +I E DKKAI+DKVT+ INWLDANQSAEKEE+E KQKELE
Sbjct  544  GLENYAYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELE  603

Query  593  GVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            G+ANPI+QKMYAAAGGAPG   G    M G      A  A    QGPKIEEVD
Sbjct  604  GIANPIMQKMYAAAGGAPGGMPGGMPDMGGAGAPPPASHA----QGPKIEEVD  652

>H310_02610
Length=650

 Score = 1088 bits (2815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/653 (87%), Positives = 598/653 (92%), Gaps = 18/653 (3%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            V G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKRLIGRKF+DP++QADIKHWPFK+T GAGDKPQITV+FKGE+KTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEIS  123

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVLIKM+EV+EA+IG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  243

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
            T EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR
Sbjct  244  TAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  303

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNK  352
            FEDMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIP            KEP K
Sbjct  304  FEDMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCK  363

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
            SINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTV
Sbjct  364  SINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTV  423

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQ+DVTFDI
Sbjct  424  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQVDVTFDI  483

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGILNVSA+EKSTGKENKITITNDKGRL++ DI+RMV EAEKYKSEDEANKVRIEAKN
Sbjct  484  DANGILNVSAIEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKVRIEAKN  543

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
             LENYAYNLRNTLNDEKL+ ++   DKK ++DKVTETI+WLDANQSAEKEE+E KQKELE
Sbjct  544  GLENYAYNLRNTLNDEKLQGKLDAADKKTVDDKVTETISWLDANQSAEKEEFEAKQKELE  603

Query  593  GVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            GVANPI+QK+YAA G   G  G    G  G  P A +       QGPKIEEVD
Sbjct  604  GVANPIMQKLYAAGGAPGGPGGMPDFGAGGAPPPASSA------QGPKIEEVD  650

>PYVX_15641
Length=629

 Score = 1078 bits (2787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/657 (88%), Positives = 590/657 (90%), Gaps = 40/657 (6%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+VSG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQAVSGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPF LTSG GDKPQI VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFTLTSGPGDKPQIQVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+                        QVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDI------------------------QVHEVVLVGGSTRIPKVQQLLSDFFNGK  336

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI R
Sbjct  337  EPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIPR  396

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  397  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  456

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYK+EDEANKVRI
Sbjct  457  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKVRI  516

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            +AKN LENY+YNLRNTLNDEKLK QISE+D+KAI+DKVTETINWLDANQSAEKEE+E KQ
Sbjct  517  DAKNGLENYSYNLRNTLNDEKLKSQISEEDRKAIDDKVTETINWLDANQSAEKEEFEAKQ  576

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELEG+ANPILQKMY     A G   G   G       AGAPPAG  DQGPKIEEVD
Sbjct  577  KELEGIANPILQKMY----AAAGGAPGGMPGGGMPGADAGAPPAGGADQGPKIEEVD  629

>PHYCA_532912
Length=626

 Score = 1066 bits (2757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/654 (86%), Positives = 579/654 (89%), Gaps = 44/654 (7%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            + SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  123
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF++TSGAGDKPQITVQFKGESKTFQPEEI
Sbjct  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPN  351
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK            EPN
Sbjct  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  335  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  394

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK RIEAK
Sbjct  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514

Query  532  NALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKEL  591
            NALENYAY+LRN+LNDEK+K++I E DKKA++DKVTE I WLDANQS EK+ YE KQKEL
Sbjct  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574

Query  592  EGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            EGVANP+LQKMY  A                     GAPPAGA DQGPKIEEVD
Sbjct  575  EGVANPVLQKMY--AAAGGSPGAEGGMPGGVPGGMPGAPPAGAADQGPKIEEVD  626

>SDRG_11473
Length=636

 Score = 1064 bits (2751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/608 (88%), Positives = 568/608 (93%), Gaps = 14/608 (2%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  67
            YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA 
Sbjct  5    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAT  64

Query  68   NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  127
            NTVFDAKRLIGRKF D +VQADIKHWPFK+TSGA DKPQITVQFKGESKTFQPEEISSMV
Sbjct  65   NTVFDAKRLIGRKFHDAVVQADIKHWPFKVTSGAADKPQITVQFKGESKTFQPEEISSMV  124

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            LIKM+E++EA++G  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY
Sbjct  125  LIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  184

Query  188  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            GLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT E
Sbjct  185  GLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTAE  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            FKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRARFED
Sbjct  245  FKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRARFED  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +C DYFRKTMEPVEKVL+DAKLSKSQVHEVVLVGGSTRIP            KEP KSIN
Sbjct  305  LCADYFRKTMEPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPCKSIN  364

Query  356  PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  415
            PDEAVA+GATVQAAILSG+  S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTTVPTK
Sbjct  365  PDEAVAFGATVQAAILSGDTQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTVPTK  424

Query  416  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  475
            KSQTFSTYADNQPGVLIQV+EGERSMT DN+LLGKF+LDGIPPMPRGVPQ+DVTFDIDAN
Sbjct  425  KSQTFSTYADNQPGVLIQVYEGERSMTADNHLLGKFSLDGIPPMPRGVPQVDVTFDIDAN  484

Query  476  GILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALE  535
            GILNVSAVEKSTGKENKITITNDKGRLS+ DIDRMV EAEKYK++DEA+KVR+EAKNALE
Sbjct  485  GILNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRVEAKNALE  544

Query  536  NYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVA  595
            NYAY+LRNTLNDEK+K  I  +DKK ++D V++TINWLD N  AEKEE+E KQKELE VA
Sbjct  545  NYAYSLRNTLNDEKVK--IDVNDKKRLDDMVSDTINWLDHNTHAEKEEFEAKQKELEAVA  602

Query  596  NPILQKMY  603
            NPI+QKMY
Sbjct  603  NPIMQKMY  610

>SPRG_00068
Length=643

 Score = 1063 bits (2750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/612 (87%), Positives = 570/612 (93%), Gaps = 14/612 (2%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            + + YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAKNQVA
Sbjct  2    ATTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKNQVA  61

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  123
            MNA NTVFDAKRLIGRKF D +VQADIKHWPFK+T GA DKPQITV+FKGESKTFQPEEI
Sbjct  62   MNAANTVFDAKRLIGRKFHDAVVQADIKHWPFKVTPGAADKPQITVEFKGESKTFQPEEI  121

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            SSMVLIKM+E++EA++G  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA
Sbjct  122  SSMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  181

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  182  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDH  241

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            FT EFKRKHRKD+T+NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRA
Sbjct  242  FTAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSASAQAYIEIDSLFDGVDFNSTITRA  301

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPN  351
            RFED+C DYFRKTM+PVEKVL+DAKLSKSQVHEVVLVGGSTRIP            KEP 
Sbjct  302  RFEDLCADYFRKTMDPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPC  361

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            KSINPDEAVA+GATVQAAILSG++ S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTT
Sbjct  362  KSINPDEAVAFGATVQAAILSGDNQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTT  421

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            VPTKKSQTFSTYADNQPGVLIQV+EGERSMT DNNLLGKF+LDGIPPMPRGVPQ+DVTFD
Sbjct  422  VPTKKSQTFSTYADNQPGVLIQVYEGERSMTADNNLLGKFSLDGIPPMPRGVPQVDVTFD  481

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGILNVSAVEKSTGKENKITITNDKGRLS+ DIDRMV EAEKYK++DEA+KVR+EAK
Sbjct  482  IDANGILNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRVEAK  541

Query  532  NALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKEL  591
            NALENYAYNLRNTLNDEK+K  I  DDKK ++D VT+TINWLD N  AEKEE+EGKQKEL
Sbjct  542  NALENYAYNLRNTLNDEKVK--IDADDKKRLDDMVTDTINWLDHNSHAEKEEFEGKQKEL  599

Query  592  EGVANPILQKMY  603
            E VANPI+QKMY
Sbjct  600  EAVANPIMQKMY  611

>PYIW_16876
Length=643

 Score = 1055 bits (2729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/615 (86%), Positives = 569/615 (93%), Gaps = 12/615 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQAVAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMN  NTVFDAKRLIGRKFSD +VQAD+KHWPFK+ +GA +KPQI V FKGE+KTFQP
Sbjct  61   QVAMNPANTVFDAKRLIGRKFSDQVVQADLKHWPFKVVAGADNKPQIVVHFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREV+EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAI+GLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVSEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAISGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ FT EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VEFFTAEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+C DYFRKTMEPVE+VLRDAKLSK QV+E+VLVGGSTRIP            K
Sbjct  301  TRARFEDLCADYFRKTMEPVERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSEFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            +  KSINPDEAVA+GATVQAAILSGND S +LQDLLLLDV PLS+GLETAGGVMTTLI R
Sbjct  361  DLYKSINPDEAVAFGATVQAAILSGNDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIPR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+ LGKF+LDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFSLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV EAE+YK  DE NK+R+
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVEEAERYKDADERNKLRV  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKNALENYAY LRN+L +EKL+ +++ DDKK +EDK+ ETI WLDANQ+AEK+E++ KQ
Sbjct  541  EAKNALENYAYGLRNSLQEEKLQAKLAADDKKTLEDKIAETIAWLDANQAAEKDEFDAKQ  600

Query  589  KELEGVANPILQKMY  603
            KELE VA+PILQKMY
Sbjct  601  KELESVASPILQKMY  615

>CCI43221
Length=660

 Score = 1055 bits (2728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/615 (86%), Positives = 571/615 (93%), Gaps = 13/615 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ VSG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQ-VSGPSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  59

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGR+ SDP+VQADIKHWPFK+TS  GDK  ITVQ+KGE+K+F+P
Sbjct  60   QVAMNATNTVFDAKRLIGRRCSDPVVQADIKHWPFKVTSSEGDKTMITVQYKGETKSFRP  119

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMRE+AEAF+GK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  120  EEISSMVLIKMREIAEAFLGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  179

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLD+KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  180  TAAAIAYGLDRKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  239

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF  EF RKHRKDIT NQRALRRLRTACERAKRTLSSSAQA+IEIDSLF+G+DFNSTI
Sbjct  240  VDHFVAEFNRKHRKDITTNQRALRRLRTACERAKRTLSSSAQAHIEIDSLFEGVDFNSTI  299

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+C DYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIP            K
Sbjct  300  TRARFEDLCADYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK  359

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E  KSINPDEAVA+GATVQAAILSG + SEKLQDLLLLDV PLSLGLETAGGVMTTLI R
Sbjct  360  ELCKSINPDEAVAFGATVQAAILSGTEQSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPR  419

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTT+PTKKSQ FSTY +NQPGV IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V
Sbjct  420  NTTLPTKKSQMFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEV  479

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSA+EKST KENKITITNDKGRLSQADIDRMVSEAEKYK EDEAN++RI
Sbjct  480  TFDIDANGILNVSAIEKSTNKENKITITNDKGRLSQADIDRMVSEAEKYKKEDEANRIRI  539

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKN LENYA+NLR+TL+DEK+K+QIS +D+  +E+KV E ++WLDANQSAEKEE+E KQ
Sbjct  540  EAKNGLENYAFNLRSTLDDEKIKNQISPEDRTTVENKVKEVVSWLDANQSAEKEEFEHKQ  599

Query  589  KELEGVANPILQKMY  603
            K+LE VANPI+QKMY
Sbjct  600  KDLEAVANPIMQKMY  614

>PYU1_G013931
Length=663

 Score = 1050 bits (2715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/611 (85%), Positives = 568/611 (93%), Gaps = 12/611 (2%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            V+G SVGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAA+NQVAM
Sbjct  11   VTGQSVGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAARNQVAM  70

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NAHNTVFDAKRLIGRKF+DP+VQAD KHWPFK+ +GA  KPQI VQFKGESKTFQPEEIS
Sbjct  71   NAHNTVFDAKRLIGRKFTDPVVQADTKHWPFKVVAGAESKPQIVVQFKGESKTFQPEEIS  130

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL KM+E+AEA+IGK+VKNAVITVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA
Sbjct  131  SMVLTKMKEIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAA  190

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR+V++F
Sbjct  191  IAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRIVEYF  250

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             QEFKRKHRKD+T NQRALRRLRTACERAKRTLSSS+QAYIEIDSLF+GIDFNSTITRAR
Sbjct  251  VQEFKRKHRKDMTGNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFEGIDFNSTITRAR  310

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNK  352
            FED+C DYFRKTMEPVE+VLRDAKLSKSQVHEVVLVGGSTRIP            K+  K
Sbjct  311  FEDLCADYFRKTMEPVERVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKDLYK  370

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
            SINPDEAVA+GATVQAAILSG+D S +LQDLLLLDV PLS+GLETAGGVMTTLI RNTTV
Sbjct  371  SINPDEAVAFGATVQAAILSGSDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIPRNTTV  430

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDVTFDI
Sbjct  431  PTKKSQTFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDI  490

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMV++AE+YK +DE NK+R+EAKN
Sbjct  491  DANGILNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVTDAERYKDQDERNKLRVEAKN  550

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            +LENYAY+LRN+L +EKL  ++S DDKK ++DK+ ETINWLDANQ+AEKEE+  KQKELE
Sbjct  551  SLENYAYSLRNSLQEEKLASKLSADDKKLLDDKIAETINWLDANQAAEKEEFADKQKELE  610

Query  593  GVANPILQKMY  603
              ANPILQ+MY
Sbjct  611  SFANPILQRMY  621

>CCI40249
Length=660

 Score = 1043 bits (2696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/607 (86%), Positives = 560/607 (92%), Gaps = 12/607 (2%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TVFDAKRLIGR FSDPIVQAD+KHWPF + +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVTFKGEKKIFQPEEISSMVL  124

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            +KMREV+EA+IGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  125  VKMREVSEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  184

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            L+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  185  LEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFVAEF  244

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  308
            KRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARFED+
Sbjct  245  KRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARFEDL  304

Query  309  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSINP  356
            C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIP            KEP KSINP
Sbjct  305  CSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKSINP  364

Query  357  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  416
            DEAVA+GATVQAAILSGND SEKLQDLLLLDV PLSLGLETAGGVMT LI RNTT+PTKK
Sbjct  365  DEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKK  424

Query  417  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  476
            SQ FST+ DNQ  V IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V +DIDANG
Sbjct  425  SQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANG  484

Query  477  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALEN  536
            ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYK +DEANKVRIEAKN LEN
Sbjct  485  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLEN  544

Query  537  YAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVAN  596
            YAYNLRN+LNDEKLK Q+SEDD+K ++DK++ET++WLDANQSAEKEEYE  QK+LE +AN
Sbjct  545  YAYNLRNSLNDEKLKSQLSEDDRKVLDDKISETMSWLDANQSAEKEEYEKLQKDLEAIAN  604

Query  597  PILQKMY  603
            PILQKMY
Sbjct  605  PILQKMY  611

>PYAP_19235
Length=643

 Score = 1042 bits (2694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/612 (85%), Positives = 563/612 (92%), Gaps = 12/612 (2%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            +VSG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  3    AVSGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  62

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  123
            MNAHNTVFDAKRLIGRKF+DP+VQAD+KHWPFK+ +GAGDKPQITV+FKGE K FQPEEI
Sbjct  63   MNAHNTVFDAKRLIGRKFTDPVVQADMKHWPFKVVTGAGDKPQITVEFKGEKKVFQPEEI  122

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            SSMVL KM+E+AEA++G +VKNAVITVPAYFNDSQRQAT+DAG IAGLNV+RIINEPTAA
Sbjct  123  SSMVLTKMKEIAEAYLGTDVKNAVITVPAYFNDSQRQATRDAGTIAGLNVMRIINEPTAA  182

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV++
Sbjct  183  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVEY  242

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            F  EFKRKH+KD+T NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDGIDFNSTITRA
Sbjct  243  FVAEFKRKHKKDLTTNQRALRRLRTACERAKRTLSSSTQAYVEIDSLFDGIDFNSTITRA  302

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPN  351
            RFEDMC DYFRKTMEPVEKVL DAK+ K QVHEVVLVGGSTRIP            KEP 
Sbjct  303  RFEDMCADYFRKTMEPVEKVLHDAKICKGQVHEVVLVGGSTRIPKVQQLLVDFFNGKEPC  362

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            KSINPDEAVA+GA VQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLI RNT 
Sbjct  363  KSINPDEAVAFGAAVQAAILSGDDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIPRNTA  422

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMT+DNNLLGKF+LDGIPPMPRG P+I+VTFD
Sbjct  423  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTKDNNLLGKFSLDGIPPMPRGKPEIEVTFD  482

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGILNVSAVEKSTGK+NKITITNDKGRLSQ++IDRMV EAEKY  ED  NK R++AK
Sbjct  483  IDANGILNVSAVEKSTGKDNKITITNDKGRLSQSEIDRMVKEAEKYAKEDADNKARVDAK  542

Query  532  NALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKEL  591
            N LENYAYNLRN+L+D  +K Q++EDD+K I+D V+ETI WLDA+Q +EK+EYE KQKEL
Sbjct  543  NTLENYAYNLRNSLDDAPVKQQMNEDDRKKIDDAVSETIKWLDAHQMSEKQEYEMKQKEL  602

Query  592  EGVANPILQKMY  603
            EG+ANPILQKMY
Sbjct  603  EGIANPILQKMY  614

>CCA16153
Length=663

 Score = 1042 bits (2694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/607 (87%), Positives = 559/607 (92%), Gaps = 12/607 (2%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TVFDAKRLIGR FSDPIVQAD+KHWPF + +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVIFKGEKKIFQPEEISSMVL  124

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            +KMREV+EA+IGK VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  125  VKMREVSEAYIGKTVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  184

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            L+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  185  LEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFVAEF  244

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  308
            KRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARFED+
Sbjct  245  KRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARFEDL  304

Query  309  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSINP  356
            C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIP            KEP KSINP
Sbjct  305  CSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKSINP  364

Query  357  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  416
            DEAVA+GATVQAAILSGND SEKLQDLLLLDV PLSLGLETAGGVMT LI RNTT+PTKK
Sbjct  365  DEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKK  424

Query  417  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  476
            SQ FST+ DNQ  V IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V +DIDANG
Sbjct  425  SQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANG  484

Query  477  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALEN  536
            ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYK +DEANKVRIEAKN LEN
Sbjct  485  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLEN  544

Query  537  YAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVAN  596
            YAYNLRN+LNDEKLK Q+SEDD+K ++DK++ET+NWLDANQSAEKEEYE  QK+LE +AN
Sbjct  545  YAYNLRNSLNDEKLKSQLSEDDRKILDDKISETMNWLDANQSAEKEEYEKLQKDLEAIAN  604

Query  597  PILQKMY  603
            PILQKMY
Sbjct  605  PILQKMY  611

>PITG_11252
Length=654

 Score = 1033 bits (2672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/657 (81%), Positives = 584/657 (89%), Gaps = 15/657 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M + V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MPEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPF +  GA  KPQ+ VQFKGE KTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFNVIRGAESKPQVVVQFKGEKKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ F  EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTI
Sbjct  241  VEFFVTEFKRKHRKDMTSNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+C +YFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIP            K
Sbjct  301  TRARFEDLCSEYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPKVQQLLKDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E  KSINPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  ELFKSINPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVP+KK+Q+FSTYADNQ GVLIQVFEGER+MTRDN+ LGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPSKKTQSFSTYADNQSGVLIQVFEGERTMTRDNHHLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ+DIDRMV++AEKYK +DE NK+R+
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVADAEKYKDQDERNKLRV  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            E+KNALENYA++LRN+  +EK+  ++SE+DKK+IEDKV ET++WLDANQ+AEKEE++ KQ
Sbjct  541  ESKNALENYAFSLRNSTREEKIAAKLSEEDKKSIEDKVAETLHWLDANQAAEKEEFDAKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            +ELEGVANPILQK+Y       GA  G  GG      G     +   ++GPKIEEVD
Sbjct  601  QELEGVANPILQKIY---ASEAGAGMGGMGGAGPRPGGPSGAGSADGEEGPKIEEVD  654

>HYAP_01537
Length=651

 Score = 1028 bits (2658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/615 (83%), Positives = 562/615 (91%), Gaps = 12/615 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M +SV+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT++ERLIGDAAKN
Sbjct  1    MTESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTESERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDP VQ+DIKHWPFK+T  + DKPQ+ VQFKGE+K FQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPEVQSDIKHWPFKVTRDSADKPQVEVQFKGETKRFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMRE+AEA+IGK+V+NAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLLSIE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF  EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSL DGIDFN+TI
Sbjct  241  VDHFVSEFKRKHRKDMTLNQRALRRLRTACERAKRTLSTSAQAYIEIDSLLDGIDFNTTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+C D+FRKTMEPV +VLRD+KLSK +VHE+VLVGGSTRIP            K
Sbjct  301  TRARFEDLCADFFRKTMEPVAQVLRDSKLSKGEVHEIVLVGGSTRIPKVQQLLIDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E  KSINPDEAVAYGATVQAAILSG  +S KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  ELFKSINPDEAVAYGATVQAAILSGGGASSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVP KKSQ+FSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LDGIPPMPRGVPQIDV
Sbjct  421  NTTVPAKKSQSFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFSLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV++AE YK +DE NK+R+
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVNDAETYKDQDERNKLRV  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            E+KN LENYA+++R +++DEK+  ++S DDKK +EDKV E + WLDAN SAEKEE + KQ
Sbjct  541  ESKNGLENYAFSVRTSVSDEKIAVKLSTDDKKIVEDKVAEILQWLDANHSAEKEEIDAKQ  600

Query  589  KELEGVANPILQKMY  603
            KELEGVANPI+QK+Y
Sbjct  601  KELEGVANPIMQKIY  615

>PHYSO_482793
Length=658

 Score = 1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/658 (81%), Positives = 589/658 (90%), Gaps = 13/658 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M + V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTEPVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVARGPENKPQLVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V++F QEFKRKHR+D++ N RA+RRLRTACERAKRTLS+SAQAYIEIDSL DG DFNSTI
Sbjct  241  VEYFVQEFKRKHRRDLSVNSRAMRRLRTACERAKRTLSTSAQAYIEIDSLLDGTDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+C ++FRKTM+PV +VLRD+KLSK+QV+EVVLVGGSTRIP            K
Sbjct  301  TRARFEDLCNEFFRKTMDPVAQVLRDSKLSKNQVNEVVLVGGSTRIPKVQQLLVDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E  KSINPDEAVAYGATVQAAILSGNDSS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  ELFKSINPDEAVAYGATVQAAILSGNDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTT+P+KK+Q+FSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTIPSKKTQSFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV++AEKYK +DE NK+RI
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVADAEKYKDQDERNKLRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            E+KNALENYA++LR++  +EKL  ++SEDDKK IE KV +T++WLDANQ+AEKEE++ KQ
Sbjct  541  ESKNALENYAFSLRSSTREEKLAAKLSEDDKKTIEYKVADTLHWLDANQAAEKEEFDAKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagap-DQGPKIEEVD  645
            +ELE +ANPILQK+YAA  GA    GGM G    G       P GA  D+GPKIEEVD
Sbjct  601  QELESMANPILQKVYAAEAGAGAGMGGMGGATAAGAGAGPHGPGGADGDEGPKIEEVD  658

>PYAP_17333
Length=657

 Score = 1021 bits (2640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/611 (84%), Positives = 560/611 (92%), Gaps = 12/611 (2%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT TERLIGDAAKNQVAM
Sbjct  6    VTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGTERLIGDAAKNQVAM  65

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NAHNTVFDAKRLIGRKF DP+VQAD+KHWPF++ +G  DKPQI V+FKGESK F  EEIS
Sbjct  66   NAHNTVFDAKRLIGRKFRDPVVQADLKHWPFQVVAGPDDKPQIIVEFKGESKRFYAEEIS  125

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL KMR++AEA+IGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  126  SMVLTKMRDIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV++F
Sbjct  186  IAYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYF  245

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
              EFKRKHR+D++ NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++GIDFNSTITRAR
Sbjct  246  VGEFKRKHRRDMSNNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGIDFNSTITRAR  305

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNK  352
            FED+CGD+FRKTMEPVE+VLRD+KLSKSQV EVVLVGGSTRIP            KE  K
Sbjct  306  FEDLCGDFFRKTMEPVERVLRDSKLSKSQVQEVVLVGGSTRIPKIQQMLSDYFNGKELYK  365

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
            SINPDEAVA+GATVQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTV
Sbjct  366  SINPDEAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTV  425

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LDG+PPMPRGVPQIDVTFDI
Sbjct  426  PTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDGLPPMPRGVPQIDVTFDI  485

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMV EAEKYK +DE NK+R+EAKN
Sbjct  486  DANGILNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVQEAEKYKDQDERNKLRVEAKN  545

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            ALENYA++LR+ + DEKL  ++ +DDKK I+  V   I WLD +Q+AEKEEY+ K KELE
Sbjct  546  ALENYAFSLRSAVQDEKLVMKLDQDDKKTIDSAVNGVIEWLDQHQAAEKEEYDAKMKELE  605

Query  593  GVANPILQKMY  603
            GVANPI+QK+Y
Sbjct  606  GVANPIMQKLY  616

>H310_09557
Length=644

 Score = 1011 bits (2615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/607 (83%), Positives = 559/607 (92%), Gaps = 12/607 (2%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  N
Sbjct  7    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  66

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TVFDAKRLIGRKF+DP++QADIKHWPFK+ +G GDKPQI V+FKGESKTFQPEEISSMVL
Sbjct  67   TVFDAKRLIGRKFNDPMIQADIKHWPFKVVAGPGDKPQIVVEFKGESKTFQPEEISSMVL  126

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            IKM++VAEAFIG EV+NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  127  IKMKQVAEAFIGVEVQNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  186

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            LDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAG+THLGGEDFDNRLVDHFT EF
Sbjct  187  LDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGNTHLGGEDFDNRLVDHFTDEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  308
            KRK++ D+  NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDG+D+N+TITRARFED+
Sbjct  247  KRKYKGDLKTNQRALRRLRTACERAKRTLSSSTQAYLEIDSLFDGMDYNTTITRARFEDL  306

Query  309  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSINP  356
            C DYFRKTMEPV+ VL+DAKLSK+QVHEVVLVGGSTRIP            KE  KSINP
Sbjct  307  CSDYFRKTMEPVKSVLQDAKLSKNQVHEVVLVGGSTRIPKVQQLLSDFFHGKELYKSINP  366

Query  357  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  416
            DEAVA+GATVQAAILSG+  S+KLQDLLLLDVTPLSLGLETAGGVMTTLI+RNTTVPTKK
Sbjct  367  DEAVAFGATVQAAILSGSSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLISRNTTVPTKK  426

Query  417  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  476
            SQTFSTYADNQPGVLIQV+EGER+MT DN+LLGKF+LDG+PPMPRGVPQ+DVTFDIDANG
Sbjct  427  SQTFSTYADNQPGVLIQVYEGERTMTHDNHLLGKFSLDGLPPMPRGVPQVDVTFDIDANG  486

Query  477  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALEN  536
            ILNVSAVEKSTGKENKITITNDKGRLS+ +I+RMV++AEKYK+ED  NK R+EAKN LEN
Sbjct  487  ILNVSAVEKSTGKENKITITNDKGRLSKDEIERMVNDAEKYKAEDTKNKERVEAKNGLEN  546

Query  537  YAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVAN  596
            YAY+LRNTL +EK++  +   DKK +EDKV + I+W+D N +AEK+EYEGKQ+ELE VAN
Sbjct  547  YAYSLRNTLQEEKIQGAMDAGDKKVLEDKVHDIISWMDRNLAAEKDEYEGKQQELESVAN  606

Query  597  PILQKMY  603
            PILQK++
Sbjct  607  PILQKVH  613

>H257_12958
Length=649

 Score = 1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/607 (84%), Positives = 555/607 (91%), Gaps = 12/607 (2%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            SVGIDLGTTYSCVG WQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  N
Sbjct  8    SVGIDLGTTYSCVGTWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  67

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TVFDAKRLIGRKF+DP++QADIKHWPFK+ +GAGDKPQI V+FKGE KTFQPEEISSMVL
Sbjct  68   TVFDAKRLIGRKFNDPMIQADIKHWPFKVIAGAGDKPQIVVEFKGERKTFQPEEISSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            IKM+EVAEA++G +V+NAVITVPAYFNDSQRQATKDAGAIAGL V+RIINEPTAAAIAYG
Sbjct  128  IKMKEVAEAYLGLDVQNAVITVPAYFNDSQRQATKDAGAIAGLTVMRIINEPTAAAIAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            LDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  188  LDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVDEF  247

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  308
            KRK+RKD+  NQRALRRLRTA ERAKRTLSSS QA++EIDSLFDGID+N+TITRARFED+
Sbjct  248  KRKYRKDMKTNQRALRRLRTASERAKRTLSSSTQAHLEIDSLFDGIDYNTTITRARFEDL  307

Query  309  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSINP  356
            C DYFRKTM PVE VLRDAKLSK+QV+EVVLVGGSTRIP            KE  KSINP
Sbjct  308  CSDYFRKTMGPVETVLRDAKLSKNQVNEVVLVGGSTRIPKVQQLLSDFFNGKELYKSINP  367

Query  357  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  416
            DEAVA+GATVQAAILSG   S+KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK
Sbjct  368  DEAVAFGATVQAAILSGTSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK  427

Query  417  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  476
            SQTFSTYADNQPGVLIQVFEGER MT+DNNLLGKF+LDG+PPMPRG+PQ+DVTFDIDANG
Sbjct  428  SQTFSTYADNQPGVLIQVFEGERVMTKDNNLLGKFSLDGLPPMPRGMPQVDVTFDIDANG  487

Query  477  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALEN  536
            ILNVSAVEKSTGKENKITITNDKGRLS+ +IDRMV++AEKYK+EDE N+ RIEAKN LEN
Sbjct  488  ILNVSAVEKSTGKENKITITNDKGRLSKDEIDRMVNDAEKYKAEDEKNRARIEAKNGLEN  547

Query  537  YAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVAN  596
            YAY+LRNTLND+K+K  +   DKK +EDKV +TI W+D N +AEK+E+E KQ+ELE VAN
Sbjct  548  YAYSLRNTLNDDKIKGAVDPADKKTLEDKVADTIAWMDRNLAAEKDEFEAKQQELESVAN  607

Query  597  PILQKMY  603
            PI+QK+Y
Sbjct  608  PIMQKLY  614

>PHYRA_71655
Length=653

 Score = 1008 bits (2606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/657 (79%), Positives = 572/657 (87%), Gaps = 16/657 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M +SV+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DI+HWPFK+  G  +KP++ VQFKGE  TFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL+KMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEP
Sbjct  121  EEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ F QEFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNSTI
Sbjct  241  VEFFVQEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPN---------  351
            TRARFED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPK            
Sbjct  301  TRARFEDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPKVQQLLIDFFNGK  360

Query  352  ---KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
               KSINPDEA+AYGATVQAAILSG+DSS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  KLFKSINPDEAIAYGATVQAAILSGHDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVP KK+Q+FSTYADNQ GVLIQVFEGERSMT DN+LLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPAKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFD+D NGILNVSAVEKSTGKENKI ITNDKGRLSQ++I+RMV +AEKYK +DE NK+RI
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            E+KNALENYA++LR++  DEK+  ++S++DKK IEDKV ET++WLDANQ+A KEE++ KQ
Sbjct  541  ESKNALENYAFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAKQ  600

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            +ELEGV NPI+QK+Y     A        GG   G            D GPKIEEVD
Sbjct  601  QELEGVTNPIMQKIY----TAASGAASGMGGAGTGGGAPSGAGGAGGDDGPKIEEVD  653

>PHALS_09802
Length=651

 Score = 1007 bits (2604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/615 (81%), Positives = 564/615 (92%), Gaps = 12/615 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M++ ++G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSEPITGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+D  VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFADSEVQSDIKHWPFKVVCGPENKPQVVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMRE+AEAFIGK+V+NAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE +VLIFDLGGGTFDVSLL+IEEGIFEV ATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHHVLIFDLGGGTFDVSLLTIEEGIFEVMATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V++F  EFKRKHRKD++ NQRALRRLRTACERAKRTLS+SAQAY+EIDSLFDGIDFNSTI
Sbjct  241  VEYFVAEFKRKHRKDLSVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+C +YFRKTM+PV +VLRD+KLSKSQV+E+VLVGGSTRIP            K
Sbjct  301  TRARFEDLCAEYFRKTMDPVAQVLRDSKLSKSQVNEIVLVGGSTRIPKVQQMLMDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            +  KSINPDEAVAYGATVQAAILSG++SS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  DLFKSINPDEAVAYGATVQAAILSGSESSAKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVP KK Q+FSTY DNQ GVLIQVFEGER+MTRDN+LLGKF+LDGIPPMPRGVPQIDV
Sbjct  421  NTTVPAKKMQSFSTYTDNQSGVLIQVFEGERTMTRDNHLLGKFSLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMV++A+KYK +DE NK+RI
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADADKYKDQDERNKLRI  540

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            E+KN+LEN+A++LR+++NDEK+  +IS +D+K I+ KV ET+ WL+ANQ+AEK E++ KQ
Sbjct  541  ESKNSLENFAFSLRSSINDEKVVAKISAEDRKLIDGKVAETLQWLEANQAAEKGEFDAKQ  600

Query  589  KELEGVANPILQKMY  603
            +ELEGVANPI+QKMY
Sbjct  601  QELEGVANPIMQKMY  615

>PHYCA_104444
Length=644

 Score = 1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/658 (77%), Positives = 561/658 (85%), Gaps = 27/658 (4%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M ++V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTEAVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFKL  G   KP + VQFKGE +TFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKLVRGPESKPLVEVQFKGEKRTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL+KMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEP
Sbjct  121  EEISSMVLVKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ F  EFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VEFFVLEFKRKYRKDMTGNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+C +YFRKTM PV +VL+D+KLSK+ V+EVVLVGGSTRIP            K
Sbjct  301  TRARFEDLCSEYFRKTMGPVAQVLQDSKLSKNHVNEVVLVGGSTRIPKVQQLLMEFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp-lslglETAGGVMTTLIA  407
            E  KSINPDEAVAYGATVQAAILSG+ +       LLL     LSLGLETAGGVMT LI 
Sbjct  361  ELFKSINPDEAVAYGATVQAAILSGSGNMSSKLQDLLLLDVAPLSLGLETAGGVMTKLIP  420

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNTTVP KK+Q+FSTY+DNQ GVLIQVFEGERS+T+DN+LLGKFNLDGIPPM RGVPQID
Sbjct  421  RNTTVPAKKTQSFSTYSDNQSGVLIQVFEGERSLTQDNHLLGKFNLDGIPPMQRGVPQID  480

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMV++AEKYK +DE NK+R
Sbjct  481  VTFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKLR  540

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IE+KNALENYA++LR+++ ++KL  ++S  DKK IEDKV ET+ WLDANQ+AEKEE++ K
Sbjct  541  IESKNALENYAFSLRSSMKEDKLATKLSAADKKTIEDKVAETLQWLDANQAAEKEEFDSK  600

Query  588  QKELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            Q+ELEGVANPI+QK+Y                            +G  D GPKIEEVD
Sbjct  601  QQELEGVANPIMQKVY--------------AAEVDKGTAPDGRGSGGDDNGPKIEEVD  644

>PHYKE_7016
Length=650

 Score = 998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/612 (82%), Positives = 558/612 (91%), Gaps = 13/612 (2%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  6    VTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NAHNTVFDAKRLIGRKFSD  VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQPEEIS
Sbjct  66   NAHNTVFDAKRLIGRKFSDLEVQSDIKHWPFKVVRGPDNKPQVVVQFKGESKTFQPEEIS  125

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVLIKMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  126  SMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGLDKK GE NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV++F
Sbjct  186  IAYGLDKKRGEHNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVEYF  245

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
              +FKRKHRKD++ + RA+RRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRAR
Sbjct  246  VTDFKRKHRKDMSTSSRAMRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNSTITRAR  305

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNK  352
            FE +C D+FRKTMEPV +VL DAKLSK  V EVVLVGGSTRIP            KE  K
Sbjct  306  FESLCDDFFRKTMEPVAQVLHDAKLSKGHVQEVVLVGGSTRIPKVQQLLTDFFHGKELFK  365

Query  353  SINPDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            SINPDEAVA+GATVQAAILSG  D+S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTT
Sbjct  366  SINPDEAVAFGATVQAAILSGAGDTSSKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTT  425

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            VP+KKSQTFSTY+DNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPM RG+PQIDVTFD
Sbjct  426  VPSKKSQTFSTYSDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMRRGIPQIDVTFD  485

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMV+EA+K+K +D  NK+RIE+K
Sbjct  486  IDANGILNVSAVEKSTGKENKITITNDKGRLSQDEIDRMVAEADKFKDQDARNKLRIESK  545

Query  532  NALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKEL  591
            N++ENYA++LR+++ +EKL  +++ +DK+ IEDKV E ++WL+ NQ+AEKEE++ KQKEL
Sbjct  546  NSVENYAFSLRSSIREEKLAVKLTAEDKQVIEDKVAEVLSWLEVNQAAEKEEFDAKQKEL  605

Query  592  EGVANPILQKMY  603
            E VANPI++K++
Sbjct  606  EDVANPIMEKIF  617

>H257_17322
Length=606

 Score = 998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/599 (86%), Positives = 538/599 (90%), Gaps = 31/599 (5%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            V G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKRLIGRKF+D ++QADIKHWPFK+T GAGDKPQITV+FKGE+KTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDSVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEIS  123

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAFIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  243

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
            T EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR
Sbjct  244  TAEFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  303

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNKSINPDEAVAYGA  364
            FEDMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPK                
Sbjct  304  FEDMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPK----------------  347

Query  365  TVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYA  424
              QAAILSGNDSSEKLQDLLLLDVTPL L LETAGGVM TLI RNTTVPTKKSQTFST A
Sbjct  348  PWQAAILSGNDSSEKLQDLLLLDVTPLLLTLETAGGVMATLIQRNTTVPTKKSQTFSTCA  407

Query  425  DNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVE  484
            +NQ GVLIQVF                 LDGIPPMPRGVP +DVTFDIDANGILNVSA+E
Sbjct  408  NNQSGVLIQVFRW---------------LDGIPPMPRGVPHVDVTFDIDANGILNVSAIE  452

Query  485  KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNT  544
            KSTGKENKITITNDKGRLS+ DI+RMV EAEKYKSEDEANK+RIEAKN LENYAYNLRNT
Sbjct  453  KSTGKENKITITNDKGRLSKDDIERMVQEAEKYKSEDEANKLRIEAKNGLENYAYNLRNT  512

Query  545  LNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANPILQKMY  603
            LNDEKL+ ++ E DKK ++DKVTETINWLDANQSAEKEEYE KQKELEGVANPI+QK+Y
Sbjct  513  LNDEKLQGKLDEADKKVVDDKVTETINWLDANQSAEKEEYEAKQKELEGVANPIMQKLY  571

>CCA14967
Length=1431

 Score = 990 bits (2560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/600 (83%), Positives = 541/600 (90%), Gaps = 18/600 (3%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M  S+      IDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  12   MTNSLEKKLPSIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  71

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGR+ SDP+VQADIKHWPFK+TS  GDKP ITVQ+KGE+K+F+P
Sbjct  72   QVAMNAINTVFDAKRLIGRRCSDPVVQADIKHWPFKVTSCEGDKPMITVQYKGETKSFRP  131

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMRE+A+A++G +VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  132  EEISSMVLIKMREIAQAYLGNDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  191

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLD+KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  192  TAAAIAYGLDRKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  251

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF  EF RKHRKDI  NQRALRRLRTACERAKRTLSSSAQA IEIDSLF+G+DFNSTI
Sbjct  252  VDHFVAEFNRKHRKDIATNQRALRRLRTACERAKRTLSSSAQAQIEIDSLFEGVDFNSTI  311

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+CGDYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIP            K
Sbjct  312  TRARFEDLCGDYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK  371

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            +  KSINPDEAVA+GATVQAAILSG + SEKLQDLLLLDV PLSLGLETAGGVMTTLI R
Sbjct  372  DLCKSINPDEAVAFGATVQAAILSGTEKSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPR  431

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTT+PTKKSQTFSTY +NQPGV IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V
Sbjct  432  NTTLPTKKSQTFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEV  491

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKST KENKITITNDKGRLSQADID MVSEAEKYK EDEAN++R+
Sbjct  492  TFDIDANGILNVSAVEKSTNKENKITITNDKGRLSQADIDLMVSEAEKYKKEDEANRIRV  551

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWL------DANQSAEKE  582
            EAKN LENY +NLR+TL+DEK+K+QIS +D+  IE+KV E ++WL      D NQ ++ E
Sbjct  552  EAKNGLENYTFNLRSTLDDEKIKNQISPEDRTTIENKVKEVVSWLLQCREEDTNQMSKDE  611

>PYAR_19807
Length=1613

 Score = 988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/614 (81%), Positives = 547/614 (89%), Gaps = 24/614 (4%)

Query  2    AQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61
            A  V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQ
Sbjct  4    ASVVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  63

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  121
            VAMNAHNTVFDAKRLIGRKF+D +VQADIKHWPF++ + + +KPQI VQFKGE+K F  E
Sbjct  64   VAMNAHNTVFDAKRLIGRKFTDAVVQADIKHWPFRVMADSANKPQIVVQFKGETKKFYAE  123

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            EISSMVL KMR+VAEAFIGK+VKNA            RQATKDAGAIAGLNVLRIINEPT
Sbjct  124  EISSMVLTKMRDVAEAFIGKQVKNA------------RQATKDAGAIAGLNVLRIINEPT  171

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAAIAYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  172  AAAIAYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLV  231

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
            ++F  EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++G+DFNSTIT
Sbjct  232  EYFVGEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGVDFNSTIT  291

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KE  349
            RARFED+C D+FRKTMEPVE+VLRDAKLSK+QV EVVLVGGSTRIP            KE
Sbjct  292  RARFEDLCADFFRKTMEPVERVLRDAKLSKNQVQEVVLVGGSTRIPKIQQLLSDFFNGKE  351

Query  350  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  409
              KSINPDEAVA+GATVQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLIARN
Sbjct  352  LYKSINPDEAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIARN  411

Query  410  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  469
            TTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LD +PPMPRGVPQIDVT
Sbjct  412  TTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDALPPMPRGVPQIDVT  471

Query  470  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIE  529
            FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMVSEAE YK +DE NK+R+E
Sbjct  472  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQQEIDRMVSEAETYKDQDERNKLRVE  531

Query  530  AKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQK  589
            AKN LENYA+ LRN+L D+K+  ++ ++DKK + D + E + WLD +Q+AEKEEY+ KQK
Sbjct  532  AKNGLENYAFTLRNSLQDDKVTAKLGDEDKKTLGDAIAEVVAWLDGHQAAEKEEYDAKQK  591

Query  590  ELEGVANPILQKMY  603
            ELE VA PILQKMY
Sbjct  592  ELENVATPILQKMY  605

>PYIR_15859
Length=626

 Score = 975 bits (2521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/611 (82%), Positives = 540/611 (88%), Gaps = 39/611 (6%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            V+G +VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  9    VTGQTVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  68

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEEIS
Sbjct  69   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQPEEIS  128

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVLIKM+E++EA+IGK+VKNAVITVPAYFNDSQRQATKDAG IAGLN            
Sbjct  129  SMVLIKMKEISEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVIAGLN------------  176

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
                    GGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV+ F
Sbjct  177  --------GGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEFF  228

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
            T EFKRK +KD+T+NQR+LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR
Sbjct  229  TAEFKRKFKKDMTQNQRSLRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  288

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FED+C DYFRKTMEPVE+VLRDAKLSK QV+E+VLVGGSTRIPK            +  K
Sbjct  289  FEDLCADYFRKTMEPVERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSDFFNGKDLYK  348

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
            SINPDEAVA+GATVQAAILSG D S +LQDLLLLDV PLSLGLETAGGVMTTLI      
Sbjct  349  SINPDEAVAFGATVQAAILSGADKSSRLQDLLLLDVAPLSLGLETAGGVMTTLIP-----  403

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
                  TFSTYADNQPGVLIQVFEGER+MTRDN+ LGKFNLDGIPPMPRGVPQIDVTFDI
Sbjct  404  --XXXXTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFNLDGIPPMPRGVPQIDVTFDI  461

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGILNVSAVEKSTGKENKITITNDKGRLSQ DIDRMV+EAEKYK  DE NK+R+EAKN
Sbjct  462  DANGILNVSAVEKSTGKENKITITNDKGRLSQEDIDRMVAEAEKYKDADERNKLRVEAKN  521

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            ALENYAY LRN+L +EK++ ++S DDKK ++DK+TETI WLDANQ+AEKEE++ KQKELE
Sbjct  522  ALENYAYGLRNSLQEEKIQAKLSADDKKRVDDKITETIAWLDANQAAEKEEFDAKQKELE  581

Query  593  GVANPILQKMY  603
            GVANPILQKMY
Sbjct  582  GVANPILQKMY  592

>CCI40247
Length=643

 Score = 959 bits (2480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/656 (72%), Positives = 546/656 (83%), Gaps = 29/656 (4%)

Query  3    QSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            ++VSG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AAKNQV
Sbjct  4    KAVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAKNQV  63

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  122
            AMNA NTVFDAKRLIGRKF D  VQ D KHWPF++  G  DKPQI V+ KG  K F  EE
Sbjct  64   AMNAENTVFDAKRLIGRKFHDQAVQQDTKHWPFRVVCGPEDKPQIVVEVKGAKKMFYAEE  123

Query  123  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  182
            IS+MVL KMRE+AEA++G++VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+NEPTA
Sbjct  124  ISAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNEPTA  183

Query  183  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  242
            AAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDNRLV+
Sbjct  184  AAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDNRLVE  243

Query  243  HFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  302
            HF  EFKRK+RKD+++NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNSTITR
Sbjct  244  HFLAEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNSTITR  303

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEP  350
            ARFED+C DYFRKTMEPVEKVLRDAKL+K+Q+HE+VLVGGSTRIP            KE 
Sbjct  304  ARFEDLCSDYFRKTMEPVEKVLRDAKLAKNQLHEIVLVGGSTRIPKVQQMLSDFFNGKEL  363

Query  351  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp-lslglETAGGVMTTLIARN  409
             KSINPDEAVAYGATVQAAILSG     +    ++L     LS+GLETAGGVMT LIARN
Sbjct  364  YKSINPDEAVAYGATVQAAILSGGSDQSERLQNVVLLDVAPLSMGLETAGGVMTVLIARN  423

Query  410  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  469
            TTVPT+KSQTFSTYADNQ GVLIQV+EGERSMTRDN+LLGKFNL+GIPPMPRGVPQI+VT
Sbjct  424  TTVPTRKSQTFSTYADNQSGVLIQVYEGERSMTRDNHLLGKFNLEGIPPMPRGVPQIEVT  483

Query  470  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIE  529
            F++DANGIL+V+AVEKSTGKENKITITNDKGRLS+ +IDRMV EA+ YK +DE NK+R+E
Sbjct  484  FEVDANGILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKLRVE  543

Query  530  AKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQK  589
            +KN LE+Y + +RNT+ D K+   +S++DKK +E K+ +TI+WLD + +AE++E+E KQK
Sbjct  544  SKNKLESYVFQVRNTIRDGKIAGNLSDEDKKQMESKIEDTISWLDQHSAAERDEFESKQK  603

Query  590  ELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            E+E + NP+LQK Y                         +    + + GPKIEEVD
Sbjct  604  EIESMVNPLLQKAY----------------GAAASATGESTAPSSKEGGPKIEEVD  643

>PPTG_19690
Length=566

 Score = 956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/561 (86%), Positives = 519/561 (93%), Gaps = 12/561 (2%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M + V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  GA +KPQ+ VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V++F QEFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAY+EIDSL DGIDFNSTI
Sbjct  241  VEYFVQEFKRKYRKDMTVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLLDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFED+C DYFRKTMEPV +VLRD+KLSK+QV E+VLVGGSTRIP            K
Sbjct  301  TRARFEDLCSDYFRKTMEPVAQVLRDSKLSKNQVDEIVLVGGSTRIPKVQQLLMGFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            +  KSINPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  DLFKSINPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVP KK+QTFSTY DNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPAKKTQTFSTYTDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDV  480

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMV++AEKYK +DE NK+RI
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKLRI  540

Query  529  EAKNALENYAYNLRNTLNDEK  549
            E+KNALENYA++LRN+  +EK
Sbjct  541  ESKNALENYAFSLRNSTREEK  561

>CCA16151
Length=643

 Score = 952 bits (2461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/655 (73%), Positives = 555/655 (85%), Gaps = 29/655 (4%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            +VSG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AAKNQVA
Sbjct  5    TVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAKNQVA  64

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  123
            MNA NTVFDAKRLIGRKF D  VQ D KHWPF +  G  DKPQI V+  G  K F  EEI
Sbjct  65   MNAENTVFDAKRLIGRKFHDQTVQQDTKHWPFSVVCGPEDKPQIVVEVNGAKKMFYAEEI  124

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            S+MVL KMRE+AEA++G++VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+NEPTAA
Sbjct  125  SAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNEPTAA  184

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDNRLV+H
Sbjct  185  AIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDNRLVEH  244

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            F  EFKRK+RKD+++NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNSTITRA
Sbjct  245  FLTEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNSTITRA  304

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPN  351
            RFED+C DYFRKTM+PVE+VLRDAKLSK+Q++E+VLVGGSTRIP            KE  
Sbjct  305  RFEDLCSDYFRKTMDPVERVLRDAKLSKNQLNEIVLVGGSTRIPKVQQLLSDFFNGKELY  364

Query  352  KSINPDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNT  410
            KSINPDEAVAYGATVQAAILSG +D SE+LQ+++LLDV PLS+GLETAGGVMT LI RNT
Sbjct  365  KSINPDEAVAYGATVQAAILSGASDQSERLQNVVLLDVAPLSMGLETAGGVMTVLIPRNT  424

Query  411  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  470
            TVPT+KSQTFSTYADNQPGVLIQV+EGER+MTRDN+LLGKFNL+ IPPMPRGVPQI+VTF
Sbjct  425  TVPTRKSQTFSTYADNQPGVLIQVYEGERTMTRDNHLLGKFNLEEIPPMPRGVPQIEVTF  484

Query  471  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEA  530
            ++DANGIL+V+AVEKSTGKENKITITNDKGRLS+ +IDRMV EA+ YK +DE NK+R+E 
Sbjct  485  EVDANGILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKLRVEC  544

Query  531  KNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKE  590
            KN LE+Y +++RNT+ D+K+ D++S+++KK +E K+ ETI+WLD N +AE++E+E KQK+
Sbjct  545  KNKLESYVFHVRNTIRDDKIADKLSDEEKKQVESKIEETISWLDQNTAAERDEFESKQKD  604

Query  591  LEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            +E + NP+LQK Y                         +      + GPKIEEVD
Sbjct  605  VEDMVNPLLQKAY----------------GAAASTAGESADPSGKEAGPKIEEVD  643

>HYAP_01540
Length=634

 Score = 942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/621 (81%), Positives = 519/621 (84%), Gaps = 62/621 (10%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ++S YSVGID+GT YS VGVWQND VEIIA DQGNRT+                   
Sbjct  1    MAQTMSDYSVGIDVGTMYSRVGVWQNDSVEIIAKDQGNRTSAV-----------------  43

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
             VAMNAHNTVFD KRLIGRKFSD +VQAD+KHWPFKLTSGAGDKPQITVQFKGESKTFQ 
Sbjct  44   -VAMNAHNTVFDGKRLIGRKFSDAVVQADVKHWPFKLTSGAGDKPQITVQFKGESKTFQS  102

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATK------DAGAIAGLNVL  174
            EEISSMVLIKMREVAEAF+GKEVK AVITVPAYFNDSQRQ  +      D+     L   
Sbjct  103  EEISSMVLIKMREVAEAFMGKEVKKAVITVPAYFNDSQRQRRRMQGPLLDSTCSVSLTSR  162

Query  175  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  234
            R+   PT              R          T+               ATAGDTHLGGE
Sbjct  163  RLRPSPTVWT-----------RRAASAMCSSSTW---------------ATAGDTHLGGE  196

Query  235  DFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  294
            DFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI
Sbjct  197  DFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  256

Query  295  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------  348
            DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK      
Sbjct  257  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  316

Query  349  ------EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  402
                  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM
Sbjct  317  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM  376

Query  403  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG  462
            TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG
Sbjct  377  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG  436

Query  463  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  522
            VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE
Sbjct  437  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  496

Query  523  ANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKE  582
            ANK+RIEAKNALENYAYNLRNTLNDEKLKDQI EDD+KAI+DKVTETINWLDANQSAEKE
Sbjct  497  ANKIRIEAKNALENYAYNLRNTLNDEKLKDQIPEDDRKAIDDKVTETINWLDANQSAEKE  556

Query  583  EYEGKQKELEGVANPILQKMY  603
            EYE KQKE+E VANPILQKMY
Sbjct  557  EYEAKQKEVESVANPILQKMY  577

>PYVX_22981
Length=612

 Score = 940 bits (2430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/656 (75%), Positives = 545/656 (83%), Gaps = 64/656 (10%)

Query  2    AQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61
            +  V+G SVGIDLGTTYSCVGVWQN+RVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  9    SSGVTGQSVGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  68

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  121
            VAMNA NTVFDAKRLIGRKF+DP+VQ DI+HWPFK+++G+  KPQITVQF+GE KTFQPE
Sbjct  69   VAMNAANTVFDAKRLIGRKFNDPVVQQDIRHWPFKVSAGSDSKPQITVQFQGERKTFQPE  128

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            EISSMVL+KMR+VAEAFIGK VKNAVITVPAYFNDSQRQATKDAG IAGLN         
Sbjct  129  EISSMVLMKMRDVAEAFIGKPVKNAVITVPAYFNDSQRQATKDAGVIAGLN---------  179

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
                                               EGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  180  -----------------------------------EGIFEVKATAGDTHLGGEDFDNRLV  204

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
            +HF  EFKRK+RKD++E+QRALRRLRTACERAKRTLSSSAQAY+EIDSL+DG+DFN+TIT
Sbjct  205  EHFAAEFKRKYRKDLSESQRALRRLRTACERAKRTLSSSAQAYVEIDSLYDGVDFNTTIT  264

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------E  349
            RARFE+MCGDYFRKTMEPVE VLRDAKL K QVHEVVLVGGSTRIPK            E
Sbjct  265  RARFEEMCGDYFRKTMEPVETVLRDAKLGKGQVHEVVLVGGSTRIPKVQQLLSQFFNGKE  324

Query  350  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  409
            P KSINPDEAVA+GATVQAAILSG+DSS KLQDLLLLDV PLSLGLETAGGVMTTLI RN
Sbjct  325  PCKSINPDEAVAFGATVQAAILSGHDSSAKLQDLLLLDVAPLSLGLETAGGVMTTLIPRN  384

Query  410  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  469
            TTVP KKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLD +PPMPRGVPQIDVT
Sbjct  385  TTVPAKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDALPPMPRGVPQIDVT  444

Query  470  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIE  529
            FDIDANGILNV+AVEKSTGKENKITITNDKGRLSQADIDRMV+EAEKYK +DE  K R++
Sbjct  445  FDIDANGILNVTAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKQQDEVQKQRVD  504

Query  530  AKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQK  589
            +KN+LENYAY LRN+LND+K+K+Q+S++D+KA++D+VT+TINWLD+NQ AEK+E++ KQK
Sbjct  505  SKNSLENYAYGLRNSLNDDKIKEQLSDNDRKAVDDQVTQTINWLDSNQMAEKDEFDAKQK  564

Query  590  ELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            EL  VANPILQKMY        A  G   G   G       P G+ ++GPKIEEVD
Sbjct  565  ELADVANPILQKMY--------ASAGGAPGKMPGADEMPTAPGGSDEKGPKIEEVD  612

>PYIR_15857
Length=577

 Score = 899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/657 (76%), Positives = 525/657 (80%), Gaps = 92/657 (14%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQAVAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++ GAGDKPQITV+FKGE+KTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREV+EAFIGKE    +  V A   D+                       
Sbjct  121  EEISSMVLIKMREVSEAFIGKE---GIFEVKATAGDTH----------------------  155

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
                                  LGG  FD  L+                H  GE      
Sbjct  156  ----------------------LGGEDFDNRLVD---------------HFVGE------  172

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
                   FKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTI
Sbjct  173  -------FKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTI  225

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIP            K
Sbjct  226  TRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  285

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EP K+INPDEAVA+GATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  286  EPCKAINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  345

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  346  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  405

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV+EAEKYK+EDE+NKVRI
Sbjct  406  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVRI  465

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EAKN LENYAYNLRNTL+DEKLK QISE+D+ AI DKVTETINWLDANQSAEKEE+E KQ
Sbjct  466  EAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAKQ  525

Query  589  KELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            KELEG+ANPILQKMY     A     G   G   G PGAGAPPA   DQGPKIEEVD
Sbjct  526  KELEGIANPILQKMY-----AAAGGAGGMPGGAPGAPGAGAPPAAGGDQGPKIEEVD  577

>PHALS_04330
Length=785

 Score = 833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/445 (97%), Positives = 432/445 (97%), Gaps = 12/445 (3%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPFK+TSGAGDKPQI VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPLVQADIKHWPFKVTSGAGDKPQIVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQ  433
            NTTVPTKKSQTFSTYADNQPGVLIQ
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQ  445

>PHYKE_6984
Length=450

 Score = 822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/450 (95%), Positives = 432/450 (96%), Gaps = 14/450 (3%)

Query  1    MAQSVS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58
            MAQ+ +  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60

Query  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  118
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFKL+SGAGDKPQITVQFKGESKTF
Sbjct  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120

Query  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240

Query  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP-----------  347
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP           
Sbjct  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360

Query  348  -KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  406
             KEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  361  GKEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  420

Query  407  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  436
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450

>PYIW_16873
Length=496

 Score = 815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/499 (88%), Positives = 454/499 (91%), Gaps = 15/499 (3%)

Query  159  RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  218
            RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG
Sbjct  1    RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  60

Query  219  IFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLS  278
            IFEVKATAGDTHLGGEDFDNRLVDHF  EFKRKHRKDIT NQRALRRLRTACERAKRTLS
Sbjct  61   IFEVKATAGDTHLGGEDFDNRLVDHFVGEFKRKHRKDITSNQRALRRLRTACERAKRTLS  120

Query  279  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  338
            SSAQAYIEIDSLFDG+DFNSTITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVV
Sbjct  121  SSAQAYIEIDSLFDGVDFNSTITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVV  180

Query  339  LVGGSTRIPK------------EPNKSINPDEAVAYGATVQAAILSGNdsseklqdllll  386
            LVGGSTRIPK            EP K+INPDEAVA+GATVQAAILSGND SEKLQDLLLL
Sbjct  181  LVGGSTRIPKVQQLLSDFFNGKEPCKAINPDEAVAFGATVQAAILSGNDQSEKLQDLLLL  240

Query  387  dvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN  446
            DVTPLSLGLETAGGVMTTLI+RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN
Sbjct  241  DVTPLSLGLETAGGVMTTLISRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN  300

Query  447  LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAD  506
            LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAD
Sbjct  301  LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAD  360

Query  507  IDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKV  566
            IDRMV+EAEKYK+EDE+NKVRIEAKN LENYAYNLRNTL+DEKLK QISE+D+ AI DKV
Sbjct  361  IDRMVAEAEKYKAEDESNKVRIEAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKV  420

Query  567  TETINWLDANQSAEKEEYEGKQKELEGVANPILQKMYaaaggapgaeggmpggmpggmpg  626
            TETINWLDANQSAEKEE+E KQKELEG+ANPILQKMY     A GA G   G   G    
Sbjct  421  TETINWLDANQSAEKEEFEAKQKELEGIANPILQKMY---AAAGGAGGMPGGAPGGMPGA  477

Query  627  agappagapDQGPKIEEVD  645
               PPA   DQGPKIEEVD
Sbjct  478  GAPPPAAGGDQGPKIEEVD  496

>PPTG_02120
Length=1001

 Score = 772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/483 (85%), Positives = 431/483 (89%), Gaps = 14/483 (3%)

Query  175   RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  234
             R +  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE
Sbjct  521   RGLYHPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  580

Query  235   DFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  294
             DFDNRLVDHFTQEFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+
Sbjct  581   DFDNRLVDHFTQEFKRKHRKDLTHNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGV  640

Query  295   DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------  348
             DFNSTITRARFED+C DYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPK      
Sbjct  641   DFNSTITRARFEDLCADYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLS  700

Query  349   ------EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  402
                   EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM
Sbjct  701   DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM  760

Query  403   TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG  462
             TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRG
Sbjct  761   TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRG  820

Query  463   VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  522
             VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDE
Sbjct  821   VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDE  880

Query  523   ANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKE  582
             ANKVRIEAKNALENYAY+LRN+LNDEK+K++I E DKK ++DKVTE I WLDANQSAEKE
Sbjct  881   ANKVRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDANQSAEKE  940

Query  583   EYEGKQKELEGVANPILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIE  642
             EYE KQKELE VANP+LQK+Y  A                   GA    + + DQGPKIE
Sbjct  941   EYESKQKELESVANPVLQKVY--ASAGGADGMAGGMAGGMPGAGAAPSSSSSTDQGPKIE  998

Query  643   EVD  645
             EVD
Sbjct  999   EVD  1001

>H310_09434
Length=658

 Score = 731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/617 (60%), Positives = 468/617 (76%), Gaps = 17/617 (3%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK  59
            MAQ   G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   MAQEPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
            NQ  +N  NT+FD KRLIGR ++D  VQAD K  PF + +  G +P I V+ KGE+K F 
Sbjct  83   NQATINPENTLFDVKRLIGRSYNDKSVQADKKLLPFHIVNKDG-RPFIEVKIKGEAKQFS  141

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
            PEE+S+M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAGL V RIINE
Sbjct  142  PEEVSAMILTKMKTIAENYLGKEVHDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINE  201

Query  180  PTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            PTAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD 
Sbjct  202  PTAAAIAYGIDKKAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFDQ  261

Query  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298
            R++  F ++++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF+ 
Sbjct  262  RIMQFFIKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDFDE  321

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK----------  348
            T+TRARFE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK          
Sbjct  322  TLTRARFEELNNDLFKKTLTPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFFN  381

Query  349  --EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  406
              EP++ INPDEAVAYGA VQ  IL G + S   + LLL          ET GGVMT +I
Sbjct  382  GKEPSRGINPDEAVAYGAAVQGGILGGENDSNLNEILLLDVAPLSLGI-ETVGGVMTKII  440

Query  407  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  466
             RNT VPTKKSQTFSTY DNQP V IQVFEGER+MT+DN++LGKF L GIPP PRGVPQI
Sbjct  441  NRNTVVPTKKSQTFSTYQDNQPAVSIQVFEGERAMTKDNHILGKFELTGIPPAPRGVPQI  500

Query  467  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKV  526
            +VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ +IDRMV EAE+   ED+  K 
Sbjct  501  EVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKD  560

Query  527  RIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEG  586
            RI+ +N+LE Y YNL+N + D KL D+I E DK  +   V E ++WLD NQ A+KE+++ 
Sbjct  561  RIDGRNSLEGYLYNLKNNVED-KLADKIEEADKDTLLKAVQEAMDWLDENQEADKEDFDA  619

Query  587  KQKELEGVANPILQKMY  603
            +QK +E +ANPI+ K+Y
Sbjct  620  QQKAIEKIANPIMAKVY  636

>PYU1_G004098
Length=656

 Score = 730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/611 (61%), Positives = 461/611 (75%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KGE K F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRGYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGEKKHFSPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            M+L KM++ AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL+V RIINEPTAAAI
Sbjct  147  MILTKMKQTAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRVMQFF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKSVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGETDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  445

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL V A +K TGK  KITIT +KGRLSQ +IDRMV EA +   ED+  K RI+ +N
Sbjct  506  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  565

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
             LE Y Y+L+NT+ D K+ D+I EDDK A+   V + ++WL+ NQ A+KE++EGKQKE+E
Sbjct  566  GLEGYLYSLKNTVED-KMADKIEEDDKDAVLKAVQDAMDWLEDNQEADKEDFEGKQKEVE  624

Query  593  GVANPILQKMY  603
             V NPI+ K+Y
Sbjct  625  KVVNPIMAKVY  635

>PHALS_00833
Length=652

 Score = 729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/611 (60%), Positives = 466/611 (76%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEII NDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIPNDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P++L +  G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVVIKGEKRQFAPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLSKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI+ ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNIDISSDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  445

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            ALE Y Y+L+N + +EKL+D++++DDK  + + V + ++WL+ NQ A+KE+YE KQKE+E
Sbjct  566  ALEGYLYSLKNNV-EEKLEDKLNDDDKDTVLNAVQDAMDWLEDNQEADKEDYEAKQKEVE  624

Query  593  GVANPILQKMY  603
             + NPI+ K+Y
Sbjct  625  KLVNPIMSKVY  635

>PYVX_16738
Length=658

 Score = 729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/616 (61%), Positives = 470/616 (76%), Gaps = 17/616 (3%)

Query  2    AQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  60
            A+   G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  23   AKGPRGPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  82

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            Q  +N   T+FD KRLIGRK++D  VQAD K  P+ +    G KP I V  KGE + F P
Sbjct  83   QATINPEKTLFDVKRLIGRKYADKSVQADKKLLPYHIADKQG-KPFIEVTVKGEKRQFAP  141

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+S+MVL KM+++AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEP
Sbjct  142  EEVSAMVLTKMKQIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEP  201

Query  181  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  202  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  261

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            ++ +F +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +
Sbjct  262  IMQYFIKKWKKDKSVDIGSDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTES  321

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------  348
            ++RARFE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPK           
Sbjct  322  LSRARFEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQTLIKDYFNG  381

Query  349  -EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
             EP++ +NPDEAVAYGA VQ  IL G    E  +D+LL+DV PLS G+ET GGVMT LI 
Sbjct  382  KEPSRGVNPDEAVAYGAAVQGGILGG-ADDELTKDVLLIDVVPLSQGIETVGGVMTKLIN  440

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+
Sbjct  441  RNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIE  500

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGIL V A +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K R
Sbjct  501  VTFEIDANGILQVGAEDKGTGKAESITITAEKGRLSQEEIDRMVQEAAEFADEDKLVKER  560

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            I+ +NALE Y Y+L+N + D KL D+I EDDK  +   V + ++WL+ NQ A KE+++ K
Sbjct  561  IDGRNALEGYLYSLKNNVED-KLADKIDEDDKDTVLTAVQDAMDWLEDNQEANKEDFDAK  619

Query  588  QKELEGVANPILQKMY  603
            QKE+E V NPI+ K+Y
Sbjct  620  QKEVEKVVNPIMAKVY  635

>PYIW_21755
Length=658

 Score = 728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/611 (60%), Positives = 458/611 (75%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGR ++D  VQAD K  P+ + +  G KP I V  KGE KTF PEE+S+
Sbjct  89   PEQTLFDVKRLIGRGYNDKSVQADKKLLPYNIINKDG-KPLIEVSVKGEKKTFSPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            M+L KM++VAE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  148  MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQFF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGEQDELTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  446

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL V A +K TGK  KITIT +KGRLSQ +IDRMV EA +   ED+  K RI+ +N
Sbjct  507  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  566

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
             LE Y Y+L+N++ D KL D+I EDDK  +   V + ++WL+ NQ A+KE++E KQKE+E
Sbjct  567  GLEGYLYSLKNSVED-KLADKIEEDDKDTVLKSVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  593  GVANPILQKMY  603
               NPI+ K+Y
Sbjct  626  KAVNPIMAKVY  636

>PYAR_18354
Length=1084

 Score = 728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/611 (60%), Positives = 461/611 (75%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  30   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  89

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGR ++D  VQAD K  PF + +  G KP I V  KGE K F PEEIS+
Sbjct  90   PEKTLFDVKRLIGRPYNDKSVQADKKLLPFDIVNKDG-KPFIQVTIKGEKKQFSPEEISA  148

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM+ +AEA+IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  149  MVLSKMKTIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  208

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LLSI+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  209  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLSIDAGVFEVLATNGDTHLGGEDFDQRVMQYF  268

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++RAR
Sbjct  269  IKKWKKDKNIDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALSRAR  328

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPK            EP++
Sbjct  329  FEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  388

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVA+GA VQ  IL G         LL+          ET GGVMT LI RNT +
Sbjct  389  GVNPDEAVAFGAAVQGGILGGEQDDTNKDILLIDVAPLSLGI-ETVGGVMTKLINRNTVI  447

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGERSMT+DN +LGKF L G+PP PRGVPQI+V+F++
Sbjct  448  PTKKSQTFSTYQDNQPAVLIQVFEGERSMTKDNRMLGKFELTGLPPAPRGVPQIEVSFEL  507

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL V A +K TGK  KITIT DKGRLSQ +++RMV EAE++  ED+  K RI+ +N
Sbjct  508  DANGILQVGAEDKGTGKAEKITITADKGRLSQEEVERMVKEAEEFADEDKKIKDRIDGRN  567

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            ALE Y Y+L+N++ D KL D+I EDDK+++   V + ++WL+ NQ ++K+++E KQKE+E
Sbjct  568  ALEGYLYSLKNSVED-KLADKIEEDDKESVLKAVQDAMDWLEDNQESDKDDFEAKQKEVE  626

Query  593  GVANPILQKMY  603
             + NPI+ K+Y
Sbjct  627  KIVNPIMSKVY  637

>PYAP_13341
Length=657

 Score = 728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/614 (60%), Positives = 464/614 (76%), Gaps = 17/614 (3%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV  62
            S  G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ 
Sbjct  26   SPRGPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQA  85

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  122
             +N   T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KGE+K F PEE
Sbjct  86   TINPEKTLFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPFIQVTIKGENKLFAPEE  144

Query  123  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  182
            +S+MVL KM+++AEA+IG+EV +AV+TVPAYFND+QRQATKDAG I+G+ V RIINEPTA
Sbjct  145  VSAMVLTKMKQIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTISGMTVQRIINEPTA  204

Query  183  AAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++
Sbjct  205  AAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIM  264

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
             +F +++K+    DI +++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++
Sbjct  265  QYFIKKWKKDKSIDIGKDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALS  324

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------E  349
            RARFE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPK            E
Sbjct  325  RARFEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKE  384

Query  350  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  409
            P++ +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RN
Sbjct  385  PSRGVNPDEAVAYGAAVQGGILGGEQDDVTKDILLIDVVPLSLGI-ETVGGVMTKLINRN  443

Query  410  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  469
            T +PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+V+
Sbjct  444  TVIPTKKSQTFSTYQDNQPAVLIQVFEGERTMTKDNRLLGKFELTGLPPAPRGVPQIEVS  503

Query  470  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIE  529
            F++DANGIL V A +K TGK  KITIT +KGRLSQ +I+RMV EAE++  ED+  K RI+
Sbjct  504  FELDANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIERMVKEAEEFADEDKKVKDRID  563

Query  530  AKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQK  589
             +N LE Y Y+L+N + D KL D+I EDDK+ +   V + ++WL+ NQ ++KE++E KQK
Sbjct  564  GRNGLEGYLYSLKNNVED-KLADKIDEDDKETVLKAVQDAMDWLEDNQDSDKEDFEAKQK  622

Query  590  ELEGVANPILQKMY  603
            E+E V NPI+ K+Y
Sbjct  623  EVEKVVNPIMAKVY  636

>PHALS_01338
Length=383

 Score = 724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/378 (92%), Positives = 361/378 (96%), Gaps = 12/378 (3%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M Q+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMN+ NTVFDAKRLIGRK+SDP+V+ADIKHWPFK+T+G GDKPQITVQFKGE+KTFQP
Sbjct  61   QVAMNSSNTVFDAKRLIGRKYSDPVVKADIKHWPFKVTAGPGDKPQITVQFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEA+IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAYIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF QEFKRKHRKD+++NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFVQEFKRKHRKDLSQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  349  EPNKSINPDEAVAYGATV  366
            EPNKSINPDEAVAYGAT+
Sbjct  361  EPNKSINPDEAVAYGATI  378

>PHYSO_286376
Length=660

 Score = 719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/611 (60%), Positives = 466/611 (76%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P++L +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVEVKGEKRQFAPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKSQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  ILSG         LL+  V       ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILSGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  446

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  566

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            ALE Y Y+L+N + +EKL+D+I EDDK  +   V + ++WL+ NQ A+KE++E KQKE+E
Sbjct  567  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  593  GVANPILQKMY  603
             + NPI+ K+Y
Sbjct  626  KLVNPIMSKVY  636

>PYU1_G004097
Length=663

 Score = 717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/608 (59%), Positives = 465/608 (76%), Gaps = 17/608 (3%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNAHN  68
            +GIDLGTTYSCVGV+++ +V+IIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N   
Sbjct  36   IGIDLGTTYSCVGVFKDGKVDIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATINPEK  95

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T+FD KRLIGR ++D  VQAD K  P+++ +  G KP I V  KG++K F PEEIS+MVL
Sbjct  96   TIFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGQTKLFSPEEISAMVL  154

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+++AEA++G++V++AV+TVPAYFND+QRQATKDAG IAGL+V RIINEPTAAAIAYG
Sbjct  155  GKMKQIAEAYLGRDVRDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAIAYG  214

Query  189  LDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F ++
Sbjct  215  IDKKAQGEKNVLVFDLGGGTFDVTLLAIDNGVFEVLATNGDTHLGGEDFDQRVMQFFIKK  274

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            +K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF+ T+TRARFE 
Sbjct  275  WKQDKGVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLNGEDFSETLTRARFEK  334

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNKSIN  355
            +  D F+KT+ PVEKVL+DA L KSQV E+VLVGGSTRIPK            EP++ +N
Sbjct  335  LNEDLFKKTLGPVEKVLKDAGLKKSQVDEIVLVGGSTRIPKVQQMIKDYFNGKEPSRGVN  394

Query  356  PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  415
            PDEAVAYGA +Q  IL G+   +    +L+  V       ET GGVMT LI RNT +PTK
Sbjct  395  PDEAVAYGAAIQGGILGGDQDEKLQDLVLIDVVPLSQGI-ETVGGVMTKLINRNTAIPTK  453

Query  416  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  475
            KSQ FST+ DNQ  V I+VFEGER++ + N LLGKF+L G+PP PRGVPQI+VTF+IDAN
Sbjct  454  KSQVFSTHVDNQAAVSIKVFEGERTLVKHNRLLGKFDLAGLPPAPRGVPQIEVTFEIDAN  513

Query  476  GILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALE  535
            GIL VSA +K TGK  KITIT +KGRLSQ +I+RMV +A ++  ED+  K RIE+KN+LE
Sbjct  514  GILQVSAQDKGTGKTEKITITAEKGRLSQEEIERMVQDAAEHAEEDKKVKERIESKNSLE  573

Query  536  NYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVA  595
             Y Y+ +NT+ D KL D+I EDDK  +   V + ++WLD N+ A+KE++EGKQK++E V 
Sbjct  574  TYLYSAKNTVED-KLSDKIEEDDKGIVLQAVKDAMDWLDDNEDADKEDFEGKQKDVEKVV  632

Query  596  NPILQKMY  603
            NPI+ K+Y
Sbjct  633  NPIMAKVY  640

>PPTG_08245
Length=658

 Score = 717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/611 (60%), Positives = 464/611 (76%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P+ L +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYNLVNKDG-KPFIEVEVKGEKRQFAPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  446

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  566

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            ALE Y Y+L+N + +EKL+D+I EDDK  +   V + ++WL+ NQ A+KE++E KQKE+E
Sbjct  567  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  593  GVANPILQKMY  603
             + NPI+ K+Y
Sbjct  626  KLVNPIMSKVY  636

>PHYCA_510696
Length=659

 Score = 716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/611 (60%), Positives = 465/611 (76%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYEIVNKEG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  445

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            ALE Y Y+L+N + +EKL+D+I EDDK  +   V + ++WL+ NQ A+KE++E KQKE+E
Sbjct  566  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  624

Query  593  GVANPILQKMY  603
             + NPI+ K+Y
Sbjct  625  KLVNPIMSKVY  635

>HYAP_01005
Length=660

 Score = 716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/611 (60%), Positives = 462/611 (76%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQ+D K  P++L +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM+ +AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +++RAR
Sbjct  268  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  328  FEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  446

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRN  566

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            +LE Y YNL+N + + KL D+I EDDK  +   V + ++WL+ NQ  +KE+YE KQKE+E
Sbjct  567  SLEGYLYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVE  625

Query  593  GVANPILQKMY  603
             V NPI+ K+Y
Sbjct  626  KVVNPIMSKVY  636

>HYAP_01004
Length=660

 Score = 716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/611 (60%), Positives = 462/611 (76%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQ+D K  P++L +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM+ +AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +++RAR
Sbjct  268  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  328  FEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  446

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRN  566

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            +LE Y YNL+N + + KL D+I EDDK  +   V + ++WL+ NQ  +KE+YE KQKE+E
Sbjct  567  SLEGYLYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVE  625

Query  593  GVANPILQKMY  603
             V NPI+ K+Y
Sbjct  626  KVVNPIMSKVY  636

>PHYRA_71042
Length=654

 Score = 714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/616 (59%), Positives = 467/616 (76%), Gaps = 17/616 (3%)

Query  2    AQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  60
            A+   G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  20   AEEARGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  79

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            Q  +N   T+FD KRLIGRK++D  VQ+D K  P+++ +  G KP I V+ KGE + F P
Sbjct  80   QATINPEKTLFDVKRLIGRKYNDKSVQSDKKLLPYEIINKDG-KPFIQVEVKGEKREFAP  138

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+S+MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEP
Sbjct  139  EEVSAMVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEP  198

Query  181  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  199  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  258

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            ++ +F +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +
Sbjct  259  IMQYFIKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTES  318

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------  348
            ++RARFE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPK           
Sbjct  319  LSRARFEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNG  378

Query  349  -EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
             EP++ +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI 
Sbjct  379  KEPSRGVNPDEAVAYGAAVQGGILGGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLIN  437

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+
Sbjct  438  RNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIE  497

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K R
Sbjct  498  VTFEIDANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDR  557

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            I+ +NALE Y Y+L+N + +EKL+D+I EDDK  +   V + ++WL+ NQ A+KE++E K
Sbjct  558  IDGRNALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEEK  616

Query  588  QKELEGVANPILQKMY  603
            QKE+E + NPI+ K+Y
Sbjct  617  QKEVEKLVNPIMSKVY  632

>PHYKE_7992
Length=657

 Score = 711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/611 (60%), Positives = 463/611 (76%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P+ L +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYTDKSVQADKKLLPYDLINKDG-KPFIQVEVKGEKRQFAPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  327  FEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  445

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQDEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            ALE Y Y+L+N +  EKL+D++ EDDK  I   V + ++WL+ NQ A+KE+YE KQKE+E
Sbjct  566  ALEGYLYSLKNNVE-EKLEDKLDEDDKDTITTAVQDAMDWLEDNQEADKEDYEEKQKEVE  624

Query  593  GVANPILQKMY  603
             + NPI+ KMY
Sbjct  625  KLVNPIMSKMY  635

>PITG_00527
Length=656

 Score = 707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/611 (60%), Positives = 465/611 (76%), Gaps = 17/611 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P++L +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+  + D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKKIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  445

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL VSA +K TGK   ITIT +KGRLSQ +IDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKRVKDRIDGRN  565

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
             LE Y Y+L+N + +EKL+D+I EDDK  +   V + ++WL+ NQ A+KE++E KQKE+E
Sbjct  566  GLEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  624

Query  593  GVANPILQKMY  603
             + NPI+ K+Y
Sbjct  625  KLVNPIMSKVY  635

>CCI50234
Length=665

 Score = 705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/613 (59%), Positives = 455/613 (74%), Gaps = 17/613 (3%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA  63
            ++G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  RLIGDAAKNQ  
Sbjct  33   MTGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDATGTRLIGDAAKNQAV  92

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  123
             N   T+FD KRLIGRKF+D  VQAD K  P+++ +  G KP I V  KGE K F PEEI
Sbjct  93   HNPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTVKGEQKVFAPEEI  151

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            S+MVL KM+++AE  IG  VK+AV+TVPAYFND+QRQATKDAG+IAGL V RIINEPTAA
Sbjct  152  SAMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEPTAA  211

Query  184  AIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  242
            AIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ 
Sbjct  212  AIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRVMQ  271

Query  243  HFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  302
             F +++ ++   +I +++RA++++R   ER KR LS++ QA IE++SL DGIDF+  ++R
Sbjct  272  FFIKKWNKEKTIEIEKDKRAVQKIRREAERVKRALSTNTQARIEVESLIDGIDFSDNLSR  331

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EP  350
            A FE +  D FRKT+ PV+KVL+DA L KS+V EVVLVGGSTRIPK            E 
Sbjct  332  ALFEKLNNDLFRKTLAPVDKVLKDAGLKKSEVDEVVLVGGSTRIPKVQELLKAYFNGKEL  391

Query  351  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  410
            N+ +NPDEAVAYGA VQ  IL G         LL+  +       ET GGVMT +I RNT
Sbjct  392  NRGVNPDEAVAYGAAVQGGILGGEQDDLNKDLLLIDVIPLSQGI-ETVGGVMTKIINRNT  450

Query  411  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  470
             +PTKKSQ FST +DNQ  V I V EGER+M +DN LLGKF L GIPP PRGVPQI+VTF
Sbjct  451  VIPTKKSQVFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQIEVTF  510

Query  471  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEA  530
            ++DANGIL VSA +K TGK  KITIT +KGRLS+ +I RMV EAE++  ED+  K RI+ 
Sbjct  511  EVDANGILQVSAEDKGTGKAEKITITAEKGRLSEEEIQRMVQEAEEFADEDKRIKERIDG  570

Query  531  KNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKE  590
            +NALE Y YNL++ ++D KL D+I EDDK+ + + V + ++WL+ NQ A+K ++E KQKE
Sbjct  571  RNALEGYLYNLKSQVDD-KLADKIEEDDKETVSNAVQDALDWLEDNQEADKPDFEAKQKE  629

Query  591  LEGVANPILQKMY  603
            +E + NPI+ K+Y
Sbjct  630  VEKIVNPIMAKLY  642

>SDRG_03564
Length=658

 Score = 704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/618 (60%), Positives = 475/618 (77%), Gaps = 18/618 (3%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK  59
            +A+   G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   VAEEPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
            NQ  +N  NT+FD KRLIGR+++D  VQAD K  P+++ +  G +P I V  KGE+KTF 
Sbjct  83   NQATINPENTLFDVKRLIGRQYNDKSVQADKKLLPYEIVNKEG-RPYIQVIVKGETKTFS  141

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+S+M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAGL V RIINE
Sbjct  142  AEEVSAMILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINE  201

Query  180  PTAAAIAYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            PTAAAIAYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD
Sbjct  202  PTAAAIAYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFD  261

Query  238  NRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  297
             R++  F ++++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF+
Sbjct  262  QRVMQFFIKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDFD  321

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK---------  348
             T+TRARFE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK         
Sbjct  322  ETLTRARFEELNNDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFF  381

Query  349  ---EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL  405
               EP++ INPDEAVAYGA VQ  IL+G  + E  +D+LLLDV PLSLG+ET GGVMT +
Sbjct  382  NGKEPSRGINPDEAVAYGAAVQGGILAG-VNDESTKDILLLDVAPLSLGIETVGGVMTKI  440

Query  406  IARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ  465
            I RNT VPTKKSQTFSTY DNQP V IQV+EGER+MT+DN++LGKF L GIPP PRGVPQ
Sbjct  441  INRNTVVPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQ  500

Query  466  IDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK  525
            I+VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ +IDRMV EAE+   ED+  K
Sbjct  501  IEVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIK  560

Query  526  VRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYE  585
             RI+ +N+LE Y YNL+N + D+       +D    ++  V E ++WLD NQ A+KE+++
Sbjct  561  DRIDGRNSLEGYLYNLKNNVEDKLADKIDDDDKDTVLK-AVQEAMDWLDENQEADKEDFD  619

Query  586  GKQKELEGVANPILQKMY  603
             +QK +E V NPI+ K+Y
Sbjct  620  AQQKAVEKVVNPIMSKVY  637

>CCA24936
Length=661

 Score = 699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/616 (58%), Positives = 455/616 (74%), Gaps = 17/616 (3%)

Query  2    AQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKN  60
            A+ ++G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  R+IGDAAKN
Sbjct  26   AKPMTGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDVTGTRMIGDAAKN  85

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            Q   N   T+FD KRLIGRKF+D  VQAD K  P+++ +  G KP I V  K E K F P
Sbjct  86   QAIHNPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTIKDEQKVFAP  144

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEIS+MVL KM+++AE  IG  VK+AV+TVPAYFND+QRQATKDAG+IAGL V RIINEP
Sbjct  145  EEISAMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEP  204

Query  181  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  205  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  264

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            ++  F +++ ++ + +I +++RA+++LR   ER KR LS+  QA +E++SL DG DF+  
Sbjct  265  IMQFFIKKWNKEKKINIEQDKRAIQKLRRESERVKRALSTLPQARLEVESLIDGQDFSDV  324

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------  348
            ++RA FE +  D FRKT+ PVEKVL+DA L KS++ EVVLVGGSTRIPK           
Sbjct  325  LSRAMFEKLNNDLFRKTLAPVEKVLKDAGLKKSEIDEVVLVGGSTRIPKVQELLKAFFNG  384

Query  349  -EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
             E N+ +NPDEAVAYGA VQ  IL G         LL+  +       ET GGVMT +I 
Sbjct  385  KELNRGVNPDEAVAYGAAVQGGILGGEQDDLNKDLLLIDVIPLSQGI-ETVGGVMTKIIN  443

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +PTKK+Q FST +DNQ  V I V EGER+M +DN LLGKF L GIPP PRGVPQI+
Sbjct  444  RNTVIPTKKAQLFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQIE  503

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF++DANGIL VSA +K TGK  K+TIT +KGRLS+ +I RMV EAE++  ED+  K R
Sbjct  504  VTFEVDANGILQVSAEDKGTGKAEKVTITAEKGRLSEEEIQRMVQEAEEFADEDKRIKER  563

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            I+ +NALE Y YNL++ + DEKL ++I EDDK+ + + V + ++WL+ NQ A+K ++E K
Sbjct  564  IDGRNALEGYLYNLKSQV-DEKLAEKIEEDDKETVTNAVQDALDWLEDNQEADKADFEAK  622

Query  588  QKELEGVANPILQKMY  603
            QKE+E V NPI+ K+Y
Sbjct  623  QKEVEKVVNPIMAKLY  638

>H257_00007
Length=787

 Score = 666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/607 (58%), Positives = 451/607 (74%), Gaps = 28/607 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANAEGNRTTPSWVAFNETERLIGEAAKLQAAS  248

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+T G GDKP I V F+GE+K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITKGEGDKPLIEVSFRGEAKSFTPEEIS  308

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  185  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  428

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            D+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  429  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  488

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIP            K
Sbjct  489  TRAKFESLNDECFKRTEETVLKVLQDANMEPGQITELVLVGGSTRIPKVQNMLSGLFGGK  548

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NT +P KK++ ++T  D Q    + ++EGER+   DNN LG+F + GI    RG P+++V
Sbjct  608  NTAIPVKKTRIYTTEEDFQTTEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEV  667

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TF+IDANGIL+VS  +K TG +N+ TI+N++GRLSQ DIDRMV EAEKYK  D     RI
Sbjct  668  TFEIDANGILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRI  727

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EA+N LE + Y         +  +  ++  + A E+ + ET +WL+ +  A  +E E K+
Sbjct  728  EARNELEGFIY---------RYLEVATKKGEAAAENLLRETRDWLEDHTEATVKELEDKK  778

Query  589  KELEGVA  595
            + LE V 
Sbjct  779  RALERVC  785

>H310_14759
Length=787

 Score = 664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/607 (58%), Positives = 447/607 (74%), Gaps = 28/607 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  248

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK++ G GDKP I V F+GE K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKISKGEGDKPLIQVTFRGEDKSFTPEEIS  308

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE F+G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENFLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  185  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDSNMV  428

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            D    EFKRK+R  D T + R++RRLRTACE AKR LS++  A IE+D+LF+G+DF+ST+
Sbjct  429  DFLVTEFKRKNRNLDPTSSARSMRRLRTACESAKRMLSTTTSATIEVDALFEGVDFSSTM  488

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIP            K
Sbjct  489  TRAKFESLNEECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQTMLSNLFGGK  548

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NT +P KK++ ++T  D Q    + ++EGER+   DNN LG+F + GI    RG P+++V
Sbjct  608  NTAIPVKKTRIYTTEEDFQTSEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEV  667

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TF+IDANGIL+VS  +K TG +N+ TI+N++GRLSQ DIDRMV EAEKYK  D     RI
Sbjct  668  TFEIDANGILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRI  727

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EA+N LE + Y         +  +  S+  +   E+ + +  +WLD +  A  +E E K+
Sbjct  728  EARNDLEGFIY---------RYLEVASKKGEAQAENALRDARDWLDEHAEATVKELEDKK  778

Query  589  KELEGVA  595
            + LE V 
Sbjct  779  RALERVC  785

>SDRG_05777
Length=786

 Score = 662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/605 (58%), Positives = 445/605 (74%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD    EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  428  VDFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSST  487

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIP            
Sbjct  488  MTRAKFESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGG  547

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIK  606

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P KK++ ++T +D Q  V + ++EGER+    NN LG+F + G+    RG PQ++
Sbjct  607  RNTAIPIKKTRVYTTESDYQTQVNVVIYEGERACVDHNNKLGEFTISGLERAKRGEPQVE  666

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K T  + + TI+N+ GRLSQADIDRMV EAEK+K ED     +
Sbjct  667  VTFEIDANGILNVSARDKKTNAKAETTISNNHGRLSQADIDRMVEEAEKFKKEDAEALKK  726

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N+LE++ Y         +  +   E    A E+ + E   WL+ ++ A   E E K
Sbjct  727  IEARNSLESFIY---------RALELTREKGDAAAENTIREAREWLEDHEDATLRELEEK  777

Query  588  QKELE  592
            ++ LE
Sbjct  778  KRVLE  782

>CCA20828
Length=787

 Score = 661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/605 (58%), Positives = 441/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTDTERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDTERLIGEAAKIQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKR+IGR F+D  VQ D +H+PFK+ SG GDKP I V++K E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEYKKETKQFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            +MVL +M+E AEA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  308  AMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGEDFDN +
Sbjct  368  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGEDFDNNM  427

Query  241  VDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD+  QEFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+GIDF+ T
Sbjct  428  VDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEGIDFSLT  487

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIP            
Sbjct  488  VTRAKFESLNEELFKRCEETVLKVLADAAMKPGDISEIVLVGGSTRIPKVQNLLSGVFNG  547

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  606

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ 
Sbjct  607  RNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISGIERARRGEPQVK  666

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVS+AEK+K +D     R
Sbjct  667  VTFEIDANGILNVSATDKKTGAKAETTISNNRGRLSQEDIDRMVSDAEKFKKDDAEMLAR  726

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N+LE + Y   N  N         E  +   E+ + +   WLD ++ A   E E K
Sbjct  727  IEARNSLEQFIYRALNNGN---------EKCEAGAENALRDAREWLDDHEEATLRELEDK  777

Query  588  QKELE  592
            ++ LE
Sbjct  778  KRTLE  782

>SPRG_10519
Length=782

 Score = 661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/605 (58%), Positives = 442/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  183  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  242

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G GDKP I V FKGE K F PEEIS
Sbjct  243  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGEGDKPLIQVTFKGEEKNFSPEEIS  302

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  303  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  362

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  363  LAYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  422

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  423  VDYLITEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSST  482

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++T E V KVL DA +    + E+VLVGGSTRIP            
Sbjct  483  MTRAKFESLNEECFKRTEETVLKVLADANMQPGDITELVLVGGSTRIPKVQNMLSAVFGG  542

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI 
Sbjct  543  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIK  601

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P KK++ ++T  D Q    + +FEGER+   DNN LG+F + GI    RG PQI+
Sbjct  602  RNTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISGIERAKRGEPQIE  661

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGIL+VSA +K TG +N  TI+N++GRL+Q DIDRMV EAEK+K +D     R
Sbjct  662  VTFEIDANGILHVSARDKKTGAKNATTISNNRGRLTQQDIDRMVEEAEKFKKDDAQMLKR  721

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            I+A+N LE Y Y         +  +  S+ +  A +  + E  +W+D N+     E E K
Sbjct  722  IDARNDLEGYLY---------RALEAASKKNDAAAQTALREARDWMDDNEELTVRELEDK  772

Query  588  QKELE  592
            ++ LE
Sbjct  773  RRVLE  777

>H257_18885
Length=786

 Score = 660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/604 (59%), Positives = 450/604 (75%), Gaps = 28/604 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+T+G  DKP I V FKGE+K+F PEEIS
Sbjct  248  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITAGDDDKPLIEVTFKGEAKSFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  368  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  427

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            D+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  428  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  487

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIP            K
Sbjct  488  TRAKFESLNDECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQNMLSGLFGGK  547

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI R
Sbjct  548  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKR  606

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NT +P KK++ ++T AD Q  V + ++EGER+    NN LG+F + GI    RG PQ++V
Sbjct  607  NTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKRGEPQVEV  666

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TF+IDANGILNVSA +K T  + + TI+++ GRLSQ DIDRMV++AEKYK +D     +I
Sbjct  667  TFEIDANGILNVSAKDKKTHAKAETTISSNGGRLSQEDIDRMVADAEKYKKDDAEVLRKI  726

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            EA+N LE + Y          L+    + D +A E+ + E   WL+ ++ A   E E K+
Sbjct  727  EARNNLEGFIY--------RALEIAREKGDSQA-ENTIREAREWLEDHEEATLRELEDKK  777

Query  589  KELE  592
            + LE
Sbjct  778  RLLE  781

>CCI46091
Length=787

 Score = 660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/605 (58%), Positives = 440/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTD+ERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDSERLIGEAAKIQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKR+IGR F+D  VQ D +H+PFK+ SG GDKP I V+FK E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEFKKETKQFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            +MVL +M+E AEA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  308  AMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGEDFDN +
Sbjct  368  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGEDFDNNM  427

Query  241  VDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD+  QEFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+GIDF+ T
Sbjct  428  VDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEGIDFSLT  487

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DA +   ++ E+VLVGGSTRIP            
Sbjct  488  VTRAKFESLNEELFKRCEETVLKVLADAAMKPDEISEIVLVGGSTRIPKVQNLLSAVFGG  547

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  606

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ 
Sbjct  607  RNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISGIERARRGEPQVK  666

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMVS+AEK+K +D     R
Sbjct  667  VTFEIDANGILNVSATDKKTGAKAETTISNNRGRLSQEDIDRMVSDAEKFKKDDAEMLSR  726

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y   N          + E    A  + + +   WLD ++ A   E E K
Sbjct  727  IEARNGLEQFIYRAINI---------VQEKGDAATGNALRDAREWLDDHEDATLRELEEK  777

Query  588  QKELE  592
            ++ LE
Sbjct  778  KRMLE  782

>HYAP_12660
Length=786

 Score = 659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/605 (58%), Positives = 444/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D KH+PFK+  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFKIKEGDDDKVLIEVEFKGEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKVCNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLAEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIP            
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPENVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG + + TI+N++GRL+Q DIDRMV+EA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLTQEDIDRMVAEADKFKKDDAEMLRR  725

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y         +  +Q  E     +E  + +  +WL+ ++ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEQAREKGDTTVESAIRDARDWLEDHEEATLRELEDK  776

Query  588  QKELE  592
            ++ LE
Sbjct  777  KRMLE  781

>PITG_11913
Length=786

 Score = 653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/605 (58%), Positives = 443/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDEDKVLIEVEFKGEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLSEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIP            
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y    T  +        + D  A E  + +  +WL+ ++ A   E E K
Sbjct  726  IEARNDLEQFIYRAIETARE--------KGDTNA-ESAIRDARDWLEDHEEATLRELEDK  776

Query  588  QKELE  592
            ++ LE
Sbjct  777  KRMLE  781

>PPTG_03121
Length=786

 Score = 653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/605 (57%), Positives = 443/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D  H+PFK+  G  DK  I V+FKGE+K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFKIKEGDDDKVLIEVEFKGENKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIP            
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y         +  +   E     +E  + +  +WL+ ++ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNVESAIRDARDWLEDHEEATLRELEDK  776

Query  588  QKELE  592
            ++ LE
Sbjct  777  KRMLE  781

>PYVX_18121
Length=633

 Score = 652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/605 (57%), Positives = 440/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D  H+PFK+  G  +K  I V+FKGE+K F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFSDEVVKKDATHFPFKIVEGDDNKVLIEVEFKGEAKRFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  154  SMVLLRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  274  VEHLLTEFKRKNRSLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DA +    V E+VLVGGSTRIP            
Sbjct  334  VTRAKFESLNEELFKRCEETVLKVLSDANMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  393

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDSNNKLGEFNISGIERAKRGEPQVE  512

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG   + TI+N++GRL+Q DIDRMV EAEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVQEAEKFKKDDAEMLRR  572

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y    T           E     +E+ + +  +WL+ ++ A   E E K
Sbjct  573  IEARNDLEQFIYRAIETAR---------EKGDANVENAIRDARDWLEDHEEATLRELEDK  623

Query  588  QKELE  592
            ++ LE
Sbjct  624  KRMLE  628

>PYIW_22144
Length=633

 Score = 651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/605 (57%), Positives = 445/605 (74%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRL TACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSSSPRAMRRLHTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL+DA +   ++ E+VLVGGSTRIP            
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLQDANMKPGEITELVLVGGSTRIPKVQTMLSGLFNG  393

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG   + TI+N+ GRLSQ+DIDRMV++AEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDDAELLRR  572

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+NALE Y Y         +  +   E     +E  + +  +WL+ ++ A   E E K
Sbjct  573  IEARNALEQYIY---------RAIELSREKGDANVETAIRDARDWLEDHEEATLRELEDK  623

Query  588  QKELE  592
            ++ LE
Sbjct  624  KRALE  628

>PYAP_22238
Length=633

 Score = 651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/605 (57%), Positives = 443/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKR+IGR FSD IV+ D  H+PFK+T G  +K  I V+FKGE+K+F PEEIS
Sbjct  94   NPSNTVFDAKRIIGRNFSDEIVKKDATHFPFKITEGDDNKVLIQVEFKGETKSFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G+     NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGQSGKGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD+   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VDYLLSEFKRKNRGLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSTT  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            ITRA+FE +  + F++  E V KVL DA +    + EVVLVGGSTRIP            
Sbjct  334  ITRAKFESLNEELFKRCEETVVKVLSDANMKPEDITEVVLVGGSTRIPKVQTMLSAQFGG  393

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDANNKLGEFNISGIERAKRGEPQVE  512

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG   + TI+N++GRL+Q DIDRMV+EAEKYK +D     +
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVAEAEKYKKDDAELLRK  572

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y         +  +   E  +   E+ + +  +WL+ ++ A   E E K
Sbjct  573  IEARNELEQFIY---------RAIEIAREKGETEAENAIRDARDWLEDHEDASLRELEDK  623

Query  588  QKELE  592
            ++ LE
Sbjct  624  KRMLE  628

>PYIR_24387
Length=633

 Score = 651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/605 (57%), Positives = 444/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIP            
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLSDANMKPEDITELVLVGGSTRIPKVQTMLSGLFNG  393

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG   + TI+N+ GRLSQ+DIDRMV++AEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDDAELLRR  572

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N+LE Y Y         +  +   E     +E  + +  +WL+ ++ A   E E K
Sbjct  573  IEARNSLEQYIY---------RAIEIAREKGDANVETAIRDARDWLEDHEEATLRELEDK  623

Query  588  QKELE  592
            ++ LE
Sbjct  624  KRVLE  628

>SPRG_00333
Length=615

 Score = 650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/618 (57%), Positives = 448/618 (72%), Gaps = 61/618 (10%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK  59
            +A+   G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   VAEEPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
            NQ  +N  NT+FD KRLIGR+++D  VQAD K  PF++ +  G +P I V+ KGE+KTF 
Sbjct  83   NQATINPENTLFDVKRLIGRQYNDKSVQADKKLLPFEIINKEG-RPYIQVKVKGETKTFS  141

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+S+M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAGL V RIINE
Sbjct  142  AEEVSAMILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINE  201

Query  180  PTAAAIAYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            PTAAAIAYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD
Sbjct  202  PTAAAIAYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFD  261

Query  238  NRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  297
             R++  F ++++++ + DI+ ++RAL++LR   E+  R                      
Sbjct  262  QRVMQFFIKKWQKQKKIDISSDKRALQKLRREAEQDAR----------------------  299

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP----------  347
                                 PVEKV++DA L KS+V E+VLVGGSTRIP          
Sbjct  300  ---------------------PVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFF  338

Query  348  --KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL  405
              KEP++ INPDEAVAYGA VQ  IL+G  + +  +D+LLLDV PLSLG+ET GGVMT +
Sbjct  339  NGKEPSRGINPDEAVAYGAAVQGGILAG-VNDDGTKDILLLDVAPLSLGIETVGGVMTKI  397

Query  406  IARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ  465
            I RNT VPTKKSQTFSTY DNQP V IQV+EGER+MT+DN++LGKF L GIPP PRGVPQ
Sbjct  398  INRNTVVPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQ  457

Query  466  IDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANK  525
            I+VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ +IDRMV EAE+   ED+  K
Sbjct  458  IEVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIK  517

Query  526  VRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYE  585
             RI+ +N+LE Y YNL+N + D KL D+I ++DK  +   V E ++WLD NQ A+KE+++
Sbjct  518  DRIDGRNSLEGYLYNLKNNVED-KLADKIDDEDKDTVLKAVQEAMDWLDENQEADKEDFD  576

Query  586  GKQKELEGVANPILQKMY  603
             +QK +E V NPI+ K+Y
Sbjct  577  AQQKAVEKVVNPIMSKVY  594

>PYU1_G001540
Length=633

 Score = 650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/605 (57%), Positives = 441/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NAHNTVFDAKR+IGR F+D IV+ D KH+PFK+  G  +K  I V+FKGE K F PEEIS
Sbjct  94   NAHNTVFDAKRIIGRNFNDEIVKKDAKHFPFKIVEGDDNKVLIEVEFKGEQKRFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGNNGQKTNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIP            
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLADANMKPEDITELVLVGGSTRIPKVQTMLSSLFNG  393

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG   + TI+ + GRLSQ DIDRMV+EAEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISQNAGRLSQDDIDRMVAEAEKFKKDDAELLRR  572

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y         +  D   E     +E  + +  +WL+ ++ A   E E K
Sbjct  573  IEARNDLEQFIY---------RAIDIAREKGDSNVETSIRDARDWLEEHEEATLRELEDK  623

Query  588  QKELE  592
            ++ LE
Sbjct  624  KRSLE  628

>PHYRA_78193
Length=786

 Score = 650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/605 (57%), Positives = 443/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FKG+ K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDDDKVLIEVEFKGDKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGTACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  + V KVL DAK+    V E+VLVGGSTRIP            
Sbjct  487  VTRAKFESLNEELFKRCEDTVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y    T  +        + D  A E  + +  +WL+ ++ A   E E K
Sbjct  726  IEARNDLEQFIYRAIETARE--------KGDTNA-ESAIRDARDWLEDHEEATLRELEDK  776

Query  588  QKELE  592
            ++ LE
Sbjct  777  KRMLE  781

>PHYKE_10815
Length=786

 Score = 649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/605 (57%), Positives = 441/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D KH+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEMVKKDAKHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+++  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQKIGQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  427  VEHLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIP            
Sbjct  487  VTRAKFESLNEELFKRCEETVTKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y         +  +   E      E  + +  +WL+ ++ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  588  QKELE  592
            ++ LE
Sbjct  777  KRMLE  781

>PYIW_26567
Length=564

 Score = 647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/537 (62%), Positives = 419/537 (78%), Gaps = 16/537 (3%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  30   GPIIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  89

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGR +SD  VQAD K  P+ + +  G KP I V  KGE K F PEEIS+
Sbjct  90   PEKTIFDVKRLIGRDYSDKSVQADKKLLPYHIVNKDG-KPMIEVLIKGEKKLFSPEEISA  148

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            M+L KM+++AE+++G+EV +A++TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  149  MILTKMKQIAESYLGREVHDAIVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  208

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DK+  GE++VL+FDLGGGTFDV+LL+IE G+FEV AT GDTHLGGEDFD R++  F
Sbjct  209  AYGIDKQSEGEKHVLVFDLGGGTFDVTLLAIEGGVFEVLATNGDTHLGGEDFDQRVMQFF  268

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI  ++RAL++LR   ER KR LS+  QA +EIDSL DG DF+ T++RAR
Sbjct  269  IKKWKKDRGIDIGSDKRALQKLRREAERVKRALSTQTQARLEIDSLLDGEDFSETLSRAR  328

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNK  352
            FE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIP            KEP++
Sbjct  329  FEKLNEDLFKKTLTPVEKVLKDAGIKKSEVDEIVLVGGSTRIPKVQQLIKDFFNGKEPSR  388

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G  + + L D++L+DV PLS G+ET GGVMT LI RNT +
Sbjct  389  GVNPDEAVAYGAAVQGGIL-GGMNQKDLGDIVLIDVVPLSQGIETVGGVMTKLINRNTAI  447

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            P KKSQ FST+ DNQP V I+V+EGER++ +DN+LLGKF+L GIPP PRG+PQI+VTF+I
Sbjct  448  PNKKSQVFSTHVDNQPAVSIKVYEGERTLVKDNHLLGKFDLTGIPPAPRGIPQIEVTFEI  507

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIE  529
            DANGIL VSA +K TGK  KITIT +KGRLSQA+IDR++ EAE++  ED+  K RI+
Sbjct  508  DANGILQVSAEDKGTGKAEKITITAEKGRLSQAEIDRIIEEAEQFAEEDKKVKERID  564

>PHALS_02079
Length=786

 Score = 647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/605 (57%), Positives = 442/605 (73%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NT+FDAKR+IGR FSD +V+ D  H+PF +  G  DK  I V FKGE K+F PEEIS
Sbjct  247  NATNTIFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVDFKGEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQNISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LSS+  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLSEFKRKNRNMDPSTSARAMRRLRTACESAKRMLSSTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIP            
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y        E  +++   + + AI D      +WL+ ++ A   E E K
Sbjct  726  IEARNDLEQFIYRA-----IEIAREKGDTNTESAIRD----ARDWLEDHEEATLRELEDK  776

Query  588  QKELE  592
            ++ LE
Sbjct  777  KRMLE  781

>PHYRA_41888
Length=586

 Score = 645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/348 (87%), Positives = 328/348 (94%), Gaps = 0/348 (0%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M +SV+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DI+HWPFK+  G  +KP++ VQFKGE  TFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL+KMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEP
Sbjct  121  EEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ F QEFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNSTI
Sbjct  241  VEFFVQEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  348
            TRARFED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPK
Sbjct  301  TRARFEDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPK  348

 Score = 315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 175/192 (91%), Gaps = 0/192 (0%)

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            VP KK+Q+FSTYADNQ GVLIQVFEGERSMT DN+LLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  364  VPAKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFD  423

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            +D NGILNVSAVEKSTGKENKI ITNDKGRLSQ++I+RMV +AEKYK +DE NK+RIE+K
Sbjct  424  VDVNGILNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLRIESK  483

Query  532  NALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKEL  591
            NALENYA++LR++  DEK+  ++S++DKK IEDKV ET++WLDANQ+A KEE++ KQ+EL
Sbjct  484  NALENYAFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAKQQEL  543

Query  592  EGVANPILQKMY  603
            EGV NPI+QK+Y
Sbjct  544  EGVTNPIMQKIY  555

>PHYCA_509820
Length=786

 Score = 643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/605 (57%), Positives = 438/605 (72%), Gaps = 29/605 (5%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D  H+PF +  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            IAYGLD   G      NVLIFDLGGGTFDVSLLSIEEGIF VK+T GDT+LG EDFDN +
Sbjct  367  IAYGLDTNAGTDGKACNVLIFDLGGGTFDVSLLSIEEGIFGVKSTGGDTYLGSEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIP            
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  528  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
            IEA+N LE + Y         +  +   E      E  + +  +WL+ ++ A   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  588  QKELE  592
            ++ LE
Sbjct  777  KRMLE  781

>SPRG_10477
Length=762

 Score = 624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/599 (57%), Positives = 427/599 (71%), Gaps = 40/599 (7%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A NA NT
Sbjct  184  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAASNATNT  243

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
            VFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEISSMVL 
Sbjct  244  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDDDKPLIQVSFKGEDKRFTPEEISSMVLT  303

Query  130  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  189
            +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  304  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  363

Query  190  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  245
            D   G    + N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLG +  D  L     
Sbjct  364  DTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGVQAQDKGL-----  418

Query  246  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
                     D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+TRA+F
Sbjct  419  ---------DPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSSTMTRAKF  469

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKS  353
            E +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIP            KE +KS
Sbjct  470  ESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGGKELSKS  529

Query  354  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  413
            INPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P
Sbjct  530  INPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIP  588

Query  414  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  473
             KK++ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ VTF+ID
Sbjct  589  VKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGIERAKRGEPQVQVTFEID  648

Query  474  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNA  533
            ANGILNVSA++K T  + + TI N+ GRL+Q DIDRMV++AEK+K +D     +IEA+N+
Sbjct  649  ANGILNVSALDKKTNAKAETTINNNNGRLTQEDIDRMVADAEKFKKDDAEVLKKIEARNS  708

Query  534  LENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
            LE++ Y         +  +   E    A E+ + E   WL+ ++ A   E E K++ LE
Sbjct  709  LESFIY---------RALELTREKGDAAAENTIREAREWLEDHEDATLRELEEKKRVLE  758

>PHYRA_47873
Length=396

 Score = 612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/399 (85%), Positives = 357/399 (89%), Gaps = 15/399 (4%)

Query  259  NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTME  318
            NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTME
Sbjct  1    NQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTME  60

Query  319  PVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNKSINPDEAVAYGATV  366
            PVEKVLRDAKLSKSQV+EVVLVGGSTRIPK            EPNKSINPDEAVAYGATV
Sbjct  61   PVEKVLRDAKLSKSQVNEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATV  120

Query  367  QAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADN  426
            QAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK+QTFSTYADN
Sbjct  121  QAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADN  180

Query  427  QPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  486
            QPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKS
Sbjct  181  QPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  240

Query  487  TGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLN  546
            TGKENKITITNDKGRLSQ+DIDRMV+EAEKYKSEDEANKVRIEAKNALENYAY+LRN+LN
Sbjct  241  TGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN  300

Query  547  DEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANPILQKMYaaa  606
            DEKLK+QI E DKK ++DKVTETI WLDA+QSAE EEYE KQKELEGVANPILQKMY   
Sbjct  301  DEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANPILQKMY---  357

Query  607  ggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
              A GA G   G   G      AP +G  DQGPKIEEVD
Sbjct  358  AAAGGAPGAEGGVPGGMPGAGAAPSSGGADQGPKIEEVD  396

>PYIR_16737
Length=511

 Score = 589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/491 (61%), Positives = 371/491 (76%), Gaps = 15/491 (3%)

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            M+L KM++VAE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  1    MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  60

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  61   AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQFF  120

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  121  IKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  180

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNK  352
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPK            EP++
Sbjct  181  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  240

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             +NPDEAVAYGA VQ  IL G         LL+  V       ET GGVMT LI RNT +
Sbjct  241  GVNPDEAVAYGAAVQGGILGGEQDDLTKDVLLIDVVPLSQGI-ETVGGVMTKLINRNTVI  299

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  300  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  359

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            DANGIL V A +K TGK  KITIT +KGRLSQ +IDRMV EA +   ED+  K RI+ +N
Sbjct  360  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  419

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
             LE Y Y+L+NT++D KL D+I EDDK ++   V + ++WL+ NQ A+KE++E KQKE+E
Sbjct  420  GLEGYLYSLKNTVDD-KLADKIEEDDKDSVLKAVQDAMDWLEDNQEADKEDFEAKQKEVE  478

Query  593  GVANPILQKMY  603
             + NPI+ K+Y
Sbjct  479  KIVNPIMAKVY  489

>H310_02604
Length=312

 Score = 577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/298 (92%), Positives = 289/298 (97%), Gaps = 0/298 (0%)

Query  5    VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            V G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKRLIGRKF+DP++QADIKHWPFK+T GAGDKPQITV+FKGE+KTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEIS  123

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVLIKM+EV+EA+IG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGG+DFDNRLVDHF
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGKDFDNRLVDHF  243

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  302
            T EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT+
Sbjct  244  TAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITQ  301

>PHYRA_47865
Length=381

 Score = 573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/380 (89%), Positives = 356/380 (94%), Gaps = 13/380 (3%)

Query  279  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  338
            SSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTMEPVEKVLRDAKLSKSQV+EVV
Sbjct  2    SSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTMEPVEKVLRDAKLSKSQVNEVV  61

Query  339  LVGGSTRIPK------------EPNKSINPDEAVAYGATVQAAILSGNdsseklqdllll  386
            LVGGSTRIPK            EPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLL
Sbjct  62   LVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLL  121

Query  387  dvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN  446
            DVTPLSLGLETAGGVMTTLIARNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+
Sbjct  122  DVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNH  181

Query  447  LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAD  506
            LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ+D
Sbjct  182  LLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSD  241

Query  507  IDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKV  566
            IDRMV+EAEKYKSED+ANKVRIEAKNALENYAY+LRN+LNDEKLK+QI E DKK ++DKV
Sbjct  242  IDRMVAEAEKYKSEDKANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKV  301

Query  567  TETINWLDANQSAEKEEYEGKQKELEGVANPILQKMYaaaggapgaeggmpggmpggmpg  626
            TETINWLDANQSAE EEYE KQKELEGVANPILQKMYAAAGGAPGAEGG+PGGMPGGMPG
Sbjct  302  TETINWLDANQSAETEEYESKQKELEGVANPILQKMYAAAGGAPGAEGGVPGGMPGGMPG  361

Query  627  agappag-apDQGPKIEEVD  645
            AGA P+    DQGPKIEEVD
Sbjct  362  AGAAPSSGGADQGPKIEEVD  381

>PHYRA_72238
Length=601

 Score = 551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/608 (50%), Positives = 407/608 (67%), Gaps = 42/608 (7%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  66
            G  VGIDLGTT++ VGVWQN+RVEI+ +  G+ +TPSYVAFT+T RLIG AAK Q+  NA
Sbjct  8    GPVVGIDLGTTFARVGVWQNNRVEIVPSCDGSYSTPSYVAFTETSRLIGHAAKYQLTRNA  67

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSM  126
             NTVF   +L+GRKFSDP VQ  +KHWPFK+  G  D P++ VQF+GE+KTFQP EI +M
Sbjct  68   RNTVFGMNQLVGRKFSDPEVQRSMKHWPFKVICGQNDNPEVEVQFRGETKTFQPVEILAM  127

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            +L ++RE+AE   GK VK  V+TVP+ FN SQR+A KDAG IAGLNVLR +N  TAA+IA
Sbjct  128  LLAELRELAEKHTGKTVKEVVLTVPSCFNHSQRRAMKDAGEIAGLNVLRFVNPATAASIA  187

Query  187  YGLDK--KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            YG DK    GE +VL+FDLGGG  DVS+++IE+GI+EVKA   D  LGG+  DNRLV+H 
Sbjct  188  YGFDKDWTDGEHDVLVFDLGGGMLDVSVVTIEQGIYEVKAAVTDARLGGQVLDNRLVEHC  247

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
              +F+R H K++  N RA+ RLR ACE+AKR LSSS + YIE+D+L DGID+ +TITRA 
Sbjct  248  VTDFERVHDKNLRVNLRAITRLRLACEQAKRALSSSTETYIELDALHDGIDYYATITRAE  307

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNK  352
             E++  D F K ++ V+KVLRDA+++K +V EVV+ GGS R P            K  + 
Sbjct  308  MENLSADLFDKALQLVQKVLRDARVAKDRVREVVVGGGSARSPKMLQLLKDFFSDKALSS  367

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             I PDE  A+G TVQAAIL+   +S  L D ++LDVTPLSL  E  G     +I R+TTV
Sbjct  368  PIRPDEGAAFGVTVQAAILNC-VASPTLYDFIMLDVTPLSLWAEVDGTNSLVVIYRHTTV  426

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            PTK++  FST  DNQ  + +++FEGE S    N LLG   +D IP  PRG  +I+VT DI
Sbjct  427  PTKRTVPFSTSEDNQAVMRVRIFEGEHSDMSANCLLGTIEVDNIPLKPRGESEIEVTLDI  486

Query  473  DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
            +A+ I+NVS  E STG E  ++I                         D   ++R+ +K 
Sbjct  487  NADDIVNVSVKEISTGLEKNLSI-----------------------GTDAREELRLGSKT  523

Query  533  ALENYAYNLRN--TLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKE  590
            ALE+YA  + +  T N  +LK  I+  D +AI+D  T+T++WL+ N SAEKE ++ K+++
Sbjct  524  ALESYANAVCSSATANIAELKRSIA--DMQAIKDSATDTLHWLNGNHSAEKEAFDVKRQK  581

Query  591  LEGVANPI  598
            LE VA P+
Sbjct  582  LEEVATPV  589

>PYAP_19738
Length=648

 Score = 517 bits (1332),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 295/575 (51%), Positives = 369/575 (64%), Gaps = 32/575 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  29   IGIDLGTTNSCVAVMEGKTPRVIENAEGARTTPSVVAILENDERLVGMPAKRQAVTNPDN  88

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  89   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVPGPNGK-DAWVEAKG--KKYSPSQIGSMVL  145

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A++F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  146  TKMKETADSFLGKSVSQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  205

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EF
Sbjct  206  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVAEF  264

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  265  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  322

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PK           +P+
Sbjct  323  ATFEKLVSGLVERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFFGKKPS  382

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  383  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTT  437

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+VTFD
Sbjct  438  IPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVTFD  497

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NVSA +KSTGKE  I I +  G LS ADI+RMV EAE     D+  K  IEAK
Sbjct  498  IDANGIVNVSARDKSTGKEQSIVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIEAK  556

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAIED  564
            N  ++ AY    TL  +++K+  + +E  K AI++
Sbjct  557  NEADSVAYTTEKTLKEHEDKVDGETAEQVKTAIQN  591

>PYU1_G003754
Length=650

 Score = 516 bits (1328),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 292/575 (51%), Positives = 369/575 (64%), Gaps = 32/575 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  30   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  89

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +K+ SG   K    V+ KG  K + P +I SMVL
Sbjct  90   TFYAVKRLIGRKFQDKETQEVSKVVSYKIVSGPNGK-DAWVEAKG--KKYSPSQIGSMVL  146

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  147  TKMKETADGFLGKSVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  206

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     EF
Sbjct  207  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGEF  265

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  266  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  323

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A+FE + G    +TM P +K ++DA L K  ++EV+LVGG +R+PK           +P+
Sbjct  324  AQFEKLVGHLIERTMTPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTSVEEFFGKKPS  383

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  384  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTT  438

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FD
Sbjct  439  IPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFD  498

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NV+A +K+TGKE  I I +  G LS ADI+RMV+EAE     D+  K  IEAK
Sbjct  499  IDANGIVNVAARDKATGKEQNIVIQSSGG-LSDADIERMVAEAEMNAEADQKRKELIEAK  557

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAIED  564
            N  ++ +Y    TL  +++KL  +  E  K  +E+
Sbjct  558  NEADSVSYTTEKTLKEHEDKLDKETVEQVKAGLEN  592

>PYVX_15051
Length=632

 Score = 514 bits (1325),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 291/573 (51%), Positives = 369/573 (64%), Gaps = 32/573 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKAPRVIENSEGARTTPSVVAILENDERLVGMPAKRQAVTNPQN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF+D   Q   K   +++ SG   K    V+ KG  K + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFTDKETQEVSKVVSYEIVSGPNGK-DAWVEAKG--KKYSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETAEGFLGKSITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EF
Sbjct  188  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVSEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A FE +  +   +T+ P +K ++DA L K  ++EV+LVGG +R+PK           +P+
Sbjct  305  ATFEKLVANLIDRTIGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQSVEDFFGKKPS  364

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  365  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTT  419

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V FD
Sbjct  420  IPTKKSQVFSTAADSQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAPRGVPQIEVAFD  479

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NVSA +K+T KE  I I +  G LS +DI+RMV EAE     D+  K  IE+K
Sbjct  480  IDANGIVNVSARDKATNKEQSIVIQSSGG-LSDSDIERMVQEAEMNAEADQKRKELIESK  538

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAI  562
            N  ++ AYN+  TL  +++KL D+  E  K A+
Sbjct  539  NEADSVAYNVEKTLKEHEDKLDDETKEQVKTAV  571

>PHYKE_9008
Length=650

 Score = 504 bits (1299),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 289/575 (50%), Positives = 371/575 (65%), Gaps = 32/575 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  28   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAIIDNDERLVGMPAKRQAVTNPEN  87

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKFSD   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  88   TFYAVKRLIGRKFSDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  144

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  145  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  204

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  205  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  263

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  264  KKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  321

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PK           +P+
Sbjct  322  ATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEDFFGKKPS  381

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  382  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTT  436

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FD
Sbjct  437  IPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAPRGVPQIEVSFD  496

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NV A +K+TGKE  I I +  G LS A+I++MV++AE   + D+  K  IEAK
Sbjct  497  IDANGIVNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAADQERKELIEAK  555

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAIED  564
            N  ++ AY    TL  +++K+  +  E  K A+ D
Sbjct  556  NDADSTAYQTEKTLKEHEDKIDAETVEKVKAALAD  590

>H310_06631
Length=651

 Score = 504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 278/561 (50%), Positives = 359/561 (64%), Gaps = 32/561 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  28   IGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPFN  87

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQIT-VQFKGESKTFQPEEISSMV  127
            T++  KRLIGRK+ D   Q   K   +K+ +G    P  T    + + + + P +I SMV
Sbjct  88   TLYAVKRLIGRKYQDKETQDVSKVVSYKIVAG----PNGTDAWVEAQGQKYSPSQIGSMV  143

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            L KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AY
Sbjct  144  LTKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAY  203

Query  188  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            GLDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H   E
Sbjct  204  GLDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHLVSE  262

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTIT  301
            FKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  IT
Sbjct  263  FKRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKIT  320

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EP  350
            RA+FE + G    +T+ P +K ++DA ++K +++EV+LVGG +R+PK            P
Sbjct  321  RAQFEKLVGHLIERTLNPCKKCVKDAGVTKEEINEVILVGGMSRMPKVQTSVEEFFGKRP  380

Query  351  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  410
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  381  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  435

Query  411  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  470
            T+PTKKSQ FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG+PQI+V+F
Sbjct  436  TIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRGIPQIEVSF  495

Query  471  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEA  530
            DIDANGI+NV A +K+TGKE  I I +  G LS+ +I+RMV EAE     D   K  IEA
Sbjct  496  DIDANGIVNVGARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIEA  554

Query  531  KNALENYAYNLRNTLNDEKLK  551
            KN  ++  Y    TL + + K
Sbjct  555  KNEADSLVYTTEKTLTEHEAK  575

>H257_01277
Length=652

 Score = 504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 282/567 (50%), Positives = 363/567 (64%), Gaps = 31/567 (5%)

Query  4    SVSGYSV-GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ  61
            S SG  V GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q
Sbjct  21   SASGAEVIGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQ  80

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  121
               N +NT++  KRLIGRKF D   Q   K   +K+ +G  +     V+ +G+   + P 
Sbjct  81   AVTNPYNTLYAVKRLIGRKFQDKETQEVAKVVSYKIVAGT-NGTDAWVEAQGQK--YSPS  137

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            +I SMVL KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPT
Sbjct  138  QIGSMVLTKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPT  197

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAA+AYGLDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+
Sbjct  198  AAALAYGLDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELL  256

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------  295
             H   EFKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D      
Sbjct  257  RHLVSEFKRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKH  314

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-------  348
             N  ITRA+FE +      +T+ P +K ++DA ++K +++EV+LVGG +R+PK       
Sbjct  315  LNIKITRAQFEKLVNHLIERTLNPCKKCVKDAGVTKDEINEVILVGGMSRMPKVQTSVEE  374

Query  349  ----EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  404
                 P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T 
Sbjct  375  FFGKRPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTK  429

Query  405  LIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVP  464
            LI RNTT+PTKKSQ FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG+P
Sbjct  430  LIPRNTTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRGIP  489

Query  465  QIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEAN  524
            QI+V+FDIDANGI+NV A +K+TGKE  I I +  G LS+ +I+RMV EAE     D   
Sbjct  490  QIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEDEIERMVREAEVNAEADAKR  548

Query  525  KVRIEAKNALENYAYNLRNTLNDEKLK  551
            K  IEAKN  ++  Y    TL + + K
Sbjct  549  KELIEAKNEADSLVYTTEKTLTEHEAK  575

>PITG_15786
Length=633

 Score = 501 bits (1291),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 288/580 (50%), Positives = 374/580 (64%), Gaps = 32/580 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVNEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PK           +P+
Sbjct  305  ATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEEFFGKKPS  364

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  365  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTT  419

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FD
Sbjct  420  IPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFD  479

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NV A +K+TGKE  I I +  G LS+A+I++MV++AE   + D+  K  IEAK
Sbjct  480  IDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEAK  538

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAIEDKVTET  569
            N  ++  Y+   TL  +++K+  +  E  K A+ D  T++
Sbjct  539  NDADSTLYSTEKTLKEHEDKIDAETLEQVKTALTDLRTKS  578

>PPTG_18274
Length=648

 Score = 501 bits (1290),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 289/580 (50%), Positives = 373/580 (64%), Gaps = 32/580 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  86

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG    + P +I SMVL
Sbjct  87   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGTK--YSPSQIGSMVL  143

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  144  TKMKETADGFLGKPVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  203

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  204  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  262

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  263  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  320

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PK           +P+
Sbjct  321  ATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEEFFGKKPS  380

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  381  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTT  435

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FD
Sbjct  436  IPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFD  495

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NV A +K+TGKE  I I +  G LS+A+I++MV++AE   + D+  K  IEAK
Sbjct  496  IDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEAK  554

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAIEDKVTET  569
            N  ++  Y+   TL  +++K+  +  E  K A+ D  T++
Sbjct  555  NEADSTLYSTEKTLKEHEDKIDAETLEKVKAALADLRTKS  594

>PHYCA_541134
Length=633

 Score = 499 bits (1286),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 288/580 (50%), Positives = 371/580 (64%), Gaps = 32/580 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A FE + G    +TM P +K ++DA L KS ++EV+LVGG +R+PK           +P+
Sbjct  305  ATFEKLVGKLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQTSVEEFFGKKPS  364

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  365  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTT  419

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FD
Sbjct  420  IPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFD  479

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NV A +K+TGKE  I I +  G LS A+I++MV++AE   + D+  K  IEAK
Sbjct  480  IDANGIVNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAADQQRKELIEAK  538

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAIEDKVTET  569
            N  ++  Y    TL  +++K+  +  E  K A+ D  T++
Sbjct  539  NEADSTLYTTEKTLTEHEDKIDAETLEKVKAALADLRTKS  578

>PHALS_07616
Length=677

 Score = 501 bits (1290),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 287/573 (50%), Positives = 370/573 (65%), Gaps = 28/573 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  55   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  114

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  115  TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKYSPSQIGSMVL  171

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AVITVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  172  TKMKETADGFLGKPITQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  231

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  232  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVSEF  290

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID----FNSTITRAR  304
            K++   +++ +  A++RLR A E+AKR L   AQ  I +  +          N  ITRA 
Sbjct  291  KKETSINLSGDNLAMQRLREAAEKAKRELDGLAQTDISLPFITADASGPKHLNMKITRAT  350

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPNKS  353
            FE + G    +TM P +K ++DA LSKS ++EV+LVGG +R+PK           +P+K 
Sbjct  351  FEKLVGKLIERTMGPCKKCVKDAGLSKSDINEVILVGGMSRMPKVQASVEEFFGKKPSKG  410

Query  354  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  413
            +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT+P
Sbjct  411  VNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIP  465

Query  414  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  473
            TKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDID
Sbjct  466  TKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFDID  525

Query  474  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNA  533
            ANGI+NV A +K+TGKE  I I +  G LS+A+I++MV++AE   + D+  K  IEAKN 
Sbjct  526  ANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEAKND  584

Query  534  LENYAYNLRNTL--NDEKLKDQISEDDKKAIED  564
             ++  Y    TL  +++K+  ++ E  K A+ D
Sbjct  585  ADSTIYTTEKTLKEHEDKIDAELLEKVKTALAD  617

>PHYRA_71123
Length=633

 Score = 499 bits (1285),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 288/580 (50%), Positives = 372/580 (64%), Gaps = 32/580 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKAARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG  K + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKYSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PK           +P+
Sbjct  305  ATFEQLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEEFFGKKPS  364

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  365  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTT  419

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FD
Sbjct  420  IPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAPRGVPQIEVSFD  479

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NV A +K+TGKE  I I +  G LS+++I++MV++AE   + D   K  IEAK
Sbjct  480  IDANGIVNVGARDKATGKEQNIVIQSSGG-LSESEIEKMVADAEANAAADLERKELIEAK  538

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAIEDKVTET  569
            N  ++  Y    TL  +++K+  +  E  K A+ D  T++
Sbjct  539  NDADSTLYTTEKTLKEHEDKIDAETLEKVKAALADLRTKS  578

>PHYSO_500480
Length=633

 Score = 498 bits (1283),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 287/580 (49%), Positives = 373/580 (64%), Gaps = 32/580 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +K+  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKHVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            +++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  I+R
Sbjct  247  RKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKISR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A FE + G+   +TM P +K ++DA L KS ++EV+LVGG +R+PK           +P+
Sbjct  305  ATFEKLVGNLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQSTVEEFFGKKPS  364

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  365  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTT  419

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FD
Sbjct  420  IPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFD  479

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NV A +K+TGKE  I I +  G LS+A+I++MV++AE   + D+  K  IEAK
Sbjct  480  IDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEAK  538

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAIEDKVTET  569
            N  ++  Y    TL  +++K+  +  E  K A+ D  T++
Sbjct  539  NEADSTLYTTEKTLKEHEDKIDAETLEKVKAALADLRTKS  578

>SDRG_11043
Length=649

 Score = 498 bits (1283),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 277/561 (49%), Positives = 358/561 (64%), Gaps = 32/561 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGA-GDKPQITVQFKGESKTFQPEEISSMV  127
            T++  KRLIGRKF+D   Q   K   +K+  G  G    +  Q     + + P +I SMV
Sbjct  87   TLYAVKRLIGRKFNDKETQEVSKVVSYKIVPGTNGSDAWVEAQ----GQKYSPSQIGSMV  142

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            L KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AY
Sbjct  143  LTKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAY  202

Query  188  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            G+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     E
Sbjct  203  GMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGE  261

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTIT  301
            FKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  IT
Sbjct  262  FKRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKIT  319

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EP  350
            RA+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PK            P
Sbjct  320  RAQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPKVQQSVEDFFGKRP  379

Query  351  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  410
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  380  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  434

Query  411  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  470
            T+PTKKSQ FST +DNQ  V I+V +GER M  DN  LG F+L  IPP PRG+PQI+V+F
Sbjct  435  TIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQNIPPAPRGIPQIEVSF  494

Query  471  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEA  530
            DIDANGI+NVSA +K+TGKE  I I +  G LS+ +I+RMV EAE     D   K  IE 
Sbjct  495  DIDANGIVNVSARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIEV  553

Query  531  KNALENYAYNLRNTLNDEKLK  551
            KN  ++  YN   TL++ + K
Sbjct  554  KNEADSLVYNAEKTLSEHESK  574

>PHYSO_525429
Length=610

 Score = 496 bits (1278),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 283/599 (47%), Positives = 389/599 (65%), Gaps = 36/599 (6%)

Query  16   TTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKR  75
            TT   VGVW N+ V ++ +D   R  PS+VAFTDTERL+GD AK QVA N +NTVF   R
Sbjct  3    TTCLRVGVWVNNNVAVLTSD---RPLPSFVAFTDTERLVGDVAKRQVATNVNNTVFGTTR  59

Query  76   LIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVA  135
            LIGRKFSD  VQ D+KHWPFK+  G  D P + VQ  G++KTF+P EI +M+L + RE  
Sbjct  60   LIGRKFSDLEVQEDLKHWPFKVVGGPNDGPLVEVQAAGQTKTFRPVEILAMLLAEARETV  119

Query  136  EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK--KG  193
            E  +GK V+NAV+TVPA FN +QRQA KDAGA+AGLNV R+I+  TAAAIA+GL+   K 
Sbjct  120  ETHLGKRVENAVVTVPASFNYAQRQAIKDAGAVAGLNVARLISASTAAAIAHGLENKTKA  179

Query  194  GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHR  253
            G+RN+L+ DLGGGT DVSL++IEE I+EV ATAG+ HLGGEDFD+RLV+H   EFKR HR
Sbjct  180  GQRNLLVLDLGGGTLDVSLVAIEEEIYEVLATAGNAHLGGEDFDSRLVEHCVAEFKRMHR  239

Query  254  KDITENQRALRRLRTACERAKRTLSS--SAQAYIEIDSLFDGIDFNSTITRARFEDMCGD  311
            KD++ N RA+ RLR ACE AKR L +  S +  IE+D+L++GIDF++ ITRA+FE +C D
Sbjct  240  KDLSTNARAMMRLRMACESAKRALFAPESVEKLIELDALYEGIDFHTKITRAQFEKLCAD  299

Query  312  YFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPN------------KSINPDEA  359
                 M PV++VL DA + +S+V EVV+VGGS RI K               +S + +E 
Sbjct  300  LSDDIMLPVQQVLSDASVLRSKVDEVVMVGGSMRITKVEELLKEFFNGKKIIRSRHEEEL  359

Query  360  VAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT-LIARNTTVPTKKSQ  418
               GAT+ AA+L+   S  K  +  +L                T+ +I R+TT+PT+K++
Sbjct  360  NVLGATMHAAMLTDELSVIKPLEEFMLLDVTPLSLGVKIDDTNTSVMIPRSTTIPTRKTR  419

Query  419  TFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGIL  478
            TFST  DNQ  V I++ EGE     DN ++GK   DG+P  PRG  +I+VT ++DANG +
Sbjct  420  TFSTSQDNQSVVQIELLEGEDG---DNRVIGKLKGDGLPLEPRGEFKIEVTVEVDANGCI  476

Query  479  NVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYA  538
             V   ++STG+  K+ ++ D   LS  +IDRM     K  S+ E           LENYA
Sbjct  477  TVLIADESTGQSKKLEVSGDC--LSALEIDRMRKSVMKDASKIE-----------LENYA  523

Query  539  YNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANP  597
             ++R+T      + + S ++ +A+E++ TET++WL+ N S  + + + K+++LE  A P
Sbjct  524  NSVRSTAAKRIAELKRSIEEMQAVEEQATETLHWLNRNHSVGRADIDVKRRKLEEAATP  582

>CCI45982
Length=661

 Score = 495 bits (1275),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 289/608 (48%), Positives = 378/608 (62%), Gaps = 42/608 (7%)

Query  2    AQSV--SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAA  58
            AQ+V  SG  +GIDLGTT SCV   +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  26   AQNVAGSGAVIGIDLGTTNSCVATMEGKTPRVIENSEGARTTPSVVAILDGGERLVGMPA  85

Query  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTF  118
            K Q   N  +T +  KRLIGRK++D       +   +K+  G   K    V+ KG+   +
Sbjct  86   KRQAVTNPESTFYAVKRLIGRKYNDGETNKVKEVVSYKIVPGPNGK-DAWVETKGQK--Y  142

Query  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
             P +I SMVL KM+E A++F+G+ V  AVITVPAYFNDSQRQATKDAG IAGL+VLRIIN
Sbjct  143  SPSQIGSMVLAKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIIN  202

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD 
Sbjct  203  EPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDE  261

Query  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID---  295
             L+ H   +FK++   D++++  A++RLR A E+AKR L   AQ  I +   F   D   
Sbjct  262  ELLRHLVSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASG  319

Query  296  ---FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK----  348
                N  ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PK    
Sbjct  320  PKHLNMKITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQA  379

Query  349  -------EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGV  401
                   +P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV
Sbjct  380  VEDFFGKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGV  434

Query  402  MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR  461
             T LI RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PR
Sbjct  435  FTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPR  494

Query  462  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSED  521
            GVPQI+V+FDIDANGI+NV+A +K+TGKE  I I +  G LS+ADI+RMV EAE   + D
Sbjct  495  GVPQIEVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG-LSEADIERMVQEAEMNATAD  553

Query  522  EANKVRIEAKNALENYAYNLRNTLND----------EKLKDQISEDDKKAIEDKVTETIN  571
            +  K  IE KN  +   Y+   TL +          E++K  +++   KA  D V E   
Sbjct  554  QQRKELIELKNDADGVIYSTEKTLKEYEDKIEATLVEQVKTDLADLRSKAEGDSVDEIKA  613

Query  572  WLDANQSA  579
             L+  Q +
Sbjct  614  ALEKVQQS  621

>CCA21514
Length=659

 Score = 492 bits (1267),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 281/579 (49%), Positives = 367/579 (63%), Gaps = 32/579 (6%)

Query  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  64
            SG  +GIDLGTT SCV         +I N +G RTTPS VA  D  ERL+G  AK Q   
Sbjct  31   SGAVIGIDLGTTNSCVATMDGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQAVT  90

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  +T +  KRLIGRK++D       +   +K+  G+  K    V+ KG+   + P +I 
Sbjct  91   NPESTFYAVKRLIGRKYNDHETNKVKEVVSYKIVPGSNGK-DAWVETKGQK--YSPSQIG  147

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL KM+E A++F+G+ V  AVITVPAYFNDSQRQATKDAG IAGL VLRIINEPTAAA
Sbjct  148  SMVLGKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAA  207

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H 
Sbjct  208  LAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHL  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNS  298
              +FK++   D++++  A++RLR A E+AKR L   AQ  I +   F   D       N 
Sbjct  267  VSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASGPKHLNM  324

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK----------  348
             ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PK          
Sbjct  325  KITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQAVEEFFG  384

Query  349  -EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
             +P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI 
Sbjct  385  KKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIP  439

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI+
Sbjct  440  RNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIE  499

Query  468  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  527
            V+FDIDANGI+NV+A +K+TGKE  I I +  G LS ADI+RMV EAE   + D+  K  
Sbjct  500  VSFDIDANGIVNVAARDKATGKEQNIIIQSSGG-LSDADIERMVQEAEMNAAADQQRKEV  558

Query  528  IEAKNALENYAYNLRNTLN--DEKLKDQISEDDKKAIED  564
            IE KN  ++  Y+   TL   ++K++  ++E  K  + D
Sbjct  559  IELKNDADSVIYSTEKTLKEFEDKIEATLAEQVKTDLAD  597

>SDRG_05816
Length=479

 Score = 481 bits (1239),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 267/484 (55%), Positives = 343/484 (71%), Gaps = 27/484 (6%)

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+
Sbjct  1    MVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAAL  60

Query  186  AYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  61   AYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  120

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            D    EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  121  DFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSSTM  180

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------  348
            TRA+FE +  + F++T E V KVL DA +    + E+VLVGGSTRIPK            
Sbjct  181  TRAKFESLNEECFKRTEETVLKVLADANMQPGDITELVLVGGSTRIPKVQNMLSAVFGGK  240

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  241  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  299

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468
            NT +P KK++ ++T  D Q    + +FEGER+   DNN LG+F + GI    RG PQI+V
Sbjct  300  NTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISGIERAKRGEPQIEV  359

Query  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            TF+IDANGIL+VSA +K TG +N  TI+N++GRL+Q DIDRMV EAEK+K +D     RI
Sbjct  360  TFEIDANGILHVSARDKKTGAKNATTISNNRGRLTQQDIDRMVEEAEKFKKDDAQMLKRI  419

Query  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            +A+N LE Y Y         +  +  S+ +  A +  + E  +W+D N+     E E K+
Sbjct  420  DARNDLEGYLY---------RALEAASKKNDAAAQTALCEARDWMDDNEELTVRELEDKR  470

Query  589  KELE  592
            + LE
Sbjct  471  RVLE  474

>PYIR_19697
Length=608

 Score = 484 bits (1245),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 276/554 (50%), Positives = 352/554 (64%), Gaps = 32/554 (6%)

Query  31   IIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQAD  89
            +I N +G RTTPS VA  D  ERL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  90   IKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVIT  149
             K   +K+ +G   K    V+ KG  K + P +I SMVL KM+E A+ F+GK +  AV+T
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKTITQAVVT  124

Query  150  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  209
            VPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  210  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  269
            VS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEFKKETSIDLSSDNLAMQRLREA  243

Query  270  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  323
             E+AKR L   AQ  I +   F   D       N  ITRA FE +      +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVSHLIERTMTPCKKC  301

Query  324  LRDAKLSKSQVHEVVLVGGSTRIPK-----------EPNKSINPDEAVAYGATVQAAILS  372
            ++DA L K  ++EV+LVGG +R+PK           +P+K +NPDE VA GA +Q  +L 
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQTTVEEFFGKKPSKGVNPDEVVAMGAAIQGGVLR  361

Query  373  GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLI  432
            G+     L D+  L +       ET GGV T LI RNTT+PTKKSQ FST AD+Q  V I
Sbjct  362  GDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGI  416

Query  433  QVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENK  492
            +V +GER M  DN  LG F+L GIPP PRGVPQI+V+FDIDANGI+NV+A +K+TGKE  
Sbjct  417  KVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVAARDKATGKEQN  476

Query  493  ITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTL--NDEKL  550
            I I +  G LS ++I+RMV EAE     D+  K  IE KN  ++ AY    TL  ++EKL
Sbjct  477  IVIQSSGG-LSDSEIERMVQEAEMNAEADQKRKELIETKNEADSVAYTTEKTLKEHEEKL  535

Query  551  KDQISEDDKKAIED  564
              +  E  K  +E+
Sbjct  536  DKETVEQVKAGLEN  549

>PYAR_22188
Length=634

 Score = 483 bits (1243),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 286/583 (49%), Positives = 363/583 (62%), Gaps = 57/583 (10%)

Query  31   IIANDQGNRTTPSYVAFTDTE-RLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQAD  89
            +I N +G RTTPS VA  D E RL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENAEGARTTPSVVAILDNEERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  90   IKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVIT  149
             K   +K+ +G   K    V+ KG  K + P +I SMVL KM+E A+ F+GK +  AV+T
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKPITQAVVT  124

Query  150  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  209
            VPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  210  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  269
            VS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVTEFKKETSIDLSGDNLAMQRLREA  243

Query  270  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  323
             E+AKR L   AQ  I +   F   D       N  ITRA FE + G+   +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVGNLVERTMGPCKKC  301

Query  324  LRDAKLSKSQVHEVVLVGGSTRIPK-----------EPNKSINPDEAVAYGATVQAAILS  372
            ++DA L K  ++EV+LVGG +R+PK           +P+K +NPDE VA GA +Q  +L 
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFFGKKPSKGVNPDEVVAMGAAIQGGVLR  361

Query  373  GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLI  432
            G+     L D+  L +       ET GGV T LI RNTT+PTKKSQ FST AD+Q  V I
Sbjct  362  GDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGI  416

Query  433  QVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENK  492
            +V +GER M  DN  LG F+L GIPP PRGVPQI+VTFDIDANGI+NVSA +KSTGKE  
Sbjct  417  KVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSARDKSTGKEQS  476

Query  493  ITITNDKGRLSQADIDRMVSEAE-------KYKS------------------EDEANKVR  527
            I I +  G LS ADI+RMV EAE       K K+                   D+  K  
Sbjct  477  IVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIXXXXERMVQEAEMNAEADQKRKAL  535

Query  528  IEAKNALENYAYNLRNTL--NDEKLKDQISEDDKKAIEDKVTE  568
            IEAKN  ++ AY+   +L  +++K+  + SE  K AI++  T+
Sbjct  536  IEAKNEADSVAYSTEKSLKEHEDKIDAETSETVKTAIQNLRTQ  578

>SPRG_02294
Length=634

 Score = 469 bits (1207),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 275/549 (50%), Positives = 360/549 (66%), Gaps = 23/549 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T++  KRLIGRKFSD   Q   K   + + +G   +       + + + + P +I SMVL
Sbjct  87   TLYAVKRLIGRKFSDKETQEVSKVVSYNIVAGTNGQ---DAWVEAQGQKYSPSQIGSMVL  143

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  144  TKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  203

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     EF
Sbjct  204  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGEF  262

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            KR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  ITR
Sbjct  263  KRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKITR  320

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNKSINPDEAVAY  362
            A+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PK   +S+   E    
Sbjct  321  AQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPK-VQQSV---EDFFG  376

Query  363  GATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFST  422
                +  +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNTT+PTKKSQ FST
Sbjct  377  KRPRRGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKSQVFST  431

Query  423  YADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSA  482
             +DNQ  V I+V +GER M  DN  LG F+L  IPP PRG+PQI+V+FDIDANGI+NVSA
Sbjct  432  ASDNQTQVGIKVLQGEREMAADNKSLGNFDLQNIPPAPRGIPQIEVSFDIDANGIVNVSA  491

Query  483  VEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLR  542
             +K+TGKE  I I +  G LS+ +I+RMV EAE     D   K  IE KN  ++  YN  
Sbjct  492  RDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIEVKNEADSLVYNAE  550

Query  543  NTLNDEKLK  551
             TL++ + K
Sbjct  551  KTLSEHESK  559

>PHYSO_339666
Length=585

 Score = 465 bits (1196),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 268/606 (44%), Positives = 372/606 (61%), Gaps = 46/606 (8%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            VGIDLGTT S VGVW+N+RVE I N Q    TPSYVAFT+T  L+G+AAK Q+  N  NT
Sbjct  5    VGIDLGTTGSRVGVWRNERVEFIPNRQQAYWTPSYVAFTETALLVGEAAKRQLTTNPENT  64

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
            VFD  + +GRKFS+  ++  +  WPFK+  G  D PQ+ VQ+KGE+K+F P EI +++L 
Sbjct  65   VFDLTQFVGRKFSE--LRESVIDWPFKVECGPEDTPQVVVQYKGETKSFMPVEIMAILLY  122

Query  130  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  189
            +MR++AE ++ +EV  AV TVP  FN  QRQA KDAGAIAGL+V+R++N  T A I YG 
Sbjct  123  EMRKIAEIYLDQEVTKAVFTVPGSFNYFQRQAMKDAGAIAGLDVIRLVNSATVACIEYGF  182

Query  190  DK---KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            +    + GE NVL+ D G  + +                          FD+RLV+HF  
Sbjct  183  NTLVGRVGELNVLVVDYGASSLN--------------------------FDSRLVEHFAA  216

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
            EF+R+H KD+  +  A+ RLRTACE AKR LSSS +A+IE+D+L DGI+F S I     E
Sbjct  217  EFQRRHGKDLRSDSSAVMRLRTACEHAKRALSSSMEAFIELDALHDGINFYSMIRCVWME  276

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK----------SINP  356
             +C D F K +  VEK+LR+A+L K QV E+VLVGGST +PK   K          S+  
Sbjct  277  RLCADLFDKMLRLVEKLLREARLRKDQVDEIVLVGGSTHVPKVQQKLKDFFNGKMLSLRQ  336

Query  357  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL-IARNTTVPTK  415
            DEA A+G  VQ   L G   S KL + +LLD   L   +E    +M  + +++N+T+P +
Sbjct  337  DEAAAFGVAVQGDFL-GGLPSPKLDEYMLLDTASLEFSVEIDDCMMKEVPVSKNSTLPMR  395

Query  416  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  475
            KS+TF T   N+  + I+ FEGE +    N LL +F +DGI   P  + +I+V  D+DAN
Sbjct  396  KSRTFLTANANKSTMRIKAFEGEATTVATNRLLCEFEMDGITMTPGRLSEIEVAIDVDAN  455

Query  476  GILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALE  535
            G L VSAVEKSTGKE KITI  +  RLS ++++RM S  E+   + E  ++RI++K  LE
Sbjct  456  GSLTVSAVEKSTGKEKKITI--NCSRLSTSEVERMHSNIEETFLDPE-EELRIQSKAVLE  512

Query  536  NYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVA  595
             YA ++ ++      K + S   +  IE    E + WLD N SA+KE ++ K+++L  +A
Sbjct  513  RYANSVCSSAAKRIAKLKRSLAKEYTIESSAMEALQWLDTNPSAKKEHFDAKRQKLGEMA  572

Query  596  NPILQK  601
             P  Q+
Sbjct  573  TPSGQR  578

>PPTG_02121
Length=222

 Score = 425 bits (1092),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 204/211 (97%), Positives = 207/211 (98%), Gaps = 0/211 (0%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M Q+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGRKFSDPIVQADIKHWPFK+TSG GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAANTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  211
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVS
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  211

>PITG_15370
Length=474

 Score = 422 bits (1085),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 234/288 (81%), Positives = 251/288 (87%), Gaps = 13/288 (5%)

Query  148  ITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGT  207
            +TVPAYFNDSQRQAT  AGAIAGLNVLRIINEPTAAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  150  VTVPAYFNDSQRQATIYAGAIAGLNVLRIINEPTAAAIAYGLDKKGGEHNVLIFDLGGGT  209

Query  208  FDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLR  267
            FDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV+ F  EFKRKHRKD+T NQRALRRLR
Sbjct  210  FDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEFFVTEFKRKHRKDMTSNQRALRRLR  269

Query  268  TACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDA  327
            TACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRARFED+C DYFRKTM+PV +VLRD+
Sbjct  270  TACERAKRTLSTSAQAYIEIDSLFDGVDFNSTITRARFEDLCSDYFRKTMDPVAQVLRDS  329

Query  328  KLSKSQVHEVVLVGGSTRIP-----------KEPNKSINPDEAVAYGATVQAAILSGNds  376
            KLSK+QV+E+VLVG STR             KE  KSINPDEAVAYGATVQAAILSGN+S
Sbjct  330  KLSKNQVNEIVLVGSSTRSKVQQLLKDFFNGKELFKSINPDEAVAYGATVQAAILSGNES  389

Query  377  seklqdlllldvtplslglETAGGVMTTLIARN--TTVPTKKSQTFST  422
            S KLQDLLLLDV PLSLGLETAGGVMT LI RN  T   T K ++ ST
Sbjct  390  SSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNNSTLSLTGKYRSLST  437

>PYAR_14487
Length=467

 Score = 421 bits (1082),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 246/288 (85%), Positives = 261/288 (91%), Gaps = 4/288 (1%)

Query  358  EAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKS  417
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  184  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243

Query  418  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  477
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303

Query  478  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENY  537
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYKSEDEANK+RIEAKN LENY
Sbjct  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363

Query  538  AYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANP  597
            AYNLRNTLNDEKL+ QI EDD+KAI+DKVTE INWLDA+Q++EKEE+E KQKELEG+ANP
Sbjct  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423

Query  598  ILQKMYaaaggapgaeggmpggmpggmpgagappagapDQGPKIEEVD  645
            ILQKMY     + GA GGMPGG PG     G  P+   DQGPKIEEVD
Sbjct  424  ILQKMY----ASAGAAGGMPGGAPGAPGAPGPAPSAGGDQGPKIEEVD  467

 Score = 346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/245 (75%), Positives = 188/245 (77%), Gaps = 40/245 (16%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQSV+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV---KATAGDTHLGGEDFD  237
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE     AT     L G D  
Sbjct  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQS  203

Query  238  NRLVD  242
             +L D
Sbjct  204  EKLQD  208

>PYAR_19930
Length=625

 Score = 425 bits (1093),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 240/417 (58%), Positives = 301/417 (72%), Gaps = 22/417 (5%)

Query  136  EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  195
            E  IG+  K    + P     + RQ+TKDAGAIAGL+V RIINEPTAAA+AYGLD   G+
Sbjct  214  ERLIGEAAKIQAASNPT----NTRQSTKDAGAIAGLDVKRIINEPTAAALAYGLDTNAGQ  269

Query  196  R----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRK  251
                 NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ LVD    EFKRK
Sbjct  270  SGAGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNLVDFLVTEFKRK  329

Query  252  HRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  310
            ++  D T + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST+TRA+ E +  
Sbjct  330  NKGLDPTGSARAMRRLRTACESAKRMLSTTTSAAVEVDSLFEGVDFSSTLTRAKLESLNE  389

Query  311  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK------------EPNKSINPDE  358
            D F++  E V+KVL DAK+    + EVVLVGGSTRIPK            E +KSINPDE
Sbjct  390  DLFKRCEETVQKVLADAKMKPDDITEVVLVGGSTRIPKVQSLLSALFGGKELSKSINPDE  449

Query  359  AVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQ  418
            AVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P +K++
Sbjct  450  AVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVRKTR  508

Query  419  TFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGIL  478
             ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++VTF+IDANGIL
Sbjct  509  VYTTEEDYQTSVDVCIYEGERAHVDSNNKLGEFNISGIERAKRGEPQVEVTFEIDANGIL  568

Query  479  NVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALE  535
            NVSA +K TG   + TI+N++GRL+Q DIDRMVS+AEK+K +D     +IEA+N LE
Sbjct  569  NVSARDKKTGARAETTISNNRGRLTQEDIDRMVSDAEKFKKDDAELLRKIEARNELE  625

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 2/65 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D ERLIG+AAK Q A 
Sbjct  168  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDQERLIGEAAKIQAAS  227

Query  65   NAHNT  69
            N  NT
Sbjct  228  NPTNT  232

>PYAP_16216
Length=564

 Score = 412 bits (1058),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 212/517 (41%), Positives = 331/517 (64%), Gaps = 17/517 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+G+T+ CVGVWQN +V IIANDQG RTTP++V F   E ++GD A N++  +A NTV
Sbjct  5    GIDIGSTHGCVGVWQNGKVNIIANDQGFRTTPAFVCFEGEEVIVGDTAVNKLHSHAANTV  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KR++G+   +   +  +  W F+LT GA           GE+    P +  S+++  
Sbjct  65   FHLKRVLGKNHEEIASRDFVSEWSFELTKGADGLAVAKTARNGEAHEVSPVDFVSILIKN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+ V + VI +PA+  +SQ++  + A   AG+NV+  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGETVDSIVINIPAHAGESQKELIRAAATKAGVNVMSYLSEPLAAAIAYGLD  184

Query  191  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
               K       L+FD+GG T DV+LLS+++G+FE+ AT+G+  LGGEDF   + +H  + 
Sbjct  185  ENTKNSHAEYALVFDIGGATHDVTLLSVDKGLFEIVATSGNDALGGEDFTKAIFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F+RK + ++ +NQ+A  RLR ACE AKR+LS+ +Q  IE+DSL +G DF   ++R RFE+
Sbjct  245  FQRKTKLNVKDNQKASSRLRAACETAKRSLSTQSQVNIEVDSLMEGEDFALKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +  D+ + +++ VEK+L +A++ K+ +  V+L+GGS+RIP            K+ +  I+
Sbjct  305  LIADFVKDSLKEVEKLLEEAEIEKADIDHVILIGGSSRIPLVQNSVKKFFDGKKTHMHIS  364

Query  356  PDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  414
            PDE VA+GAT++AA +       E       ++VTPL+L +  A G ++ +I R+T +PT
Sbjct  365  PDEVVAHGATLEAAAIGDIAALGEPKSAQNDVNVTPLTLSVALANGSVSEVIHRDTVLPT  424

Query  415  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  474
              ++ F+T  DNQ  + IQV+EGER M +DN LL +  + GI P+P+G  +I+VTF I +
Sbjct  425  SATEVFTTSVDNQDSIFIQVYEGERVMAKDNTLLAQLKVTGISPLPKGEAEIEVTFAISS  484

Query  475  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             G+L V+A E S GK+  + + ND  RL+ AD+  ++
Sbjct  485  KGVLTVTANEASAGKKT-LEVKNDAKRLTAADVAAVI  520

>HYAP_01993
Length=569

 Score = 409 bits (1051),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 218/527 (41%), Positives = 332/527 (63%), Gaps = 17/527 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVWQN +V IIANDQG RTTP+YV F   E ++GD A N++A +A NT+
Sbjct  5    GIDIGTTHGCVGVWQNGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKLASHADNTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+  +D   +  +K WPF +T GA    Q   Q  GE     P E   ++L  
Sbjct  65   FHLKRLLGKAHADVKDREFVKEWPFGVTEGADGVAQAETQRNGEKHAVDPVEFMMLLLQN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+++++ VI  PA+ ++   +    A    G+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVINKPAHTDEKYTELLDAAAKKVGVNVLTYLSEPLAAAIAYGLD  184

Query  191  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G+  LGGEDF   + +H  + 
Sbjct  185  EAANNDKPEFVLVFDIGGATHDVTLLNADKGLFEVVASKGNDTLGGEDFTAAIFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  245  FLRKTKLDVKPNQKASSRLRLACEAAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +  D  +KT+  +E +L+D +L K  +  VVLVGGS+RIP            K  +  ++
Sbjct  305  LINDDVQKTITEIEAILKDNELEKEDIDHVVLVGGSSRIPLVQTLIKKFFENKTLHTQLS  364

Query  356  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  414
            PDEAVA+GAT++A+ L+    S    + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAFGATIEASCLAELLGSEAPAKPLNMVNVVPLTLSVALANGSVSELIQRDTILPA  424

Query  415  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  474
              ++ F+T +DNQ    +Q++EG+R M +DN L+ + ++ GI P+P+G  +IDVTF +  
Sbjct  425  SATEVFTTSSDNQEAAFLQIYEGQRLMAKDNTLVAQLSVAGITPLPKGDAEIDVTFTVST  484

Query  475  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSED  521
             G+L V+A E+  G ++ + + +D  RL+ AD+  +V +A+    ED
Sbjct  485  KGVLTVTASERKAGSKS-LEVMHDSTRLTPADVAAVVKKADDAADED  530

>PPTG_16727
Length=217

 Score = 395 bits (1015),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 196/207 (95%), Gaps = 0/207 (0%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M + V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  GA +KPQ+ VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGT  207
            TAAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGT  207

>PHYSO_552116
Length=570

 Score = 407 bits (1047),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 215/517 (42%), Positives = 327/517 (63%), Gaps = 17/517 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+  +D   +  +K WPF +T+GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVADRDFVKEWPFDITAGADGVAQAETQRNGEKHPVSPVEFMALLLQN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+++++ VI+ PA+ +DS  +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVISKPAHTDDSYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  184

Query  191  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   + +H  + 
Sbjct  185  EAANNAKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAAVFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AK+TLS+  QA IE+D+L +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRIACEVAKKTLSTQTQANIEVDTLMEGEDFSLKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +  DY  +T+  +E +L + +L K  +  +VLVGGSTRIP            K  +  ++
Sbjct  305  LITDYVHETITEIEAILEENELEKEDIDHIVLVGGSTRIPLVQNLVKKFFDGKNVHTQLS  364

Query  356  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  414
            PDEAVAYGAT++ + L+           L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAYGATIEGSGLAELVGVPAPKNPLNMVNVVPLNLSVALANGSVSELIQRDTVLPA  424

Query  415  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  474
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I+VTF +  
Sbjct  425  TATELFTTSEDNQEAVYLQIYEGQRLMAKDNTLVAQLSVAGITPLPKGDAEIEVTFTVST  484

Query  475  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             G+L V+A E+  GK++ + +T D  RL+ AD+  +V
Sbjct  485  KGVLTVTASERKAGKKS-LEVTQDSKRLTPADVAAIV  520

>PYU1_G006940
Length=565

 Score = 404 bits (1037),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 212/517 (41%), Positives = 325/517 (63%), Gaps = 17/517 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLHSHAENTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KR++G+   D +    I+ W FK++              GE     P E  S+++  
Sbjct  65   FHLKRVLGKNHEDVVDHDYIQEWSFKVSKADDGAVHAATSRNGEPHHVTPVEFVSLLIKN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+ V + V+++PA+  + Q++  ++A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEAVDSVVLSIPAHATEKQKELLQEAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  191  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
               K      VL+FD+GG T DV+L++ ++G+FE+ A+AG+  LGGEDF   LV+H  + 
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVASAGNDKLGGEDFTKALVEHCAKA  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F+RK + ++ +N++A  RLR ACE AKRTLS+  Q  IEIDSL +G DF+  ++R RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQTQVNIEIDSLMEGEDFSLKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +  DY    ++ V+ +L  A + K  V  V+LVGGS+RIP            K  +  ++
Sbjct  305  LINDYVTAALKEVDALLESADVEKEHVDHVILVGGSSRIPLLQNAVKKYFDGKTTHLHLS  364

Query  356  PDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  414
            PDE VA+GATV+A++ +   +     + L  ++VTPL+L +  A G +T LI R T +P 
Sbjct  365  PDEVVAHGATVEASLRADLANFEAPKKALDNVNVTPLTLSVALANGSVTELIHRETVLPA  424

Query  415  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  474
              ++TF+T  DNQ  + +Q++EGER M +DN LL    + GI P P+G  +I+VTF ++ 
Sbjct  425  TATETFTTSQDNQTAIFLQIYEGERVMAKDNTLLASLAVSGIAPAPKGEAEIEVTFAVNT  484

Query  475  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             G L ++AVE++ GK+  + ++ND  RLS AD+  ++
Sbjct  485  KGALTITAVEQTAGKKT-LEVSNDPKRLSAADVAVII  520

>PPTG_10122
Length=569

 Score = 403 bits (1036),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 216/517 (42%), Positives = 328/517 (63%), Gaps = 18/517 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+  +D   +  +K WPF +T GA +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVKDRDFVKEWPFDVTQGA-EGAQVETQRSGEKHPVTPVEFMAVLLQN  123

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++E+AE F G+++++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  183

Query  191  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H  + 
Sbjct  184  EAANNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKASSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP            K     ++
Sbjct  304  LISDYVHETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFDGKNVRTQMS  363

Query  356  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  414
            PDEAVAYGAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAYGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  415  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  474
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I+V F +  
Sbjct  424  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPLPKGDAEIEVIFTVST  483

Query  475  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             G+L V+A E+  GK++ + +T+D  RL+ AD+  +V
Sbjct  484  KGVLTVTASERKAGKKS-LEVTHDSKRLTPADVAAIV  519

>PHYRA_71591
Length=570

 Score = 402 bits (1033),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 217/517 (42%), Positives = 325/517 (63%), Gaps = 17/517 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+  +D   +  +K WPF +T+GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVSDRDYVKEWPFNVTAGADGVAQAETQRNGEKHPVTPVEFMALLLQN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++E+AE F G+++++ VI  PA+ ++S  +    A A AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGEKLEHVVINKPAHTDESYTELLDAAAAKAGVNVLTYLSEPLAAAIAYGLD  184

Query  191  KKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   L +H  + 
Sbjct  185  EASNNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFSAALFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G D +  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRSLSTQTQANIEVDSLMEGEDLSLKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +  DY  +T+  ++ +L +  L K  +  VVLVGGSTRIP            K  +  ++
Sbjct  305  LISDYVHETITEIDAILEENDLEKDDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVHTQLS  364

Query  356  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  414
            PDEAVA+GAT++A+ L+      E  + L L++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAFGATIEASGLAELVGVPEPKKPLNLVNVVPLNLSVALANGSVSELIQRDTVLPA  424

Query  415  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  474
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P  +G  +I+V F +  
Sbjct  425  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPKAKGEVEIEVDFTVST  484

Query  475  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             G+L V+A E+  GK++ + +T D  RL+ AD+  +V
Sbjct  485  KGVLTVTASERKAGKKS-LEVTQDSKRLTPADVAAIV  520

>PHYKE_64
Length=569

 Score = 397 bits (1020),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 211/517 (41%), Positives = 323/517 (62%), Gaps = 17/517 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A +T+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADSTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            +  KRL+G+  +D   +  +K WPF +  GA           GE     P +  +++L  
Sbjct  65   YHLKRLLGKSHADVASRDFVKSWPFDVMEGAKGGAHAETVRNGEKHEVSPVDFMALLLQN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++E+AE F G+ +++ VI+ PA+ ++  ++    A   AG+ VL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGETLEHVVISKPAHADEKHQELLNAAAEKAGVKVLTYLSEPLAAAIAYGLD  184

Query  191  KKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV ++ G   LGGEDF N + +H  + 
Sbjct  185  EAANNPKPEYVLVFDIGGATHDVTLLNADKGLFEVLSSKGKDTLGGEDFTNAVFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AKRTLS+  Q+ IE+DSL +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRTLSTQTQSNIEVDSLMEGEDFSLKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +  DY    M+ V+ +L + +L K  +  VVLVGGSTRIP            K  +  + 
Sbjct  305  LIIDYVTDIMKEVDAILEENELEKDDIDHVVLVGGSTRIPLVQSMIKKSFEGKTTHLQMP  364

Query  356  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  414
            PDE +AYGAT++A+ L+    + E  + + +++V PL+L +  A G ++ LI R T +P 
Sbjct  365  PDEVIAYGATIEASGLAELVDAPEPKKPVNMVNVVPLNLSVALANGSVSELIQRETILPA  424

Query  415  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  474
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GIPPM +G  +I+VTF +  
Sbjct  425  THTELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVAGIPPMSKGDAEIEVTFTVST  484

Query  475  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             G+L+V+A E+  GK+  + +TND  RLS AD+  +V
Sbjct  485  KGVLSVTASERKAGKKT-LEVTNDPKRLSTADVAAIV  520

>PYIR_24123
Length=567

 Score = 396 bits (1018),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 205/517 (40%), Positives = 324/517 (63%), Gaps = 17/517 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E ++GD A N+++ +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIVGDTAVNKLSSHAENTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KR++G+   + + +  I+ W FK+               GE+    P E  S+++  
Sbjct  65   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSEDGAVHAATSRNGEAHHVTPVEFVSLLIKN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+ V N V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGESVDNVVLSIPAHVTEKQKELLQAAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  191  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
               K      VL+FD+GG T DV+L++ ++G+FE+ AT+G  +LGGEDF   L +H  + 
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVATSGKDNLGGEDFTKALFEHCAKA  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F+RK + ++ +N++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP            K  +  ++
Sbjct  305  LISDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVKKHFDGKTTHLHLS  364

Query  356  PDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  414
            PDE VA+GAT++A++ +   +     + L  ++VTPL+L +  A G +  +I R+T +P 
Sbjct  365  PDEVVAHGATIEASLRADLANFESPKKALNHVNVTPLTLSVALANGSVAEVIHRDTVLPA  424

Query  415  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  474
              ++TF+T  DNQ  + +QV+EGER M +DN LL   ++ GI P P+G  +I+VTF ++ 
Sbjct  425  TATETFTTSQDNQTAIFLQVYEGERVMAKDNTLLASLSVAGIAPAPKGEAEIEVTFTVNT  484

Query  475  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             G+L ++AVE++ GK+  + + ND  RL+  D+  ++
Sbjct  485  KGVLTITAVEQAAGKKT-LEVKNDPKRLTAKDVADII  520

>PITG_03546
Length=569

 Score = 395 bits (1014),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 212/517 (41%), Positives = 326/517 (63%), Gaps = 18/517 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F   R++G+  +D   +  +K WPF +T G+ +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLNRILGKAHADIKDRDFVKEWPFDVTQGS-EGAQVETQRNGEKHPVTPVEFMAVLLQN  123

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++E+AE F G+++++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGLD  183

Query  191  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H  + 
Sbjct  184  EATSNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+   RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKTSSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP            K     ++
Sbjct  304  LITDYVNETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVRTQMS  363

Query  356  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  414
            PDEAVA+GAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAFGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  415  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  474
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P P+G  +I+VTF + +
Sbjct  424  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPQPKGDAEIEVTFTVSS  483

Query  475  NGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             G+L V+A E+  GK++ + +T D  RL+ AD+  +V
Sbjct  484  KGVLTVTAAERKAGKKS-LEVTQDSKRLTPADVAAIV  519

>SDRG_10038
Length=565

 Score = 389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 212/512 (41%), Positives = 317/512 (62%), Gaps = 18/512 (4%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
             +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA N
Sbjct  3    CIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAAN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TV+  KR++G+K SD      IK W F + + A       V  K   +     E +S+VL
Sbjct  63   TVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKRDVSATEFASLVL  122

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             K++ +AE + G +VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AAAIAYG
Sbjct  123  GKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAYG  182

Query  189  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
             D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV+H  +
Sbjct  183  FDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALVEHCVK  242

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
             F+R+ + D+ +N RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D    ++R+RFE
Sbjct  243  TFERQKKVDLKDNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRFE  302

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSI  354
            +M GD+ RK +  +E +L +A L K  +  V+L GGSTRIP            K+ + +I
Sbjct  303  EMIGDHVRKMVTDIETLLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKKASSTI  362

Query  355  NPDEAVAYGATVQAAILS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
             PDE +AYGATV+AA LS      +     L +++  PL+L L  A G +  +I RNT +
Sbjct  363  VPDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVL  422

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            P    + F+T+ DNQ  V +Q++EG+R M RDN LL    + GIPPM +G P+I+V+F++
Sbjct  423  PATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNV  482

Query  473  DANGILNVSA-VEKSTGKENK-ITITNDKGRL  502
                +L V A +  + G ++K +T+ +D  R+
Sbjct  483  TRKSVLTVKAHLRNAEGAKSKALTVESDSKRV  514

>PITG_05721
Length=302

 Score = 379 bits (974),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 215/292 (74%), Positives = 236/292 (81%), Gaps = 24/292 (8%)

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            +L K +      I  + K + +TVPAYFNDSQ QATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  1    MLQKCKPTTHRKIKNKTKTSEVTVPAYFNDSQHQATKDAGAIAGLNVLRIINEPTAAAIA  60

Query  187  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            YGLD+KGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGG DFDNR+V+ F  
Sbjct  61   YGLDEKGGENNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGGDFDNRMVEFFVT  120

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
            E K  H            RLRTACER KRTLS+SAQAYIEIDSLFDG+DFNSTITRARFE
Sbjct  121  EVKPLH------------RLRTACERTKRTLSTSAQAYIEIDSLFDGVDFNSTITRARFE  168

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSI  354
            D+C DYFRKTM+PV +VLRD+KLSK+Q +E+VLVGGSTRIP            KE  KS+
Sbjct  169  DLCSDYFRKTMDPVAQVLRDSKLSKNQGNEIVLVGGSTRIPKVQQLLKDFFNGKELFKSV  228

Query  355  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  406
            NPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAG VMT LI
Sbjct  229  NPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGSVMTKLI  280

>PHALS_00390
Length=569

 Score = 383 bits (984),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 217/544 (40%), Positives = 332/544 (61%), Gaps = 21/544 (4%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+   +   +  +K W F +   A +   +  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKNHDEIKDRNFVKEWSFSVAQNA-EGVTVETQRNGEKHHVTPVEFMALLLQN  123

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAI-AGLNVLRIINEPTAAAIAYGL  189
            ++E+AE F G+++++ VI+ PA+  DS+     DA A  AG+NVL  ++EP AAAIAYG 
Sbjct  124  LKELAEDFTGEKLEHVVISKPAH-TDSRYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGF  182

Query  190  DKKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            D+         VL+FD+GG T DV+LL++++G+F+V A+ G   LGGE+F   + DH  +
Sbjct  183  DEAVNNEKPEYVLVFDIGGATHDVTLLNVDKGLFQVVASKGKDTLGGENFTAAVFDHCAK  242

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
             F RK + DI  NQ+A  RLR ACE AKR+LS+  Q+ IE+DSL +G DF   ++R RFE
Sbjct  243  AFLRKTKLDIKSNQKASSRLRIACEAAKRSLSTQTQSNIEVDSLMEGEDFALKLSRPRFE  302

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSI  354
            ++  ++  +T+  ++ +L +  L K  +  ++LVGGSTRIP            K     +
Sbjct  303  ELISNFVNETITEIDVILEENDLEKDDIDHIILVGGSTRIPLVQNVVKKYFEGKNVRTQL  362

Query  355  NPDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVP  413
            +PDEAVA+GAT++A+ L      S+ ++ + ++++ PL+L L  A G +  LI R T +P
Sbjct  363  SPDEAVAFGATIEASCLVELVGVSKPIEPVNMVNMVPLNLSLALANGSVAELIHRETILP  422

Query  414  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  473
               ++ F+T  DNQ  V +Q++EG+R M +DN L+ +  + GI P+P+G   I+VTF + 
Sbjct  423  ATVTEIFTTSCDNQETVYLQIYEGQRIMAKDNTLVAQLKVSGITPLPKGDAAIEVTFTVS  482

Query  474  ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIE-AKN  532
              G+L V+A E+  G ++ I +T D  RL+ AD+  +V  AE    ED+     +E A+ 
Sbjct  483  TKGVLTVTASERMAGTKS-IQVTQDSKRLTPADVAAIVKNAEDAADEDDVLLGELEDAEK  541

Query  533  ALEN  536
            A EN
Sbjct  542  AAEN  545

>SPRG_11133
Length=676

 Score = 386 bits (991),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 219/448 (49%), Positives = 291/448 (65%), Gaps = 30/448 (7%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MA       +GIDLGTT   VGVW++ +VE++ ND GN +TPS VAFTD  RL+GD AK+
Sbjct  1    MAGGSQSVVIGIDLGTTTCSVGVWRHGQVEMVRNDNGNLSTPSCVAFTDAGRLVGDFAKS  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            Q   NA NTVF+  R+IGR++ +   +        ++  G  + P I V  KGE+K   P
Sbjct  61   QAPRNAPNTVFNIMRIIGRRYDEVRKKT-------QVVCGPKNNPMIRVVEKGETKELHP  113

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEI + +++K+++    +    +++AV+TVP  FN  QRQA +DA AIAGL   RI + P
Sbjct  114  EEILAELVVKLKDDVVTYTNARIEHAVVTVPTGFNLLQRQAVRDACAIAGLAKYRISDAP  173

Query  181  TAAAIAYGLDKKGGER---NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            T AA+A+    KG  R   + ++ D+GGG   VSLL+IE+GIFEVKA AGD  LGGEDFD
Sbjct  174  TTAAVAH-TSIKGAPRCEVHDMVVDMGGGHLSVSLLAIEDGIFEVKAVAGDACLGGEDFD  232

Query  238  NRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  297
            + L DHF  EF R++RKD+T   RA+RRLRTACE+AKR LS S  A +E++ LF  IDF 
Sbjct  233  DVLFDHFAAEFARQYRKDMTTCDRAVRRLRTACEKAKRDLSISNTATLELEVLFGSIDFR  292

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKE--------  349
            S+ITRARFED+C   FRK  +P+EKVLRDAK+ KSQV +VVL GGS R+PK         
Sbjct  293  SSITRARFEDLCSGLFRKVTQPIEKVLRDAKIDKSQVRDVVLAGGSMRMPKMQQLLSSFF  352

Query  350  ---------PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  400
                      +  +N +EA A+GATV AA+   +++S     LL+L V P S+G+ET GG
Sbjct  353  GERYADKKLCHSILNNNEAAAHGATVMAAL--NDETSPDDMHLLVLHVVPYSVGIETGGG  410

Query  401  VMTTLIARNTTVPTKKSQTFSTYADNQP  428
            VMTTLI+RNTT+P+KKS+ F       P
Sbjct  411  VMTTLISRNTTIPSKKSEKFKISQPQSP  438

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query  432  IQVFEGERSMTRDNNLLGKFNLDGI-PPMPRGVPQIDVTFDIDANGILN-VSAVEKSTGK  489
            I++F GERSM RDN  L    + G   P  R     DV FDID +G+L  +       G 
Sbjct  523  IKIFTGERSMVRDNTPLHTIAIHGFYDPTARS----DVAFDIDGDGLLTAIVTYTPHIGT  578

Query  490  ENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENY  537
               I +  DKG LSQ D+ R+ +  E   + D+  + R+ A   L+ Y
Sbjct  579  NETIVVKLDKGYLSQHDVKRLTTNFE--AAADDRTRRRV-AHEELQTY  623

>PHYCA_532207
Length=1118

 Score = 393 bits (1010),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 216/525 (41%), Positives = 328/525 (62%), Gaps = 19/525 (4%)

Query  4     SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
             S S   +GID+GTT+ CVGVW N +V +IANDQG RTTP+YV F   E ++GD A N++ 
Sbjct  546   SRSLVQIGIDIGTTHGCVGVWHNGKVNVIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLP  605

Query  64    MNAHNTVFDAKRLIGRKFSDPIVQAD-IKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  122
              +A NT+F  KRL+G K  D I   D +K WPF +T GA    Q   +  GE     P E
Sbjct  606   SHADNTIFHLKRLLG-KAHDEIKDRDFVKEWPFDVTEGAEGVAQAETKRNGEKHPVTPVE  664

Query  123   ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  182
               +++L  ++++AE F G+++++ VI+ PA+ ++   +    A   AG+NVL  ++EP A
Sbjct  665   FMTLLLQNLKDLAEDFTGEKLEHVVISKPAHTDEKYTELLDAAAKQAGVNVLTYLSEPLA  724

Query  183   AAIAYGLDKKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
             AAIAYGLD+         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   
Sbjct  725   AAIAYGLDEAANNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAA  784

Query  240   LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
             + +H  + F RK + D+  NQ+A  RLR ACE AKRTLS+  QA IE+D+L +G DF   
Sbjct  785   VFEHCAKSFLRKTKLDVKTNQKASSRLRIACETAKRTLSTQTQANIEVDTLMEGEDFALK  844

Query  300   ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
             ++R RFE++  DY  +T+  ++ +L + +L K  +  +VLVGGSTRIP            
Sbjct  845   LSRPRFEELINDYVHETITEIDAILEENELEKEDIDHIVLVGGSTRIPLVQTLVKKYFEG  904

Query  348   KEPNKSINPDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLI  406
             K  +  ++PDEAVAYGAT++A+ L+      E  + L +++V PL+L +  A G ++ LI
Sbjct  905   KTVHTQLSPDEAVAYGATIEASGLAELVDVPEPKKPLNMVNVVPLNLSVALANGSVSELI  964

Query  407   ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  466
              R+T +P   ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I
Sbjct  965   QRDTILPATATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPLPKGDAEI  1024

Query  467   DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             +VTF +   G+L V+A E+  G ++ + +  D  RL+ AD+  +V
Sbjct  1025  EVTFTVSTKGVLTVTASERKAGNKS-LEVAQDAKRLTPADVAAIV  1068

>PYVX_17692
Length=551

 Score = 376 bits (965),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 207/527 (39%), Positives = 325/527 (62%), Gaps = 29/527 (6%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GIDLG+T+ CVGVW N +V IIANDQG RTTP++V F   E ++GD A +++  +A +TV
Sbjct  5    GIDLGSTHGCVGVWHNGKVNIIANDQGFRTTPAFVCFEGDEVIVGDTAVHKLPAHADSTV  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KR++G+  +D   +  ++ WPF + +G G     T Q  G +    P +  +++L  
Sbjct  65   FHLKRVLGKSQADVASRPFVQDWPFDVAAGEGGAAVATTQKNGAAHQVAPVDFLALLLRN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            +R++A+ F G+ V++ V++VP + +++ R   +DA A A +NVL  I EPT         
Sbjct  125  LRDLAQDFTGETVEHVVLSVPPHADEAHRALIRDAAAAAEVNVLAYIPEPTPEP------  178

Query  191  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  250
                 + VL+FD+GG T DV+LL+ ++G+F+V AT GD  LGGEDF + + +H  + F+R
Sbjct  179  -----QYVLVFDIGGATHDVTLLTADKGLFDVTATQGDDALGGEDFTSAVFEHCAKAFQR  233

Query  251  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  310
            K + D+  NQ+A  RLR ACE AKR+LS+  Q  IE+DSL +G DF+  ++R RFE++  
Sbjct  234  KTKLDVRGNQKASSRLRLACETAKRSLSTQTQVTIEVDSLLEGEDFSLKLSRPRFEELIN  293

Query  311  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSINPDE  358
            DY +K ++ VE +L   +L K  +  VVL+GGSTRIP            K  +  ++PDE
Sbjct  294  DYVKKALDEVEALLEAQELDKEDIDHVVLIGGSTRIPLVQSSVKSFFDGKRTHLHLSPDE  353

Query  359  AVAYGATVQAA---ILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  415
             VA+GAT++AA    L G    +  +    ++ TPL+L +  A G ++ L+ R+T +P  
Sbjct  354  VVAHGATIEAAGRGDLVG--VPDPKKPANQVNATPLTLSVALANGSVSELVHRDTVLPAS  411

Query  416  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  475
             ++TF+T AD+Q  V +Q++EGER M +DN LL +  + GI  +P+G  +IDVTF +   
Sbjct  412  ATETFTTSADDQTAVFLQIYEGERLMAKDNTLLAQLAVTGITALPKGEAEIDVTFTVSTK  471

Query  476  GILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  522
            G+L V+A E+S GK+  + + +D  RL+ AD+  +V + +    ED+
Sbjct  472  GVLTVTAEERSAGKKT-LEVKHDDKRLTAADVAAIVQKGKDAAEEDD  517

>H310_12765
Length=560

 Score = 371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 208/520 (40%), Positives = 310/520 (60%), Gaps = 21/520 (4%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCMVSFASDDVVVGDSAVAKLHNNAAN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TV+  KR++G+K  D      +K W F L +     P    +    S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKDVHAHEYVKDWSFDLAADKHGAP--IAKILDGSRDIHAVEFCTIVL  120

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             K++ +AE + G  VKN+V+TVP  ++D Q+   ++A + A LNVLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGSSVKNSVLTVPEGYSDEQKALLQEAASAADLNVLRYISEPIAAAIAYG  180

Query  189  L--DKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            L  DKK   +  ++ D+GG + D++LLS+++G+F V ATA D  LGGE F N +V+H  +
Sbjct  181  LDEDKKNESKLAVVVDIGGASTDLTLLSVDKGLFNVIATASDHALGGEVFTNSVVEHCIK  240

Query  247  EFKRKHRKDI-TENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
             F+R+ +  I  +N RAL R++ A E+AK++LS+  Q  IE+DSL DG D    ++R+RF
Sbjct  241  TFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQTQVTIEVDSLADGQDLIVKLSRSRF  300

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK------------S  353
            EDM  D+ RK  + +  +L  A   K  +  V+L+GGSTRIPK                +
Sbjct  301  EDMVIDHIRKVTKDIAALLEGAGYEKDSIDHVLLIGGSTRIPKVQTAVEDFFDGKKALVT  360

Query  354  INPDEAVAYGATVQAAILSGNds-seklqdlllldvtplslglETAGGVMTTLIARNTTV  412
            I PDEAVA+GATV++  LS     +     L  ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESGTLSETADWTLPEDPLNNVEAVPLNLSLGLADGTVYDMIHRGTIL  420

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            P    + F+T  DNQ  V +QV+EG+R + +DN LL    L GIPP P+G  +++V+F +
Sbjct  421  PANHQEVFTTQVDNQHAVYLQVYEGQRVLKKDNTLLANLTLTGIPPAPKGESEVEVSFTV  480

Query  473  DANGILNVSA-VEKSTGKENKITITNDKGRLSQADIDRMV  511
               G L V A V  + G    + + +D  R+   D++ +V
Sbjct  481  TRKGQLTVKAHVRNAEGGSKALVVASDSKRV--VDVNAIV  518

>SPRG_15695
Length=581

 Score = 370 bits (951),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 209/517 (40%), Positives = 311/517 (60%), Gaps = 28/517 (5%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            S++   +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++ 
Sbjct  24   SLNMACIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLH  83

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEI  123
             NA NTV+  KR++G+K SD      IK W F + + A       V  K   +     E 
Sbjct  84   NNAANTVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKREISATEF  143

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            +S+VL K++ +AE + G +VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AA
Sbjct  144  ASLVLGKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAA  203

Query  184  AIAYGLD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AIAYG D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV
Sbjct  204  AIAYGFDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALV  263

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
            +H  + F+R+ + D+  N RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D      
Sbjct  264  EHCVKTFERQKKVDLKNNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLI----  319

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KE  349
                  M GD+ RK +  +E +L +A L K  +  V+L GGSTRIP            K+
Sbjct  320  ------MIGDHVRKMITDIEALLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKK  373

Query  350  PNKSINPDEAVAYGATVQAAILS--GNdsseklqdlllldvtplslglETAGGVMTTLIA  407
             + +I PDE +AYGATV+AA LS      +     L +++  PL+L L  A G +  +I 
Sbjct  374  ASSTIVPDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQ  433

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  467
            RNT +P    + F+T+ DNQ  V +Q++EG+R M RDN LL    + GIPPM +G P+I+
Sbjct  434  RNTVLPATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIE  493

Query  468  VTFDIDANGILNVSA-VEKSTGKENK-ITITNDKGRL  502
            V+F++    +L V A +  + G ++K +T+ +D  R+
Sbjct  494  VSFNVTRKSVLTVKAHLRNAEGAKSKALTVESDSKRV  530

>H257_07650
Length=563

 Score = 365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 205/490 (42%), Positives = 301/490 (61%), Gaps = 18/490 (4%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCIVSFASDDVVVGDSAVAKLHNNAAN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TV+  KR++G+K  +      +K W F L +     P    +    S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKEVHEHDYVKDWSFDLAADTHGAP--IAKILDGSRDISSVEFCTIVL  120

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             K++ +AE + G  VKNAV+TVP  ++D Q+   ++A   A L+VLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGVVVKNAVLTVPEGYSDEQKALLEEAATAADLSVLRYISEPIAAAIAYG  180

Query  189  L--DKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            L  DKK   + V++ D+GG + D++LLSI++G+F V ATA D  LGGE F N +V+H  +
Sbjct  181  LDEDKKNESKLVVVVDIGGASTDLTLLSIDKGLFNVIATASDHALGGEVFTNSIVEHCVK  240

Query  247  EFKRKHRKDI-TENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
             F+R+ +  I  +N RAL R++ A E+AK++LS+ +Q  IE+DSL DG D    ++R+RF
Sbjct  241  AFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRF  300

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK------------S  353
            EDM  D+ RK  + +  +L  A  +K  +  V+LVGGS+RIPK  +             S
Sbjct  301  EDMVSDHVRKVTKDIAALLDGAGYAKDTIDHVLLVGGSSRIPKAQSAVEDFFDGKKALVS  360

Query  354  INPDEAVAYGATVQAAILSGNds-seklqdlllldvtplslglETAGGVMTTLIARNTTV  412
            I PDEAVA+GATV++A LS     +        ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESATLSETADWTLPTDPHNNVEAVPLTLSLGLADGTVYEMIHRGTVL  420

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  472
            P    + F+T ADNQ  V +QV+EG+R + +DN LL    L GIPP P+G  +++V+F++
Sbjct  421  PANVQEVFTTNADNQDAVYLQVYEGQRVLKKDNTLLANLTLSGIPPAPKGESEVEVSFNV  480

Query  473  DANGILNVSA  482
               G L V A
Sbjct  481  TRKGQLTVKA  490

>PYAR_24704
Length=525

 Score = 364 bits (934),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 194/495 (39%), Positives = 294/495 (59%), Gaps = 24/495 (5%)

Query  26   NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPI  85
            N +V IIANDQG RTTP+YV F   E ++GD A N+V  +A NT+F  KR++G+   D  
Sbjct  1    NGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKVHSHAANTIFHLKRVLGKNHEDVA  60

Query  86   VQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKN  145
                +  W F +  GA           G      P E  S++L  ++ +AE F G+ V +
Sbjct  61   ASDFVSEWSFDVAKGADGAVVAKTSRNGADHEVTPVEFLSILLKNLKNLAEDFTGETVDS  120

Query  146  AVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD---KKGGERNVLIFD  202
             VI++ A+  ++Q++    A A AG+NVL  ++EP AAAIAYGLD   K       ++ D
Sbjct  121  VVISLSAHGGENQKELISAAAAKAGVNVLSYLSEPLAAAIAYGLDENTKNSHAEYAVVVD  180

Query  203  LGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRA  262
            +GG T DV+L+SI++G+FE+  T G+  LGGEDF   + +H  + F+RK + ++ +N +A
Sbjct  181  IGGATHDVTLVSIDKGLFEIVGTHGNDSLGGEDFTKAVFEHCVKAFQRKTKLNVKDNAKA  240

Query  263  LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEK  322
              RLR ACE AKRTLS+ +Q  IE+D+L +G DF   ++R RFE++  DY + +++ VEK
Sbjct  241  SSRLRVACEAAKRTLSTQSQVNIEVDTLMEGEDFALKLSRPRFEELIVDYVKTSLKEVEK  300

Query  323  VLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSINPDEAVAYGATVQAAI  370
            VL DA + KS V  V+L+GGS+RIP            K+ +  ++PDE VA+GAT++AA 
Sbjct  301  VLEDADVDKSDVDHVILIGGSSRIPLVQTSVKKFFDGKKTHMHMSPDEVVAHGATLEAAA  360

Query  371  LS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQP  428
            +S   N    + +   +             G V  T++      PT  ++ F+T ADNQ 
Sbjct  361  ISELANFDPAESEQNNVAVTPLTLSVALANGSVSETVL------PTSATEVFTTSADNQD  414

Query  429  GVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTG  488
             + IQV+EGER+M +DN LL +  +DGI P+P+G  +I+VTF + + G+L V+A E + G
Sbjct  415  AIFIQVYEGERAMAKDNTLLAQLRVDGISPLPKGEAEIEVTFAVSSKGVLTVTANEAAAG  474

Query  489  KENKITITNDKGRLS  503
            K+  + + ND  RL+
Sbjct  475  KKT-LEVKNDGARLT  488

>PYIR_16738
Length=555

 Score = 357 bits (917),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 186/328 (57%), Positives = 252/328 (77%), Gaps = 13/328 (4%)

Query  288  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  347
            DSL DG DF+ T++RARFE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIP
Sbjct  194  DSLLDGEDFSETLSRARFEKLNEDLFKKTLGPVEKVLKDAGVKKSEVDEIVLVGGSTRIP  253

Query  348  K------------EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslgl  395
            K            EP++ +NPDEAVAYGA VQ  ILSG    E L D++L+DV PLS G+
Sbjct  254  KVQQLIKDYFNGKEPSRGVNPDEAVAYGAAVQGGILSG-AEQEGLGDMVLIDVVPLSQGI  312

Query  396  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  455
            ET GGVMT LI +NT +PTKKSQ FST+ DNQP V I+V+EGER++ +DN+LLGKF+L G
Sbjct  313  ETVGGVMTKLINKNTAIPTKKSQVFSTHVDNQPAVSIKVYEGERALVKDNHLLGKFDLTG  372

Query  456  IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAE  515
            IPP PRGVPQI VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ +IDR++ EAE
Sbjct  373  IPPAPRGVPQIQVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRIIREAE  432

Query  516  KYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDA  575
            ++  ED+  K RI+++NALE+Y YN++N++ D+K+  ++ ++DK A+   V + ++WL+ 
Sbjct  433  QFAEEDKRVKERIDSQNALESYLYNVKNSVEDDKVAAKMEDEDKDAVLKSVQDAMDWLED  492

Query  576  NQSAEKEEYEGKQKELEGVANPILQKMY  603
            NQ A+K++++ KQKE+E + NPI++K+Y
Sbjct  493  NQEADKDDFDAKQKEVEKIVNPIMKKVY  520

 Score = 212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 128/165 (78%), Gaps = 2/165 (1%)

Query  2    AQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  60
            A+   G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  26   AKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  85

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
            Q  +N   T+FD KRLIGR ++D  VQAD K  P+K+    G KP I V  KGE K F P
Sbjct  86   QATINPEQTLFDVKRLIGRSYNDKSVQADKKLLPYKIVDKDG-KPAIEVPIKGEKKLFSP  144

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDA  165
            EEIS+M+L KM+++AE ++GK++ +AV+TVPAYFND+QRQATKDA
Sbjct  145  EEISAMILTKMKQIAEGYLGKDIHDAVVTVPAYFNDAQRQATKDA  189

>SDRG_05778
Length=618

 Score = 359 bits (921),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 199/240 (83%), Gaps = 6/240 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFK+  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

 Score = 156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 122/196 (62%), Gaps = 9/196 (5%)

Query  397  TAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGI  456
            T G VM+ LI RNT +P KK++ ++T  D Q  V + ++EGER+    NN LG+F + GI
Sbjct  428  TVGRVMSVLIKRNTAIPIKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGI  487

Query  457  PPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEK  516
                RG PQ+ VTF+IDANGILNVSA++K T  + + TI N+ GRL+Q DIDRMV++AEK
Sbjct  488  ERAKRGEPQVQVTFEIDANGILNVSALDKKTNAKAETTINNNNGRLTQEDIDRMVADAEK  547

Query  517  YKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDAN  576
            +K +D     +IEA+N+LE++ Y         +  +   E    A E+ + E   WL+ +
Sbjct  548  FKKDDAEVLKKIEARNSLESFIY---------RALELTREKGDAAAENTIREAREWLEDH  598

Query  577  QSAEKEEYEGKQKELE  592
            + A   E E K++ LE
Sbjct  599  EDATLRELEEKKRVLE  614

>PHYKE_2977
Length=220

 Score = 341 bits (874),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 207/220 (94%), Positives = 212/220 (96%), Gaps = 8/220 (4%)

Query  434  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  493
            VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI
Sbjct  1    VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  60

Query  494  TITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQ  553
            TITNDKGRLSQADIDRMV+EAEKYKSEDEANK+RIEAKNALENYAYNLRNTLNDEKLKDQ
Sbjct  61   TITNDKGRLSQADIDRMVAEAEKYKSEDEANKIRIEAKNALENYAYNLRNTLNDEKLKDQ  120

Query  554  ISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANPILQKMYaaaggapgae  613
            I+EDDKKAI+DKVTETINWLDANQSAEKEE+EGKQKELEGVANPILQKMYAAAGGAPGAE
Sbjct  121  ITEDDKKAIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMYAAAGGAPGAE  180

Query  614  --------ggmpggmpggmpgagappagapDQGPKIEEVD  645
                    GGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD
Sbjct  181  GGMPGGMPGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  220

>CCI47582
Length=582

 Score = 349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 204/553 (37%), Positives = 313/553 (57%), Gaps = 32/553 (6%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHADN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFK--GESKTFQPEEISSM  126
             VF  +RL+G+K+ +      +  W FK+     D+ Q     K  GE       E  ++
Sbjct  63   IVFHLRRLLGKKYEEIAENPHVNEWFFKVEKDGKDEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            +L  ++ +A+ + G  +  AV+T   +  D Q+Q    A   A L+++  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVLTTSIHCTDRQQQLLTQAAKEAQLDIMSYLPDPIAAAIA  182

Query  187  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  236
            YG D       KK  +     +L+ D+GG T  ++LLS+++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPNNYKKANQCQADLILVVDIGGATTAITLLSVDKGLFEIVADGGHEGRGGEDL  242

Query  237  DNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
               +VDH  Q F RK + DI +N++A+ RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAQSFLRKTKVDIHKNRKAMIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  297  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP---------  347
            +  ++R RFE++   + R   E ++KVL +A   K  V  ++LVGGS RIP         
Sbjct  303  SMKLSRPRFEELIQKHVRFIFEEIDKVLVNADTEKENVDHIILVGGSCRIPLIQEKIQSY  362

Query  348  -KEPNK--SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGV---  401
             K+ N    ++PDE VA GAT++AA L          D L   V   ++ L  + G+   
Sbjct  363  FKDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLDQHVNVNAVPLSLSVGLVHG  422

Query  402  -MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  460
             + TLI R+  +P K ++TF+T+ DNQ  VLI+++EGER++   N LL +  + GI P+P
Sbjct  423  NVHTLIHRDAILPAKMTETFTTWEDNQTEVLIEIYEGERAIAEKNTLLARMCVSGIAPLP  482

Query  461  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKIT-ITNDKGRLS-QADIDRMVSEAEKYK  518
            +G  +I +   + + G+L V A     G+E KI  I  D+ RL+ +  +D++V  A    
Sbjct  483  KGEAEIILQVQVSSKGVLTVKA--SMNGEEKKILEIHTDEARLADKKQLDQIVEAANDAI  540

Query  519  SEDEANKVRIEAK  531
             ED+     IE K
Sbjct  541  DEDDTFLTEIENK  553

>PYIW_19165
Length=1124

 Score = 360 bits (923),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 192/516 (37%), Positives = 302/516 (59%), Gaps = 38/516 (7%)

Query  11    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
             GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  585   GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLTSHAENTI  644

Query  71    FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
             F  KR++G+   + + +  I+ W FK+               G++    P E  S+++  
Sbjct  645   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSDDGAVHAATSRNGDAHHVTPVEFVSLLIKN  704

Query  131   MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
             ++++AE F G+ V + V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  705   LKDLAEDFTGETVDDVVLSIPAHATEKQKELLQAAADKAGVNVLTFISEPIAAAIAYGLD  764

Query  191   ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
                K     +VL+FD+GG T DV+L++ ++G+FE+ AT+G   LGGEDF   L +H  + 
Sbjct  765   DSAKGSHPESVLVFDIGGATHDVTLINADQGLFEIVATSGKDDLGGEDFTKALFEHCAKT  824

Query  248   FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
             F+RK   D+ +N++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  825   FQRKTTLDVKKNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  884

Query  308   MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
             +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP            K  +  ++
Sbjct  885   LIYDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVMKHFDGKTTHLHLS  944

Query  356   PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  415
             PDE VA+GAT++A++ +                       E+    +  +   N T P  
Sbjct  945   PDEVVAHGATIEASLRAD------------------IANFESPKKPLNHV---NVT-PLT  982

Query  416   KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  475
              S   +  +DNQ  + +QV+EGER M +DN LL   ++ GI   P+   +I+VTF +   
Sbjct  983   LSVALANGSDNQTAIFLQVYEGERVMAKDNTLLASLSVTGIAAAPKSEAEIEVTFTVSTK  1042

Query  476   GILNVSAVEKSTGKENKITITNDKGRLSQADIDRMV  511
             G+L+++AVE++ G +  + + +D  RL+ AD+  ++
Sbjct  1043  GVLSITAVEQAAGTKT-LEVKSDPKRLTAADVAAII  1077

>CCA20229
Length=583

 Score = 343 bits (879),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 203/553 (37%), Positives = 308/553 (56%), Gaps = 32/553 (6%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHAEN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFK--GESKTFQPEEISSM  126
             VF   RL+G+   +    A +  W FK+   + ++ Q     K  GE       E  ++
Sbjct  63   IVFHLGRLLGKSHEEVAENAHVNEWFFKVEKDSKNEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            +L  ++ +A+ + G  +  AVI+   +    Q+Q    A   A LNV+  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVISTSIHCTTEQKQVLAQAAKDAELNVMSYLPDPIAAAIA  182

Query  187  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  236
            YG D       KK  +     +L+ D+GG T  V+LL++++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPKNYKKANQSTAQLILVVDIGGATTAVTLLNVDKGLFEIVADGGSEFRGGEDL  242

Query  237  DNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
               +VDH  + F RK +  I  N++A  RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAKSFLRKTKVAIQNNRKATIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  297  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK----  352
            +  ++R RFE++  D+ R   E ++ VL  A + K  V  V+LVGGS RIP    K    
Sbjct  303  SMKLSRPRFEELIQDHVRFIFEEIDAVLEKADVDKENVDHVILVGGSCRIPLIQEKIQTY  362

Query  353  --------SINPDEAVAYGATVQAA----ILSGNdsseklqdlllldvtplslglETAGG  400
                     ++PDE VA GAT++AA    +L      + L+    ++  PLSL +  A G
Sbjct  363  FGDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLEQHANVNAVPLSLSVGLAHG  422

Query  401  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  460
             + TLI R+  +P K  +TF+T+ DNQ   LI+++EGER++   N LL +  + GI P+P
Sbjct  423  NVHTLIHRDVVLPAKMMETFTTWEDNQTEALIEIYEGERAIAEKNTLLAQMCISGITPLP  482

Query  461  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKIT-ITNDKGRLSQA-DIDRMVSEAEKYK  518
            +G  +I +   + + G+L V A+    G+E K+  I  D+ RL+ A  +D +V  A    
Sbjct  483  KGEAEIIIELQVSSQGLLTVRAI--LNGEEKKMLEIHTDQARLADAKKLDHIVEAANAAM  540

Query  519  SEDEANKVRIEAK  531
             ED+     IE K
Sbjct  541  DEDDTFLTEIENK  553

>PYAR_24687
Length=618

 Score = 329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 205/547 (37%), Positives = 309/547 (56%), Gaps = 26/547 (5%)

Query  2    AQSVSGYSVGIDLGTTYSCVGVWQND--RVEIIANDQGNRTTPSYVAFTDT--ERLIGDA  57
            +Q  + + + ID GT+ +   V +N   +VEII ND+G+  TP+YV +     E ++G  
Sbjct  32   SQDSAHHMIAIDFGTSNTRAAVVRNTTGQVEIIPNDKGHSATPTYVTWDSVTGEVIVGRD  91

Query  58   AKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT  117
            AK Q  +   NT FD K+L+GR F    VQ+ I   P+ +     +KP I V+ KGE++ 
Sbjct  92   AKQQALLQPKNTAFDFKQLLGRSFDSKEVQSAIAQLPYTIID-RDNKPFIQVEMKGETRE  150

Query  118  FQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  177
            F  EE+++MVL +M++ AEA++G+E++NAV+TVPA F D+QR+A K A A+AGL   R++
Sbjct  151  FSVEEVTAMVLTRMKQFAEAYLGEEIENAVVTVPASFEDAQREAMKAACAMAGLTTRRVL  210

Query  178  NEPTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  236
            NEPTAA + +G+  K   ER VL+    GG  D +LL I+EGI EV  T   +H  G++ 
Sbjct  211  NEPTAATMGFGIKPKTQHERKVLVVHFDGGALDATLLEIDEGIVEVLVT--KSHRIGDEV  268

Query  237  DNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
              R++DH   ++K     DI+ + R L+RLR   ER +  LS   +A + I+S       
Sbjct  269  TQRVMDHCISQWKYDKHVDISTDPRMLQRLRLEAERVQHALSEQTEAVVTIESSSGSAVL  328

Query  297  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK--------  348
              + +RA  E M  D     +E VE  L +  ++K +V  +V  GG++RIP         
Sbjct  329  TQSFSRATLETMTRDLAEPLVEIVEIALMNGGVAKQEVDGIVFAGGASRIPMLRQLMVER  388

Query  349  ----EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  404
                E    ++ +E V +GA   A I+ G  + +   +L +L     SLG+ETAGGVM  
Sbjct  389  FGWIELQCDVDEEEVVVHGAAAIADIIHGQ-AVDATAELNILPWIVNSLGVETAGGVMLP  447

Query  405  LIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVP  464
            +++R+   PT+ +QT ST   NQ  + I+VFEGER +T+DN+ +G+  L G+ P P+GVP
Sbjct  448  VLSRHRLTPTRATQTVSTLHANQLDITIRVFEGERLLTKDNHFIGQLRLSGLAPAPQGVP  507

Query  465  QIDVTFDIDANG-ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEA-EKYKSEDE  522
            +I+V F+ DA G  L  +A  + T   + +TI   K        D  V +A E  K ED 
Sbjct  508  RIEVEFETDAMGETLFATARVEGTNLADSLTIQVAKHAFEH---DEAVRKAGEDAKDEDT  564

Query  523  ANKVRIE  529
              K RIE
Sbjct  565  KVKARIE  571

>PITG_15111
Length=186

 Score = 314 bits (804),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 161/169 (95%), Gaps = 0/169 (0%)

Query  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  7    PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR  66

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            LV+ F  EFKRKHRKD+T NQRALRRLRTACERAKRTL +SAQAYIEIDSL+DG+DFNST
Sbjct  67   LVEFFVTEFKRKHRKDMTSNQRALRRLRTACERAKRTLFTSAQAYIEIDSLYDGVDFNST  126

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  348
            ITRARFED+C DYFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIPK
Sbjct  127  ITRARFEDLCSDYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPK  175

>PYIW_17145
Length=443

 Score = 315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 186/395 (47%), Positives = 244/395 (62%), Gaps = 28/395 (7%)

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  1    MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEF  59

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  60   KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  117

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPN  351
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PK           +P+
Sbjct  118  ATFEKLVNHLIERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTTVEDFFGKKPS  177

Query  352  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  411
            K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT
Sbjct  178  KGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLITRNTT  232

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  471
            +PTKKSQ FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI+V+FD
Sbjct  233  IPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSFD  292

Query  472  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
            IDANGI+NV+A +K+TGKE  I I +  G LS ++I+RMV EAE     D   K  IEAK
Sbjct  293  IDANGIVNVAARDKATGKEQNIVIQSSGG-LSDSEIERMVQEAEMNAEADLKRKELIEAK  351

Query  532  NALENYAYNLRNTL--NDEKLKDQISEDDKKAIED  564
            N  ++ AY    TL  ++EKL  +  E  K  +E+
Sbjct  352  NEADSVAYTTEKTLKEHEEKLDKETVEAVKAGLEN  386

>PHALS_12790
Length=214

 Score = 300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)

Query  441  MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  500
            MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  501  RLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKK  560
            RLSQADIDRMVSEAEKYKSEDEANKVRIEAKN LENYAYNLRNTLNDEKLK Q+S+DDKK
Sbjct  61   RLSQADIDRMVSEAEKYKSEDEANKVRIEAKNGLENYAYNLRNTLNDEKLKGQLSDDDKK  120

Query  561  AIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANPILQKMY  603
            AI+DKVTETINWLDANQSAEKEE+EGKQKELEGVANPILQKMY
Sbjct  121  AIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMY  163

>PHYSO_549561
Length=361

 Score = 305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 244/366 (67%), Gaps = 23/366 (6%)

Query  240  LVDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298
            +V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+S
Sbjct  1    MVEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSS  60

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK----------  348
            T+TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPK          
Sbjct  61   TVTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFG  120

Query  349  --EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  406
              E +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI
Sbjct  121  GKELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLI  179

Query  407  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  466
             RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ+
Sbjct  180  KRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQV  239

Query  467  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKV  526
            +VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DIDRMV+EA+K+K +D     
Sbjct  240  EVTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLR  299

Query  527  RIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEG  586
            RIEA+N LE + Y         +  +   E     +E  + +  +WL+ ++ A   E E 
Sbjct  300  RIEARNDLEQFIY---------RAIEMAREKGDTNVESAIRDARDWLEDHEEATLRELED  350

Query  587  KQKELE  592
            K++ LE
Sbjct  351  KKRMLE  356

>PHYSO_493381
Length=562

 Score = 311 bits (797),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 208/505 (41%), Positives = 296/505 (59%), Gaps = 40/505 (8%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERL--IGDAA-KNQ  61
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  T +   +G+AA + +
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVRFEPTTQRADVGNAAVQLE  80

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQP  120
                  NTV   KRL+G+KF          +  +K+ S A     + V   G+ K   QP
Sbjct  81   TQEPVGNTVRSVKRLMGQKFESKAADVARIYATYKVVSTAQGNAAVQVARGGQKKVHVQP  140

Query  121  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            EE+S+ VL +++  AEA+    VK  N VITVPAYF+DSQR+AT  + ++AG   +R++N
Sbjct  141  EEVSACVLAELKASAEAYFDGSVKLDNVVITVPAYFSDSQRKATITSASMAGFKAVRLLN  200

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAA+AYGL   G  + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +N
Sbjct  201  EPTAAAMAYGLFLSG-TKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDINN  259

Query  239  RLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             LVDH  +   + H  D+   Q     + RL+   E+AK  LS+   A IE+  +     
Sbjct  260  ILVDHLLEVLYKHH--DVARAQVGEGDMVRLKREVEKAKIELSAEDYAEIELQGIAGVKT  317

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP--------  347
            F  T+ R +FE +C   ++K +  V  VL++A++    + EV+LVGGSTRIP        
Sbjct  318  FTYTLMRRKFEQLCDPIWKKCLRIVTSVLKEAEVEAVDIDEVILVGGSTRIPILRTKISE  377

Query  348  ----KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  403
                KE   S+N DE V  GA +QAAILSG       +D+L++D  PL +GLETA G M 
Sbjct  378  AFGGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDALPLPIGLETADGSME  436

Query  404  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  461
             ++ RN  +PT  ++ F T+ D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR  
Sbjct  437  VILPRNARIPTTVTKYFQTFEDDQLGLTVEVYEGEKEIAKENDHICYFNF----ALPRDK  492

Query  462  ----GVPQIDVTFDIDANGILNVSA  482
                G     VTF ++A+GIL V A
Sbjct  493  IGKAGEFAHPVTFTMNASGILQVQA  517

>PITG_16528
Length=561

 Score = 310 bits (795),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 209/505 (41%), Positives = 295/505 (58%), Gaps = 41/505 (8%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTER--LIGDAAKN-Q  61
             +GIDLGTT SCVG+W  DR  V+I  N  D+G RTTPS V F    +   +G+ A   +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKIFKNHLDRG-RTTPSVVRFDPKSQSVAVGNVAVGLE  80

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQP  120
             +    NT+   KRL+G+KF    V     +  +++   A     + V  +G+ K   QP
Sbjct  81   TSEPVENTIRSVKRLMGQKFDSKAVDVARIYASYEVAPTAQGNVAVQV-VRGQKKVQVQP  139

Query  121  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            EE+S+ VL +++  A+A+     K  N VITVPAYF+D+QR+AT  + ++AG   +R++N
Sbjct  140  EEVSACVLRELKASADAYFDGHTKLDNVVITVPAYFSDTQRKATIASASMAGFKAVRLLN  199

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAA+AYGL    G + V +FD GGGT DVSLLSIE+G FEV    GDT+LGGED +N
Sbjct  200  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIEDGKFEVLGIGGDTNLGGEDINN  258

Query  239  RLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             L+DH      R+H  ++T  Q     + RL+   E+AK  LS    A I +  + D   
Sbjct  259  TLLDHVLDVLYRRH--NVTRAQVGQADMVRLKREVEKAKIELSEQEDAEISVHDIADVST  316

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP--------  347
            F  T+TR +FE +C   ++K +  V  VLRDA++  S + EV+LVGGSTRIP        
Sbjct  317  FTYTLTRRKFEQLCDAIWKKCLRIVSSVLRDAEVEPSDIDEVILVGGSTRIPVLRTKISE  376

Query  348  ----KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  403
                KE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  377  AFNGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSME  435

Query  404  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  461
             ++ RN  +PT  ++ F TY D Q G+ ++V+EGE+ + ++N+ +  FN      +PR  
Sbjct  436  VILLRNARIPTTVTKYFQTYEDEQRGLTVEVYEGEKEVAKENDHICYFNF----ALPRDK  491

Query  462  ----GVPQIDVTFDIDANGILNVSA  482
                G     VTF ++A+GIL V A
Sbjct  492  VGKAGEFAHPVTFTMNASGILQVQA  516

>PHYRA_79054
Length=563

 Score = 307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 202/506 (40%), Positives = 295/506 (58%), Gaps = 42/506 (8%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F D      D     VA+
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRSDRG-RTTPSVVRF-DPSSQAADVGNAAVAL  79

Query  65   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQ  119
                   NT+   KRL+G+KF          +  +++   A     + V   G+     Q
Sbjct  80   ETCEPLGNTIRSVKRLMGQKFDSKAADVARIYAGYRVLPTAQGNVAVQVLRGGKRDIQVQ  139

Query  120  PEEISSMVLIKMREVAEAFI--GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  177
            PEE+S+ VLI+++  AEA+   G+ ++N VITVPAYF+DSQR+AT  + ++AG   +R++
Sbjct  140  PEEVSACVLIELKASAEAYFEDGRRLENVVITVPAYFSDSQRKATITSASMAGFKAVRLL  199

Query  178  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  200  NEPTAAAMAYGL-FLSGRKVVTVFDFGGGTLDVSLLSIDDGKFEVLGIGGDTNLGGEDIN  258

Query  238  NRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  294
            N L DH  +   + H  D+T  Q     + RL+   E+AK  LS+   A + +  +    
Sbjct  259  NTLCDHLLEVLYKHH--DVTRAQVGDVDMVRLKREVEKAKIELSTEEYADVTVHGIAGVK  316

Query  295  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP-------  347
             F  ++ R++FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP       
Sbjct  317  TFTYSLLRSKFEQLCDPIWKKCLRIVSSVLKEAEMEAADIDEVILVGGSTRIPILRTKIS  376

Query  348  -----KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  402
                 KE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M
Sbjct  377  EAFNGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSM  435

Query  403  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-  461
              ++ RN  +PT  ++ F T+ D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR 
Sbjct  436  EVILPRNARIPTTVTKNFQTFEDDQRGLTVEVYEGEKDIAKENDHICYFNF----ALPRD  491

Query  462  -----GVPQIDVTFDIDANGILNVSA  482
                 G     VTF ++A+GIL V A
Sbjct  492  KIGKAGEFAHPVTFTMNASGILQVQA  517

>PHYCA_6458
Length=560

 Score = 303 bits (776),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 206/508 (41%), Positives = 295/508 (58%), Gaps = 47/508 (9%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLI--GDAAKN-Q  61
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + +  G+ A   +
Sbjct  21   CLGIDLGTTNSCVGMWHVDRHHVKILKNRLDRG-RTTPSVVRFNPQSQSVDVGNVAIGLE  79

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQ---FKGESKT-  117
             +    NT+   KRL+G+KF+         +  +++       PQ  V     +G+ K  
Sbjct  80   TSEPVGNTIRSVKRLMGQKFASKATDVARIYASYEVAP----TPQGNVAAQVVRGQKKVQ  135

Query  118  FQPEEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLR  175
             QPEE+S+ +L +++  AE +   +VK  N VITVPAYF+DSQR+AT  A ++AG   +R
Sbjct  136  VQPEEVSACILTELKASAEGYFDGQVKLDNVVITVPAYFSDSQRKATITAASMAGFKAVR  195

Query  176  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGED  235
            ++NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED
Sbjct  196  LLNEPTAAAMAYGL-FLSGTKMVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGED  254

Query  236  FDNRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFD  292
             +N LVDH  +   + H+  +T  Q     + RL+ A E+AK  LS      I +  +  
Sbjct  255  INNVLVDHLLEVLYKHHK--VTRAQVGEADMVRLKRAVEKAKIELSEEEDVEITVHDIAG  312

Query  293  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP-----  347
               F  T+TR +FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP     
Sbjct  313  VEKFAFTLTRRKFEQLCDPIWKKCLRIVSSVLKEAQVEAADIDEVILVGGSTRIPILRTK  372

Query  348  -------KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  400
                   KE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G
Sbjct  373  ISDAFNGKELCLSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETADG  431

Query  401  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  460
             M  ++ RN  +PT  ++ F TY D Q G+ ++V+EGE+   ++N+ +  FN      +P
Sbjct  432  TMEVILPRNARIPTTVTKYFQTYEDGQRGLTVEVYEGEKENAKENDHICYFNF----ALP  487

Query  461  R------GVPQIDVTFDIDANGILNVSA  482
            R      G     VTF ++A+GIL V A
Sbjct  488  RDKIGKAGEFAHPVTFTMNASGILQVQA  515

>PYAR_14579
Length=567

 Score = 303 bits (777),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 202/507 (40%), Positives = 299/507 (59%), Gaps = 40/507 (8%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTERLIGDAAKNQV  62
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  +  E L+G+AA  + 
Sbjct  22   CIGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVHFLPSSHEVLVGNAAIARE  80

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESK-TFQPE  121
                 NTV   KRL+G++F    VQ   K     + + A     + VQ  G+     QPE
Sbjct  81   YEPPGNTVRAIKRLMGQRFDSRAVQLASKFATHSIVATAQGNAAVQVQRGGDGVIAVQPE  140

Query  122  EISSMVLIKMREVAEAFI----GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  177
            EI++ VL +++  AEA+      K + N VITVPAYFNDSQR+AT  +  +AG   +R++
Sbjct  141  EIAAEVLRELKASAEAYWEQTHSKRIDNVVITVPAYFNDSQRKATILSAQMAGFKAVRLL  200

Query  178  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            NEPTAAA+AYGL    GE++V++ D GGGT DVSLL+I +G F+V    GDT+LGGED +
Sbjct  201  NEPTAAAMAYGL-FVSGEKHVVVVDFGGGTLDVSLLAIHDGKFQVLGIGGDTNLGGEDIN  259

Query  238  NRLVDHFTQEFKRKHRKDITENQRA-LRRLRTACERAKRTLSSSAQAYIEIDS---LFDG  293
            + ++ H  +  +R+     +   R+ L +++   ERAK  LS+     +E+ +   L   
Sbjct  260  DLVMAHVLENLQRQRSVPRSALSRSDLIQIKREVERAKVALSTDESVELELPNLGPLAKQ  319

Query  294  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------  347
              F   +TR +FE +CG  + + ++ VE VLR+A +   ++ EV++VGGSTRIP      
Sbjct  320  KPFTLVLTRTKFESLCGSIWTRCLDIVEDVLREAGVETHEIDEVIMVGGSTRIPIVRSKV  379

Query  348  ------KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGV  401
                  KE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLE A G 
Sbjct  380  SAFFHDKELCVSVNADEVVCEGAAIQAAILSG-IDKRVFRDVLMMDVIPLPIGLEKADGR  438

Query  402  MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR  461
            M  L+A+N+ +P   ++ F T+ D Q G+ +QV+EGE+ M ++N+ +  F+     P+PR
Sbjct  439  MEVLLAKNSRIPVSVTKYFETFEDGQRGLTVQVYEGEKEMAKENDHISDFSF----PLPR  494

Query  462  ------GVPQIDVTFDIDANGILNVSA  482
                  G  +  VT  ++A+G+L V A
Sbjct  495  DKIGKAGEFRHPVTLTMNASGVLQVQA  521

>PPTG_05819
Length=561

 Score = 301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 203/506 (40%), Positives = 295/506 (58%), Gaps = 43/506 (8%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + + D     V +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKILKNSLDRG-RTTPSVVRFDPKSQSV-DVGNVAVGL  79

Query  65   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQ  119
                   NT+   KRL+G++F +  V     +  +++   A     + V  +G  K   Q
Sbjct  80   ETSEPVGNTIRSVKRLMGQRFENKAVDVARIYASYEVAPTAQGNVAVQV-VRGHKKVQVQ  138

Query  120  PEEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  177
            PEE+S+ VL +++  AEA+   + K  N VITVPAYF+D+QR+AT  + ++AG   +R++
Sbjct  139  PEEVSACVLRELKASAEAYFDGQTKLDNVVITVPAYFSDAQRRATITSASMAGFKAVRLL  198

Query  178  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  199  NEPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDIN  257

Query  238  NRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  294
            N L+DH      ++H  ++T  Q     + R++   E+AK  LS    A I +  +    
Sbjct  258  NTLLDHLLDVLYKRH--NVTRAQVEQGDMVRVKREVEKAKIELSEQESADITVYEIAGVS  315

Query  295  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP-------  347
             F  T+TR +FE +C   ++K +  V  VL+ A++  + + EV+LVGGSTRIP       
Sbjct  316  TFKYTLTRRKFEQLCDPIWKKCLRIVASVLKHAEVDAADIDEVILVGGSTRIPVLRTKIS  375

Query  348  -----KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  402
                 KE  KS+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M
Sbjct  376  EAFNGKELCKSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGTM  434

Query  403  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-  461
              ++ RN  +PT  ++ F TY D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR 
Sbjct  435  EVILPRNARIPTTVTKYFQTYEDDQRGLTVEVYEGEKEIAKENDHICYFNF----ALPRD  490

Query  462  -----GVPQIDVTFDIDANGILNVSA  482
                 G     VTF ++A+GIL V A
Sbjct  491  KIGKAGEFAHPVTFTMNASGILQVQA  516

>PYU1_G002895
Length=561

 Score = 301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 204/505 (40%), Positives = 297/505 (59%), Gaps = 38/505 (8%)

Query  7    GYSVGIDLGTTYSCVGVWQNDR--VEII--ANDQGNRTTPSYVAF---TDTERLIGDAAK  59
            G  +GIDLGTT SC+G+W  +R  V+I+  A D+  RTTPS V F   ++    +G AA 
Sbjct  21   GLCIGIDLGTTNSCIGMWHVERNHVKILKSAKDR-KRTTPSVVRFDPASEHAYEVGHAAI  79

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
             Q      NTV   KRL+G+K++   V+       + + S       + V    +    Q
Sbjct  80   AQETQPVGNTVRSIKRLMGQKYASKAVEVAKSFGTYTVASTKQGNAAVQVVRNEKPALLQ  139

Query  120  PEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            PEE+S+ +L  ++  AEA+  GK + N VITVPAYF+DSQR+AT  + ++AG  V+R++N
Sbjct  140  PEEVSACILSDLKASAEAYFDGKRIDNVVITVPAYFSDSQRKATITSASMAGFKVIRLMN  199

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAA+AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N
Sbjct  200  EPTAAAMAYGL-FVAGTKIVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNN  258

Query  239  RLVDHFTQEFKRKH---RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             ++DH ++   + H   R  +T N   + +L+T  ERAK  LS+   A I +  +     
Sbjct  259  VIIDHLSELLHKHHDVARSRLTMND--MIQLKTQAERAKIELSNEDTAKIRLRDVAGIPA  316

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP--------  347
            F  T+TR +FE +C   ++K +  V  VL++A++  + V EVV+VGGSTRIP        
Sbjct  317  FEYTLTRHKFEQLCESIWKKCLRIVSSVLKEAEVEVADVDEVVMVGGSTRIPILRSKISD  376

Query  348  ----KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  403
                KE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  377  FFNGKELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETADGRME  435

Query  404  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  461
             +I +N  +P   ++ F T+ DNQ G+ I+V+EGE  + ++N+ +  FN      +PR  
Sbjct  436  VIIPKNARIPVSLTKYFQTFEDNQRGLTIEVYEGENEVAKENDHICYFNFT----LPRDK  491

Query  462  ----GVPQIDVTFDIDANGILNVSA  482
                G     VTF ++A+G+L V A
Sbjct  492  VGKAGEFAHPVTFTMNASGVLQVQA  516

>SDRG_17122
Length=361

 Score = 288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 231/370 (62%), Gaps = 32/370 (9%)

Query  75   RLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREV  134
            R+IGR++ +    A +         G+ + P I V  KG++K   PEE+ + +++K+++ 
Sbjct  2    RIIGRRYDEVRKTAQV-------VRGSMNNPIIRVIEKGDAKELHPEEVLAELVVKLKDD  54

Query  135  AEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY----GLD  190
              A+    +++A++TVP  FN  QRQA +DA AIAGL   RI +  T AA+ +    G+ 
Sbjct  55   VAAYTNARIEHAIVTVPTGFNLLQRQAVRDACAIAGLTNYRIKDVSTTAAVGHTSIKGMP  114

Query  191  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  250
            ++ G    ++ DLGGG   V LL IE GIFEV+A AG T LGGEDFD+ L DHF  EF R
Sbjct  115  RREGHD--MVVDLGGGHLSVPLLMIENGIFEVEAVAGITCLGGEDFDDHLYDHFVAEFSR  172

Query  251  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  310
            KHRKD+T   RA+RRLRTACE+ KR LS S  A +E++ LF  IDF S+ITRARFE +C 
Sbjct  173  KHRKDMTTCNRAVRRLRTACEKVKRDLSVSNTATLELEMLFGDIDFCSSITRARFEALCS  232

Query  311  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKE-----------------PNKS  353
            + F K  + +EKVLRDAK++KSQV +VVL GGS R+PK                   +  
Sbjct  233  ELFSKVTKLIEKVLRDAKINKSQVRDVVLAGGSMRMPKMQQLLSTFFGGANVDKKLCHSI  292

Query  354  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  413
            +N +EA A+GATV AA + G   +      L+LD    S+G+ET GGV+T+LI+RNTT+P
Sbjct  293  LNNNEAAAHGATVMAAAVYGE--TWPDSRFLVLDAVSDSVGIETDGGVLTSLISRNTTIP  350

Query  414  TKKSQTFSTY  423
             KKS+ F  +
Sbjct  351  AKKSKKFEIF  360

>PHALS_02692
Length=557

 Score = 293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 199/505 (39%), Positives = 292/505 (58%), Gaps = 41/505 (8%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAFTDTERLI--GDAAKN-QV  62
             +GIDLGTT SCVG+W  DR  V+I  N     RTTPS V F  T + +  G AA + + 
Sbjct  18   CLGIDLGTTNSCVGMWYVDRNHVKIFKNRLNRGRTTPSVVHFDPTSQSVDVGQAAIDLET  77

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQF-KGESKT-FQP  120
            +    NT+   KRL+G+K+          +  +++   A  +  + VQ  +G  K   QP
Sbjct  78   SEPVGNTIRSIKRLMGQKYESKATDVARIYASYEVAPTA--QKNVAVQLVRGHKKVQVQP  135

Query  121  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            EE+S+ +L +++  AEA+   + +  N VITVPAYF+D+QR+AT  +  +AG   +R++N
Sbjct  136  EEVSAYILTELKTSAEAYFDGQTRLNNVVITVPAYFSDAQRKATITSALMAGFKAVRLLN  195

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAA+AYGL    G + V +FD GGGT DVSLL I++G FEV    GDT+LGGED +N
Sbjct  196  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLRIQDGKFEVLGIGGDTNLGGEDINN  254

Query  239  RLVDHFTQEFKRKH---RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             ++DH  +   ++H   R  +T     L RL+   E+ K  LS    A + +  L     
Sbjct  255  LVLDHVLEVLNKRHNVIRSQVTGAD--LVRLKQEVEKLKIQLSVEESADVIVRDLAGVPR  312

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP--------  347
               T+TR +FE +C   ++K +  +  VL++A++  + + EV+LVGGSTRIP        
Sbjct  313  VTVTLTRRKFEQLCDPIWKKCLRIMSSVLKEAQVDAADMDEVILVGGSTRIPCLRSKISK  372

Query  348  ----KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  403
                KE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  373  AFHGKELCMSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETADGTME  431

Query  404  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  461
             ++ RN  +PT  ++ F+TY DNQ G+ I+V+EGE+ + ++N+ +  FN      +PR  
Sbjct  432  VILPRNARIPTTVTKYFTTYEDNQRGITIEVYEGEKDIAKENDHICYFNF----ALPRNK  487

Query  462  ----GVPQIDVTFDIDANGILNVSA  482
                G     VTF ++A+GIL V A
Sbjct  488  IGKAGEYSHPVTFTMNASGILQVQA  512

>H310_03911
Length=570

 Score = 294 bits (752),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 200/516 (39%), Positives = 294/516 (57%), Gaps = 38/516 (7%)

Query  9    SVGIDLGTTYSCVGVWQNDR-----VEIIANDQGNRTTPSYVAFT-DTERLIG-DAAKNQ  61
             +GIDLGTT SCVG W+        V  +  D  ++T PS V+F       +G DA +++
Sbjct  21   CIGIDLGTTNSCVGYWKEGANFAKIVNHVGKDGKHKTVPSVVSFPPQGNPFVGFDAVEHE  80

Query  62   VAMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
              +     T+  AKRL+G+  ++  V  + K+  + L     D   + +    +     P
Sbjct  81   QKLEPDTVTIRSAKRLMGKTLAE--VGDEQKYLSYSLCD---DGDHVAIDLPSKKTVVAP  135

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
             E+S+++L  +++  E  +G +V N V+TVPA+FN+SQRQAT  A A+AG   +R++NEP
Sbjct  136  SEVSAILLKYIKDTTEEKLGHQVVNCVLTVPAHFNESQRQATLKAAAMAGFQGIRLLNEP  195

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    G+THLGGED ++ L
Sbjct  196  TAAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGKFAVDGVGGNTHLGGEDINHVL  254

Query  241  VDHFTQEFKRKH-RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
             D+  +  + ++    +T ++ A+ +L+ A E AK TLSS  +  I +D +         
Sbjct  255  YDYMLESIQNQNGGTPLTLDRTAIIQLQQAAEHAKVTLSSQKEVSIYLDDIGGVKSHKLK  314

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +TR++FE +C     + ++    VL    L+ + + EVVLVGGSTRIP            
Sbjct  315  LTRSKFESLCDPLLTRCIDITLNVLASIDLTPNDIDEVVLVGGSTRIPALRNKLSALFNG  374

Query  348  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  407
            KE   S+N DE VA GA +QAAILSG  +   LQD+L+LDV PLS+G+E A G M  LI 
Sbjct  375  KEMCTSMNADEVVASGAAIQAAILSG-VNKRVLQDVLMLDVIPLSIGIEKADGTMEVLIP  433

Query  408  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------  461
            +N+ +P   ++ F T  D+Q G+ ++VFEGE+ + RDN  L  FN      +PR      
Sbjct  434  KNSRIPIAVTKHFETLDDDQRGITVEVFEGEKPVARDNVFLTYFNF----TLPRHKAGKA  489

Query  462  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  497
            G  Q  VT  +DANGIL V A  +    +N++ I+N
Sbjct  490  GEFQHAVTLSMDANGILQVKAGAQHDIDDNEVAISN  525

>SPRG_01255
Length=566

 Score = 292 bits (747),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 197/500 (39%), Positives = 284/500 (57%), Gaps = 36/500 (7%)

Query  9    SVGIDLGTTYSCVGVW--QNDRVEII---ANDQGNRTTPSYVAFTDT-ERLIGDAAKNQV  62
             +GIDLGTT SCVG W    + V+I+   A D   +T PS V+F  T    +G AA    
Sbjct  24   CIGIDLGTTNSCVGYWKLHANHVKIVNHSAGDTKAKTLPSVVSFPPTGAPAVGFAAVAAE  83

Query  63   AMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  121
            A +A   TV  AKRL+G+  +D     D K+  + L  G  +   +++       +  P 
Sbjct  84   ASDADVVTVRSAKRLLGQSLAD--ASPDQKYLSYTLCDG--ESGHVSIALPARKTSVTPS  139

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            E+++++L K++  AEA + + + N V+TVPAYF + QRQAT +A A+AG + +R++NEPT
Sbjct  140  EVAALLLSKLKAAAEAKLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPT  199

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAA+AYGL   G +R V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N L 
Sbjct  200  AAAMAYGLFVAGTKR-VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNILF  258

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            DH  Q   +KH    +      + +L+ A E AK  LS+  +  + + ++        T+
Sbjct  259  DHVLQAIAKKHGPVSLPLATHDMVQLQRAVEAAKVALSTDDETVLRLTNVGHVALHEMTL  318

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TR + + +C   ++K +    +VL+   +  S V EVVLVGGSTRIP            K
Sbjct  319  TRRKLDALCDPLYKKCLRITREVLKSIDVDPSDVDEVVLVGGSTRIPAIRARLRAFFNDK  378

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E   S+N DE VA GA +QAAILSG    +  QD+L+LDV P+S+G+E A G M  LI +
Sbjct  379  ELCTSVNADEVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIQK  437

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------G  462
            N+ +P   ++ F T  D+Q G  I+VFEGE  + R+N  L  F+      +PR      G
Sbjct  438  NSRIPVSVTKYFDTAIDDQAGFTIEVFEGESPVARENTYLTYFDF----VLPRKVRGKAG  493

Query  463  VPQIDVTFDIDANGILNVSA  482
              Q  VT  ++ANG+L V A
Sbjct  494  AIQHPVTLSMNANGLLQVKA  513

>PYIW_17320
Length=563

 Score = 291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 194/498 (39%), Positives = 290/498 (58%), Gaps = 28/498 (6%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAF---TDTERLIGDAAKNQV  62
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS V F   ++    +G AA  Q 
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPSVVRFDPQSEHAYEVGHAAIAQE  82

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEE  122
                 NT+   KRL+G+K++   V+       + +T+       + V    ++   QPEE
Sbjct  83   TQPVGNTIRSVKRLMGQKYTSKAVEVAKSFGTYTITATKQGGAAVQVVRANKTAVVQPEE  142

Query  123  ISSMVLIKMREVAEAFIG-KEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            +++ +L  ++  AEA+   K + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPT
Sbjct  143  VAACILADLKASAEAYFDDKRIDNVVITVPAYFNDSQRKATLTSASMAGFKAVRLLNEPT  202

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAA+AYGL    G + V++FD GGGT DVSL+SI +G FEV    GDT+LGGED +N + 
Sbjct  203  AAAMAYGL-FVAGTKMVVVFDFGGGTLDVSLMSISDGRFEVLGIGGDTNLGGEDLNNAIT  261

Query  242  DHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            DH  +   + H     T   + + +L+T  E+AK  LSS     IE+  +     F  T+
Sbjct  262  DHLIELLHKHHDVSRATLTMQDMIQLKTQAEQAKIALSSDDSTEIELRDVAGIAKFKYTL  321

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348
            TR +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP            K
Sbjct  322  TRHKFEQLGEAIWKKCLRIVHSVLKEAEVEVADVDEVVMVGGSTRIPLLRTKVSDFFDGK  381

Query  349  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  408
            E   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLET  G M T+I +
Sbjct  382  ELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGRMETIIPK  440

Query  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR----GVP  464
            N+ +P   ++ F T+ DNQ G+ ++V+EGE  + ++N+ +  FN   + P  +    G  
Sbjct  441  NSRIPVSLTKYFQTFEDNQRGLTVEVYEGEHEVAKENDHICYFNF--VLPHDKVGKAGEF  498

Query  465  QIDVTFDIDANGILNVSA  482
               VTF ++A+G+L V A
Sbjct  499  AHPVTFTMNASGVLQVQA  516

>PYIR_13638
Length=543

 Score = 288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 189/499 (38%), Positives = 286/499 (57%), Gaps = 50/499 (10%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAFTDTERLIGDAAKNQVAMN  65
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS     +T  +            
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPS----VETAPV------------  66

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
              NT+   KRL+G+K++    +       +K+ +       + V    +  T +PEE+S+
Sbjct  67   -GNTIRSIKRLMGQKYTSKAAEVAKSFGTYKIAATKQGSAAVQVVRAQKLVTVEPEEVSA  125

Query  126  MVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             +L  ++  AE +   K + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPTAAA
Sbjct  126  CILSDLKASAEVYFDNKRIDNVVITVPAYFNDSQRKATITSASMAGFKAIRLMNEPTAAA  185

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N + DH 
Sbjct  186  MAYGL-FVAGTKMVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNNVITDHL  244

Query  245  TQEFKRKHRKDITENQRALR---RLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
             +   + H  D+   + ++    +L+T  E+AK  LSS   A IE+  +     F  T+T
Sbjct  245  IELLHKHH--DVPRAKLSMADMIQLKTQAEQAKIALSSDDSAEIELHDVAGVPKFKYTLT  302

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KE  349
            R +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP            KE
Sbjct  303  RHKFEQLGESIWKKCLRIVSSVLKEAEVEIADVDEVVMVGGSTRIPILRTKISEFFDGKE  362

Query  350  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  409
               S+N DE V  GA +QAAILSG       +D+L++DV PL +GLET  G M  +I +N
Sbjct  363  LCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGTMEVIIPKN  421

Query  410  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GV  463
            + +P   ++ F T+ DNQ G+ ++V+EGE+ + ++N+ +  FN      +PR      G 
Sbjct  422  SRIPVSLTKYFQTFEDNQRGLTVEVYEGEQKVAKENDHICYFNF----VLPRDKIGRAGE  477

Query  464  PQIDVTFDIDANGILNVSA  482
                VTF ++A+G+L V A
Sbjct  478  FAHPVTFTMNASGVLQVQA  496

>PHYRA_51904
Length=129

 Score = 271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/127 (100%), Positives = 127/127 (100%), Gaps = 0/127 (0%)

Query  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65
            SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
            AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS
Sbjct  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122

Query  126  MVLIKMR  132
            MVLIKMR
Sbjct  123  MVLIKMR  129

>CCI45261
Length=558

 Score = 285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 189/507 (37%), Positives = 299/507 (59%), Gaps = 47/507 (9%)

Query  9    SVGIDLGTTYSCVGVWQND--RVEIIANDQGNR---TTPSYVAFTDTERLIGDAAKNQVA  63
            ++GID GTT SCVG+W  D  RV+I+ +D   +     PS V +  T+  +    +  V 
Sbjct  24   AIGIDFGTTNSCVGIWLKDQSRVKILKHDFDTKRYYLLPSVVRYDPTDVSLVSVGQEAVR  83

Query  64   MNA----HNTVFDAKRLIGRKFSD---PIVQADIKHWPFKLTSGAGDKPQITVQFKGESK  116
            + A     NT+   KRL+G+++++     +Q+   H    +++  G+     +  K +  
Sbjct  84   LEATPPCKNTIRCVKRLMGQRYTNDRISYLQSSSTHQI--VSTKRGNVGICIITEKNDES  141

Query  117  TFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLR  175
              +PE++++ +L+K++  AEA+   K ++N V+TVPA+FND QR+AT  A ++AG   +R
Sbjct  142  IVEPEQVAACILLKLKAKAEAYFDHKIIENVVLTVPAHFNDGQRKATIRAASMAGFRKIR  201

Query  176  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGED  235
            ++NEPTAAA+AYGL    G + VL+FD GGGT DVSL+ I+EG F+V A  GDT+LGGED
Sbjct  202  LMNEPTAAAMAYGL-FIAGHKQVLVFDFGGGTLDVSLMRIDEGKFKVVAIGGDTNLGGED  260

Query  236  FDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             +  +  H    F+++    +T +Q+    ++ + E AK  LS S +A +E+      + 
Sbjct  261  INQIIYHHILCSFEKRGILKLTIDQQT--AMKQSIEEAKIQLSDSMEATVELKVATRLLQ  318

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP--------  347
            +N  + R  FE +C   +++ +  +EKVL+DA L    V EVV+VGGSTRIP        
Sbjct  319  YN--LRRDVFESICDSVWKRCISTIEKVLKDASLEPCDVDEVVMVGGSTRIPKLRSSISE  376

Query  348  ----KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  403
                KE   S+N D  V  GA +QAA+LSG    + LQD+L+LDV PLS+GLET  G M 
Sbjct  377  FFDKKELCDSVNADRVVCEGAAIQAAVLSG-MDRKTLQDVLMLDVIPLSMGLETVDGRME  435

Query  404  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGV  463
             ++++N+ +P + ++ F T+ D+Q G+ + V+EGE S+ R+N  + +F+     P+P   
Sbjct  436  IILSKNSQIPAEVTKYFQTFEDDQRGISVDVYEGENSIARENEHICRFDF----PIPS--  489

Query  464  PQID--------VTFDIDANGILNVSA  482
             +ID        VTF ++ NG+L VSA
Sbjct  490  LKIDKAGRIFHPVTFKMNENGVLQVSA  516

>H257_01680
Length=571

 Score = 278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 194/518 (37%), Positives = 285/518 (55%), Gaps = 41/518 (8%)

Query  9    SVGIDLGTTYSCVGVWQN--DRVEII---ANDQGNRTTPSYVAF-TDTERLIG-DAAKNQ  61
             +GIDLGTT SCVG W+   +  +II   A D  ++T PS V+F +     +G DA +++
Sbjct  21   CIGIDLGTTNSCVGYWKEGANHAKIINHTATDGKHKTVPSVVSFPSQGNPFVGFDAVEHE  80

Query  62   VAMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
                    T+  AKRL+G+  ++  +  + K+  + L    G    + +    +     P
Sbjct  81   QKYEPDTVTIRSAKRLMGKTLAE--MADEQKYLSYTLCDADG---HVAIDLPSKESIATP  135

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
             E+S+++L  +++ AE  +G +V N V+TVPAYFN+SQRQ+T  A  +AG   +R++NEP
Sbjct  136  SEVSAILLKYIKDTAEDKLGHQVFNCVLTVPAYFNESQRQSTLKAATMAGFQGIRLLNEP  195

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    GDTHLGGED ++ L
Sbjct  196  TAAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGTFAVDGVGGDTHLGGEDINHLL  254

Query  241  VDHF----TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
            VD      +QE        +   + A+ +L+ A E AK TLS+     I +  +      
Sbjct  255  VDFMLDSISQEQNGGKPLPLPLTRTAIIQLQQAAEHAKVTLSTQKDVSIYLKDVGGIKAH  314

Query  297  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK----  352
               ++RA+ E +C     + ++    VL    L+   + EVVLVGGSTRIP    K    
Sbjct  315  KMKLSRAKLESLCAPLLTRCVDITRDVLASIGLTPQDIDEVVLVGGSTRIPALRTKLSDL  374

Query  353  --------SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  404
                    S+N DE VA GA +QAAILSG       QD+L++DV PLS+G+E A G M  
Sbjct  375  FDGKVLCTSVNADEVVASGAAIQAAILSG-VDKRVFQDVLMMDVIPLSIGIEMADGRMEV  433

Query  405  LIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR---  461
            LI +N+ +P   +++F TY D+Q G+ ++VFEG+  + RDN  L  FN      +PR   
Sbjct  434  LIPKNSRIPISVTKSFDTYEDHQKGITVEVFEGDHPVARDNVYLTYFNF----TLPRHKL  489

Query  462  ---GVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  496
               G  Q  VT  ++ NG+L V A  +    EN+  ++
Sbjct  490  GKAGEFQHAVTLSMNENGVLQVKAGAQHEIDENEAAVS  527

>PYVX_13615
Length=585

 Score = 278 bits (710),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 196/528 (37%), Positives = 297/528 (56%), Gaps = 63/528 (12%)

Query  9    SVGIDLGTTYSC---VGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTERLIG-DAA  58
             VGIDLGTT SC   VG+W+ +R  V+I+ N  D+G RTTPS V F     + L+G +A 
Sbjct  21   CVGIDLGTTNSCATRVGIWKTERNHVKILKNRRDRG-RTTPSVVRFGPESDQVLVGNEAI  79

Query  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKG-ESKT  117
             +++     NTV   KRL+G+ F    V+   K   FKL         I++   G ++ T
Sbjct  80   AHELEDPVGNTVRAVKRLMGQPFESKAVEVATKFAAFKLEPTKQGNTAISIDRSGSKTDT  139

Query  118  FQPEEISSMVLIKMREVAEAFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRI  176
              PE++S+ VL +++  AEA+   E + + VITVPAYFNDSQR+AT +A   AG + +R+
Sbjct  140  VLPEDVSAAVLSELKASAEAYYQDESIDHVVITVPAYFNDSQRRATLEAATSAGFSAVRL  199

Query  177  INEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  236
            +NEPTAAA+AYGL    G + V++FD GGGT DVSL+ I++G FEV    GDT+LGGED 
Sbjct  200  LNEPTAAAMAYGL-FLAGTKLVVVFDFGGGTLDVSLMQIQDGKFEVLGIGGDTNLGGEDI  258

Query  237  DNRLVDHFTQEFKRK---HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEI-DSLFD  292
            ++ L+DH  + F +    HR+ +      + +L+   E+AK  LS+   A +E+  +   
Sbjct  259  NHLLLDHVLEMFDKHFGVHREQLRPED--MVKLKREVEKAKIELSTEESAVVELRGAAGS  316

Query  293  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP-----  347
                  T+ R +FE +C   +++ +  V  VL++A+   +++ EV+LVGGSTRIP     
Sbjct  317  SKTMTVTLHRRKFELLCESIWKRCLRIVSNVLKEAEADVTEIDEVILVGGSTRIPVVRSR  376

Query  348  ---------------------------KEPNKSINPDEAVAYGATVQAAILSGNdssekl  380
                                       +E   S+N DE V  GA +QAAILSG    +  
Sbjct  377  LSEFFNDKWMVCLTVRIRSTNGVSGVEQELCMSVNADEVVCEGAAIQAAILSG-MDHKVF  435

Query  381  qdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERS  440
            +D+L++DV PL +GLETA G M  L+ +N+ +P   ++ F T+ D Q G+ ++V+EGE +
Sbjct  436  RDVLMMDVIPLPIGLETADGAMEVLLPKNSRIPVSLTKYFETFEDGQRGLTVEVYEGEHA  495

Query  441  MTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDIDANGILNVSA  482
            + + N+ +  FN      +PR      G  +  VTF +  +G+L V A
Sbjct  496  VAKQNDHICYFNF----ALPRDKIGKAGEFRHPVTFTMTPSGVLQVQA  539

>SDRG_16621
Length=531

 Score = 276 bits (705),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 186/493 (38%), Positives = 276/493 (56%), Gaps = 56/493 (11%)

Query  25   QNDRVEIIANDQGN---RTTPSYVAFTDTERLIGDAAKNQVAMNAHN------TVFDAKR  75
              + V+I+ +  G+   +T PS V+F  T    G  A   VA+ A        TV  AKR
Sbjct  1    HANHVKIVNHSTGDAKAKTLPSVVSFPST----GAPAVGFVAVAAEASDADVVTVRSAKR  56

Query  76   LIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVA  135
            L+G+  +D +   D K+  +KL  G  +   +++       +  P E+++++L ++++ A
Sbjct  57   LLGQSLADAL--PDQKYLSYKLCEG--ESGHVSIALPARKTSVTPSEVAALLLSELKKAA  112

Query  136  EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  195
            EA + + + N V+TVPAYF + QRQAT +A A+AG + +R++NEPTAAA+AYGL   G +
Sbjct  113  EAKLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPTAAAMAYGLFVAGTK  172

Query  196  RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKH---  252
            R V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N + DH  Q   +KH   
Sbjct  173  R-VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNIVFDHVLQSIAKKHGPL  231

Query  253  -----RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
                   D+ + QRA+       E AK  LS+  +  + + ++        T+TR + + 
Sbjct  232  ALPLATPDMVQLQRAV-------EAAKIALSTDDETVLRLTNVGHVALHEMTLTRRKLDA  284

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSIN  355
            +C   F+K +    +VL+   +  S V+EVVLVGGSTRIP            KE   S+N
Sbjct  285  LCDPLFKKCLRITREVLKAIDVDPSDVNEVVLVGGSTRIPAIRARLRAFFNDKELCTSVN  344

Query  356  PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  415
             DE VA GA +QAAILSG    +  QD+L+LDV P+S+G+E A G M  LI +N+ +P  
Sbjct  345  ADEVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIPKNSRIPVS  403

Query  416  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVT  469
             ++ F T  D+Q G  I+VFEGE  + R+N  L  F+      +PR      G  Q  VT
Sbjct  404  VTKYFDTAVDDQAGFTIEVFEGESPVARENTYLTYFDF----VLPRKTRGKAGSIQHPVT  459

Query  470  FDIDANGILNVSA  482
              ++ANG+L V A
Sbjct  460  LSMNANGLLQVKA  472

>CCA22305
Length=561

 Score = 275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 187/510 (37%), Positives = 297/510 (58%), Gaps = 50/510 (10%)

Query  9    SVGIDLGTTYSCVGVWQND--RVEIIAN---DQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            ++GID GTT SCVGVW  D  RV+I  +    + +   PS V +   +  +    K  + 
Sbjct  24   AIGIDFGTTNSCVGVWLKDQNRVKIFKHGIETKWSHLLPSVVRYDPVDISLVLVGKEAIE  83

Query  64   MN----AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES----  115
            +       NT+   KRL+G+K+ +  +        +++ S    +    +Q  G+     
Sbjct  84   LESKPPCKNTIRCVKRLMGQKYVNDRIAYLQSSSIYEIVST--QRGNAAIQIDGDHGDDK  141

Query  116  -KTFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNV  173
              + +PEE+++ +LIK++  AEA+   K ++N V+TVPA+FND QR+AT  A ++AG   
Sbjct  142  RTSVEPEEVAAHILIKLKARAEAYFDHKAIENVVLTVPAHFNDGQRKATIRAASMAGFKK  201

Query  174  LRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGG  233
            +R++NEPTAAA+AYGL    G++ VL+FD GGGT DVSL+ I EG F V A  GDT+LGG
Sbjct  202  IRLLNEPTAAAMAYGL-FIAGKKQVLVFDFGGGTLDVSLMQIHEGRFRVVAIGGDTNLGG  260

Query  234  EDFDNRLVDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  292
            ED +  ++DH  Q F+ K     +T +Q+A   ++ + E+AK  LS++ +A I+ +    
Sbjct  261  EDINQMIIDHILQSFEEKEGILQLTIDQKA--AMKQSIEQAKIQLSNAMEAVIKFEHKTT  318

Query  293  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK  352
               +   ++R  FE +C   + + +  ++ VL+DA +    V EVV+VGGSTRIPK  +K
Sbjct  319  WRQY--ALSRDVFESICDSVWTRCISTIQGVLQDASVDPCDVDEVVMVGGSTRIPKLRSK  376

Query  353  ------------SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  400
                        S+N D+ V  GA +QAA+LSG    + LQD+L+LDV PLS+GLETA G
Sbjct  377  ISEVFDNKALCESVNADQVVCEGAAIQAAVLSG-MDRKVLQDVLMLDVIPLSMGLETADG  435

Query  401  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  460
             M  ++ +N+ +P + ++ F T+ D+Q G+ + V+EGE  + R+N  + +F+     P+P
Sbjct  436  RMEVILPKNSQIPAQVTKYFQTFEDDQRGISVDVYEGEHPIARENEHICRFDF----PIP  491

Query  461  RGVPQID--------VTFDIDANGILNVSA  482
                +ID        VTF ++ NG+L+V+A
Sbjct  492  TS--KIDTAGRIFHPVTFRMNENGVLHVTA  519

>PYAP_19903
Length=527

 Score = 274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 190/504 (38%), Positives = 289/504 (57%), Gaps = 37/504 (7%)

Query  23   VWQNDR--VEIIAN-DQGNRTTPSYVAFT--DTERLIGDAAKNQVAMNAHNTVFDAKRLI  77
            +W  +R  V+I+ N D   RTTPS V F     E ++G+AA  +      NTV   KRL+
Sbjct  1    MWHVERNHVKILKNRDDRGRTTPSVVHFKPDSQEVVVGNAAIAREYDPPGNTVRTIKRLM  60

Query  78   GRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT-FQPEEISSMVLIKMREVAE  136
            G++F    V+   +     +         ++V+  G+     QPEE+SS VL++++  AE
Sbjct  61   GQRFDSDAVRVAKRFATHSIVETKQGNAAVSVKRSGQDAVDVQPEEVSSHVLMELKASAE  120

Query  137  AFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  195
            A+   E V N VITVPAYFNDSQR+AT  +  +AG   +R++NEPTAAA+AYGL    G+
Sbjct  121  AYWDDERVDNVVITVPAYFNDSQRKATILSAQMAGFKAIRLLNEPTAAAMAYGL-FLSGQ  179

Query  196  RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKH---  252
            ++V++FD GGGT DVSLLSI +G FEV    GDT+LGGED ++ +V H      ++H   
Sbjct  180  KHVVVFDFGGGTLDVSLLSINDGRFEVLGIGGDTNLGGEDINDLVVGHVVDMLHQQHGLT  239

Query  253  RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID-FNSTITRARFEDMCGD  311
            R D++ +   L +++   E+AK  LSS     IE+  +      +   +TR  FE +C  
Sbjct  240  RNDLSRSD--LIQIKRETEKAKVELSSEESIAIELKGIGKKKQAYKIKLTRPAFEKICAS  297

Query  312  YFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSINPDEA  359
             + + +  V  VL +A +  S + EV++VGGSTRIP            KE   S+N DE 
Sbjct  298  IWSRCLVIVTDVLEEAGVHTSDIDEVIMVGGSTRIPIVRAKVSEFFDNKELCLSVNADEV  357

Query  360  VAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQT  419
            V  GA +QAAILSG       +D+L++DV PL +GLE A G M  L+ +N+ +P   ++ 
Sbjct  358  VCEGAAIQAAILSG-LDKRIFRDVLMMDVLPLPIGLEKADGEMEILLPKNSRIPVTMTKY  416

Query  420  FSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDID  473
            F T+ D+Q G+ +QV+EGE ++ ++N+ +  FN     P+PR      G  +  VTF ++
Sbjct  417  FETFEDDQRGLTVQVYEGENAVAQENDHICDFNF----PIPRDKIGKAGEFKHPVTFTMN  472

Query  474  ANGILNVSAVEKSTGKENKITITN  497
            A+G+L V+A      +E  +++T+
Sbjct  473  ASGVLQVTAGIHHDSEETPMSLTS  496

>H257_16775
Length=291

 Score = 265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 173/248 (70%), Gaps = 47/248 (19%)

Query  356  PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  415
            PDEAVA+GATVQAAILSGNDSS++LQD                   +  L     ++  K
Sbjct  56   PDEAVAFGATVQAAILSGNDSSDRLQD-------------------LLFLHVTPLSLGLK  96

Query  416  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  475
            +  TFST  DNQPG LIQVFEGERSMTRDNNLLGKF+ DGIPPM RGVPQ+DVTFDIDAN
Sbjct  97   QPATFST--DNQPGALIQVFEGERSMTRDNNLLGKFSFDGIPPMHRGVPQVDVTFDIDAN  154

Query  476  GILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALE  535
            GILNVS +EKSTGKE  ITITN KGRLS+ DI                    IE  N LE
Sbjct  155  GILNVSTIEKSTGKE--ITITNAKGRLSKDDI--------------------IERMNGLE  192

Query  536  NYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVA  595
            NYAYNLRNTLN EKL+ ++ E DKK +EDKVTETI WLDA     KEEYE KQKELEGVA
Sbjct  193  NYAYNLRNTLNVEKLQGKLDEADKKVMEDKVTETIKWLDAT----KEEYEAKQKELEGVA  248

Query  596  NPILQKMY  603
            NPI+QK+Y
Sbjct  249  NPIMQKLY  256

>HYAP_01857
Length=492

 Score = 269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 185/467 (40%), Positives = 263/467 (56%), Gaps = 35/467 (7%)

Query  42   PSYVAFTDTERLI--GDAA-KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLT  98
            PS V F    + +  GDAA + +      NT+   KRL+G+KF    V     +  + + 
Sbjct  2    PSVVHFDPQSQHVDVGDAAVEFETEPPVGNTIRSIKRLLGQKFVSKAVDVARIYASYSVV  61

Query  99   SGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKE--VKNAVITVPAYFND  156
              A     + V   G+    QPEE+ + VL +++  AEA+   +  + N VITVPAYF+D
Sbjct  62   PTAQGNVVLQVVRGGKRVQVQPEEVVASVLAELKASAEAYFDGQLSIDNVVITVPAYFSD  121

Query  157  SQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIE  216
            SQR+AT  + ++AG   +R++NEPTAAA+AYGL    G++ V +FD GGGT DVSLL IE
Sbjct  122  SQRKATLTSASMAGFKAVRLLNEPTAAAMAYGL-FLSGKKLVTVFDFGGGTLDVSLLRIE  180

Query  217  EGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERA  273
            +G FEV    GDT+LGG+D DN LVDH  +   R H  ++T  Q     + RL+   E A
Sbjct  181  DGKFEVLGIGGDTNLGGDDIDNVLVDHLIEMLDRHH--NLTRAQVGDENMVRLKREVENA  238

Query  274  KRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQ  333
            K  LS    A + +D + +      T+TR + E++CG   +K +  V  VL +AK+  S 
Sbjct  239  KIKLSEEEHAVVTVD-MANVPRITYTLTRRKLEELCGPIRKKCLRIVSSVLEEAKVESSN  297

Query  334  VHEVVLVGGSTRIP------------KEPNKSINPDEAVAYGATVQAAILSGNdsseklq  381
            V EV+LVGGSTRIP            KE   S+N DE V  GA +QAAIL G       +
Sbjct  298  VDEVILVGGSTRIPILRQQISEAFGGKELCMSVNADEVVCEGAAIQAAILCG-VDQRVFR  356

Query  382  dlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSM  441
            D+L++DV PL +GLETA G M  ++ +N  +PT  ++ F TY DNQ G+ ++V+EGE  +
Sbjct  357  DVLMMDVLPLPIGLETADGSMEVILPKNARIPTTMTKYFQTYEDNQRGLTVEVYEGENKI  416

Query  442  TRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDIDANGILNVSA  482
             ++ + +  FN      +PR      G     VTF ++ANGIL V A
Sbjct  417  AKECDHICYFNF----VLPRDKIGKAGEFAHPVTFTMNANGILQVRA  459

>SDRG_01068
Length=621

 Score = 271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 195/619 (32%), Positives = 301/619 (49%), Gaps = 40/619 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQ-GNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            + ID+GT+   VGVW+NDRVE++A D  G    P+YVAFTD  RL+G  AK   A +A N
Sbjct  5    IAIDIGTSNLRVGVWRNDRVELLALDSDGATALPAYVAFTDAGRLVGRRAKAYAATDAAN  64

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
             VF   R +GR   D  V+AD    PF++ + + DKPQ+ V   G+  TF  EE    VL
Sbjct  65   VVFRMTRFLGRSMRDRGVRADCDKVPFQVVASSDDKPQVRVTLNGQPSTFDLEE----VL  120

Query  129  IKMREVAEAFIGKE--VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
              + E  +A + ++  V    +TVPA F  +QR A  DA AIAGLNV +++N PTAA + 
Sbjct  121  ATLLEHTKAMVDEQLTVGYVTLTVPAAFTTTQRHAVLDAAAIAGLNVRKLLNAPTAALVT  180

Query  187  YG--LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            Y     +   ER VL    G G+  V++   E  +    AT+G+ HLGG D D RLV H 
Sbjct  181  YMNMHPRMREERTVLTVTAGAGSLGVAITVDESALSTAVATSGNAHLGGLDIDERLVRHC  240

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
               F+R    D+  + R L+RLRTACE AK  LS++    +E+  L    D    ++R +
Sbjct  241  IAAFERTIGCDVRLSPRGLQRLRTACEEAKIALSTATTTTVEVPRLSGENDLVVVVSRDQ  300

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNKSI----------  354
               +  +   +    V K L+ AKL K+ + ++VL GG  R+P      +          
Sbjct  301  LNQLAREMMAQLTALVVKALQTAKLDKNNIDDIVLAGGLVRMPLLKTTLVDLFHGQRVRL  360

Query  355  --NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  412
              NPDEA+  GAT+  A    N +       +L      +             +AR  T 
Sbjct  361  VGNPDEAIVTGATLYTA----NATLRATGRDVLACQCLPTPFWVATEARHPQYLARGATD  416

Query  413  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ---IDVT  469
                ++   T   NQP + + V+EG       ++L GK+    + P+P G+P+   + V 
Sbjct  417  YFSTTEDMFTTQANQPDITLLVYEGLLGQRDTSHLQGKWR---VGPLPNGIPRGATVQVG  473

Query  470  FDI-DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            F I  A G L +SA    T  +  I  TN+    ++  + R++ EA   +  D    +  
Sbjct  474  FQICHATGTLQISA----TVDDKPIPATNELAPTTRGRMCRLIQEAATRRQVDGRQHIHA  529

Query  529  EAKNALE---NYAYNLRNTLNDEKL-KDQISEDDKKAIEDKVTETINWLDANQSAEKEEY  584
                A      Y   LR   + + + ++++SE  +  ++D +   + WL  + +A   EY
Sbjct  530  ARAAAKAAATEYTMRLREAWHGDAISRNRVSEVTRDELDDALALALKWLILHPNANTVEY  589

Query  585  EGKQKELEGVANPILQKMY  603
            E  + +LE V + +++ +Y
Sbjct  590  EVVRFKLEAVGSRVVEALY  608

>PHALS_00667
Length=142

 Score = 255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 136/142 (96%), Gaps = 0/142 (0%)

Query  441  MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  500
            MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  501  RLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKK  560
            RLSQA+IDRMV+EA+KYKSEDEANKVR+EAKNALENYAY+LRN+LN+EK+K+ I + DKK
Sbjct  61   RLSQAEIDRMVAEADKYKSEDEANKVRVEAKNALENYAYSLRNSLNEEKMKESIPKADKK  120

Query  561  AIEDKVTETINWLDANQSAEKE  582
             ++DKVTE I WLDA+QS+EKE
Sbjct  121  VVDDKVTEVIQWLDAHQSSEKE  142

>PHYSO_525236
Length=246

 Score = 257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 161/224 (72%), Gaps = 4/224 (2%)

Query  3    QSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            ++  G S+GID+GT YS V +W  DR EI+ N  GNR T SYVAFTD++ L+GDAA +Q 
Sbjct  4    KTTGGPSIGIDIGTAYSRVAIWHKDRAEILPNRFGNRLTSSYVAFTDSKVLVGDAAADQR  63

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGD----KPQITVQFKGESKTF  118
              NA NTVF   RL+GRKFSDP VQ  IKHWPFK+  G  D     P + VQF+G++K F
Sbjct  64   LQNAENTVFGITRLLGRKFSDPEVQERIKHWPFKVIRGPHDTPPPPPHVMVQFRGQTKIF  123

Query  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
             P +I S++L +MR + E + GKE   AV+TVPA+FN SQRQA KDAGAIA + V+R+I+
Sbjct  124  HPVQILSLLLSEMRGIVETYTGKEATTAVVTVPAHFNYSQRQAVKDAGAIAEIQVMRMIS  183

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  222
              TAA+I+YG++KKG ER VL+ DLG  T DVS++ IE+G FEV
Sbjct  184  RSTAASISYGINKKGSERRVLVVDLGASTLDVSVVEIEDGNFEV  227

>SPRG_00183
Length=609

 Score = 258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 181/610 (30%), Positives = 304/610 (50%), Gaps = 32/610 (5%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  67
            + + ID+G +   VGVW+N R  ++A D  N   P+ VAFTDT  L G+ AK     +  
Sbjct  6    HCIAIDIGASTIRVGVWRNGRATVLALDGAN-GLPAVVAFTDTTTLFGNQAKAIAQNDPT  64

Query  68   NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  127
            N VF+   L+GR+ +DP VQA +   PF++ + +   P I VQ +  + T+ P+EI  M+
Sbjct  65   NVVFNVLHLLGRRMNDPTVQAMVTSAPFRIIASSDKTPLIHVQHRRSACTYYPQEIVGML  124

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            L   +++AE  +G  + +AV+TVPA +  SQRQA  DA  +AGL V R+++  TA  IA+
Sbjct  125  LEHAKKLAEDHLGACLDHAVVTVPATYTTSQRQAVLDAATMAGLTVDRLLSATTAVGIAH  184

Query  188  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
                   +R +L+ D G  +   S+++ E   F   A+A DT LGG   D RL  H    
Sbjct  185  TQATGASKRKLLVVDAGASSVTASVVTAEHDTFTAHASASDTQLGGFAMDARLAAHCMST  244

Query  248  FKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLF-DGIDFNSTITRARF  305
            +    R  D+     A +RL +ACE A+  LS+S +  + I     DG+    T++R + 
Sbjct  245  WTPSTRGHDLI---LAKQRLLSACEAARCALSTSDETDVCIPHRSQDGMRL--TLSREKL  299

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKS  353
              +      K +  V KVL+ A+  K  V ++VLVGG   +P            K+    
Sbjct  300  NALVHHLMDKVVAHVLKVLQQAQCCKEDVDDIVLVGGVALMPCLQTTLSNLFGGKQVAWF  359

Query  354  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  413
              P EAV  GA +   I S   SS+       +     +     A G   T + R+  + 
Sbjct  360  PTPSEAVVAGAALY--IASTTASSDATVRPFAIHDALSTPIWAAAAGHHWTTVFRSPALS  417

Query  414  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  473
            +  + TF +   + P VL+ V+EG+      ++L G+++++ +P        IDV F +D
Sbjct  418  SMATHTFVSTG-SSPFVLL-VYEGDVGFPASSHLQGQWHIESLP----HTRFIDVAFVVD  471

Query  474  -ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
               G+L V+A +KS+ K   + +TN     S+ ++  + ++A           +   AK 
Sbjct  472  ECTGVLRVTASDKSSQK--ALPVTNTDCATSRRELQHLCAQATARYHTTRQTVLLARAKA  529

Query  533  ALENYAYNLRNTLN-DEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKEL  591
            A  ++ Y+LR+T + DE  + ++ +  +  ++D +   I WL  +  A  ++Y+  + +L
Sbjct  530  AANDFTYSLRSTWHSDEASRRRVGDAARDELDDALAAAIKWLLLHPQATIDQYDDVRVQL  589

Query  592  EGVANPILQK  601
            E V+  +L +
Sbjct  590  EAVSRRVLAR  599

>SPRG_00182
Length=615

 Score = 253 bits (646),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 188/618 (30%), Positives = 302/618 (49%), Gaps = 48/618 (8%)

Query  12   IDLGTTYSCVGVWQNDRVEIIAND-QGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            +D+GT+   VGV +N+RVE++A D  G    P+YVAFTD+ RL G  AK   A    N +
Sbjct  7    LDIGTSSLRVGVKRNNRVELLALDGDGATAMPAYVAFTDSGRLFGRRAKAYAASAPENVI  66

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F   R +G    D  V+AD    PF++ + + DKPQ+ V   G+  TF  EE+ +M+L  
Sbjct  67   FRMLRFLGGSMRDLNVRADCDKVPFRVVASSDDKPQVRVTVNGQPSTFDLEEVMAMLL--  124

Query  131  MREVAEAFIGKE--VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
              E  +A + ++  V++  +TVPA F  +QR+A  DA AIAGL V +++N PTAA +AY 
Sbjct  125  --EHTKAMVDEQLAVRHVTLTVPASFTTTQRRAVLDAAAIAGLTVRKLLNAPTAALVAYM  182

Query  189  L---DKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  245
                 +   +R V+    G G+  V++      +    AT G+ HLGG + D RLV H  
Sbjct  183  ATHPSRMHQDRTVVTVTAGAGSLGVAITIDSNDVSTAVATTGNAHLGGIEIDERLVRHCI  242

Query  246  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
              F+R   +D+  + R L+RLRTACE AK  LS++    IE+  L    D    ++R + 
Sbjct  243  AAFERTIGRDVHLSPRGLQRLRTACEDAKIALSTATTTTIEVPRLSGENDLVVCVSRDQL  302

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNKSI-----------  354
              +  D   +    V + LR AK+ K+ V  +VL GG  R+P      +           
Sbjct  303  NALARDVMTQLTALVVEALRMAKMEKANVDAIVLAGGLGRMPLLQTTLVDLFHGQRVRLI  362

Query  355  -NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  413
             NP EA+  GAT+      G+  + +         T                + R +T  
Sbjct  363  GNPSEAIVTGATLYTP--DGDVLALQSLPTPFWVATEARHPE---------YLLRGSTEY  411

Query  414  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ---IDVTF  470
               ++ F T  + Q  + + V+EG       ++L GK+    + P+P+ +P+   + V+F
Sbjct  412  FSTTEDFYTTQNKQSDITLLVYEGLVGQRETSHLQGKWR---VGPLPKSIPRGASVQVSF  468

Query  471  DI-DANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSED---EANKV  526
             I DA G L+VSA     GKE  I   N+    ++  + R++ EA   +  D     N  
Sbjct  469  QILDATGTLDVSATVD--GKE--IPTANELAPTTRGRMRRLIEEAATRRRVDGGQVVNAA  524

Query  527  RIEAKNALENYAYNLRNTLNDEKL-KDQISEDDKKAIEDKVTETINWLDANQSAEKEEYE  585
            R  AK A   Y   LR   + + + ++++SE  +  ++D +   + WL  N +A   EY 
Sbjct  525  RAAAKAATTEYTMRLREAWHGDAVSRNRVSEATRDELDDALAVALKWLILNPNATIVEYN  584

Query  586  GKQKELEGVANPILQKMY  603
              + +LE V + +++ ++
Sbjct  585  AVRFQLEAVGSRVIEGLW  602

>SDRG_01067
Length=611

 Score = 246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 181/612 (30%), Positives = 300/612 (49%), Gaps = 38/612 (6%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  67
            + V ID+GT+   VGVW+N RV ++A D G  + P+ VAFTDT  L G  AK     +  
Sbjct  6    HCVAIDIGTSRVRVGVWRNGRVHVLALD-GAESLPAVVAFTDTLTLFGHQAKAYAQDHPT  64

Query  68   NTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMV  127
            N V +A +L+GR+ +DPIVQA +   PF++ + +   P I VQ +  + T+ P+EI +M+
Sbjct  65   NVVSNALQLLGRRMNDPIVQAAVAGAPFRIRASSDKTPLICVQHQRSACTYYPQEIIAML  124

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            L  +R  AE  +G  + +AV+TVPA +  SQRQA  DA  +AG  V R+++  TAAAIA 
Sbjct  125  LEHVRTSAECHLGSCLDHAVVTVPATYTTSQRQAIVDAATMAGWTVDRLLSATTAAAIAQ  184

Query  188  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
                   +R +L+ D G      S+++ E   F   A+A D H+ G   D RL  +    
Sbjct  185  VHATGADKRRLLVVDAGASAVTASVVTAEYDTFTAHASASDMHVSGSAMDARLAAYCMSS  244

Query  248  FKRKHRKDITENQRAL-----RRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  302
            +    R  I  N  A      +RL +ACE A+  LS++ +  + I  L+   D   +++R
Sbjct  245  W----RPSIIGNDFAFSASTKQRLLSACEAARCALSTTNETQLCIPRLYRDEDVALSLSR  300

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNKSINPDEAVAY  362
             + + +      K +  V KVL+ AK  K  V ++VLVGG   +P   +   N    V  
Sbjct  301  EKLDALVDHLMDKVVVLVRKVLQQAKCVKDDVEDIVLVGGVASMPYLQSTLSN----VFC  356

Query  363  GATVQA----AILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT--------  410
            G TV      A+++G              V       +    ++T + A           
Sbjct  357  GKTVACLATPAVVAGAALYVASTTASSDSVVRPIAIHD---ALLTPIWAAAAGHHWRTVF  413

Query  411  TVPTKKSQTFSTYADNQPG-VLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  469
             VP        T+  N  G  ++ ++EG+   +  ++L G+++++ +    R    IDV 
Sbjct  414  NVPVLSGTATHTFQSNGSGPFVLLMYEGDVGFSDSSHLQGRWHIETL----RSTRFIDVA  469

Query  470  FDID-ANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528
            F ID   G+L V+A +KST  +  +++ N     S+  +  + ++A           +  
Sbjct  470  FVIDEGTGVLRVAAFDKST--QEGLSVVNSDSATSRRKLQHLCAQAMARHHIARQKVLLA  527

Query  529  EAKNALENYAYNLRNTLN-DEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  587
             AK A  ++ Y+LR+T + DE  + ++ +  +  ++D +   I WL  N +A  EEY+  
Sbjct  528  RAKAAANDFTYSLRSTWHSDEASRHRVGDPSRDELDDALAAAIKWLLLNPNATIEEYDDV  587

Query  588  QKELEGVANPIL  599
            + +LE V+  +L
Sbjct  588  RVQLETVSRRVL  599

>PYVX_13288
Length=810

 Score = 249 bits (637),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 189/679 (28%), Positives = 312/679 (46%), Gaps = 96/679 (14%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAISVARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +     A     I +Q+  E  TF  E+I +MVL 
Sbjct  64   ATDIKRLIGRKFKHPEVQREIAQLAYPCVELANGDVGIVLQYNDEPVTFSCEQIVAMVLN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYAVLSCPGFYTDVQRRAVLNASKIAGVNCLRLLNEHTAVALAYG  183

Query  189  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN         V+  D+G  ++ VS+++  +G  +VKA A D  LGG DFD  
Sbjct  184  IYKSA--RNLFHESEPQYVMFIDIGHASYTVSIIAFVQGKLQVKAAAYDRFLGGRDFDMA  241

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  297
            +      +F  K++ D   N ++  +L +ACE++K+ LS       ++ I+ L D  D++
Sbjct  242  IAKDAAAQFSAKYKTDPLANPKSRIKLLSACEKSKKNLSPYGVTATHLNIECLADDRDYS  301

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP----------  347
            + IT  +FE+M      +   P+E  L+DA + KSQ+  V ++GG TR+           
Sbjct  302  AQITLEQFEEMIAPLLARLDAPIESALKDAGIDKSQLANVEIIGGGTRVASVKRHLSEVL  361

Query  348  ---KEP-----NKSINPDEAVAYGATVQAAILSGNdsse------------------klq  381
               KE      + ++N DE+VA G  +Q AILS     +                     
Sbjct  362  GLDKEAQNYGLSTTLNADESVARGCALQCAILSPMFKVKEFSITDAVHLPIRVSWDGAAS  421

Query  382  dlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSM  441
                       + +E +      +  R    P  K  TF     +Q   +  V++   + 
Sbjct  422  APTDAAENDEDVNMEASSDSSIVIFHRKDEYPKTKRITFRR---DQSFAIDAVYDESATP  478

Query  442  TRDNNLL---GKFNLDGIPPMPRG--VPQIDVTFDIDANGILNV----------------  480
                + L   GKF + G+P + +   +P+I V    D NG+ +V                
Sbjct  479  YLPPDYLMSIGKFTVSGLPSLAKDAELPKIRVNVTQDINGLFSVASSQLMQEVKEEEKPA  538

Query  481  -------------SAVEKSTGKENK------ITITNDKGRLSQADIDRMVSEAEKYKSED  521
                         +A +KS   + K      + +T + G L+ +D+     +  K   +D
Sbjct  539  EEEAKEGAEGDAKAAEDKSEQPKKKRFRKIELQVTAEVGGLTTSDVAAATEQELKMAQQD  598

Query  522  EANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWL--DANQSA  579
               +     +N LE++ Y +RN ++D +L + I+  +K  +E+K+ E  +WL  D    +
Sbjct  599  RVIEETFNKRNELESFVYEMRNHVSD-RLANFITSSEKATLEEKLLEAEDWLYTDEGFDS  657

Query  580  EKEEYEGKQKELEGVANPI  598
             K  Y+ K  +L  ++NP+
Sbjct  658  TKSVYQTKLDDLRKLSNPV  676

>PYAP_18643
Length=804

 Score = 249 bits (635),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 186/678 (27%), Positives = 313/678 (46%), Gaps = 96/678 (14%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNVDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +K          + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAYKCVELPNGDVGVVLNYNDEPVTFTCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQAIAAAANEGVRPAYAVMSCPGFYTDVQRRALLNATKIAGMNCLRLLNEHTAIALAYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +   ++V+  D+G  ++ VS+++  +G  +VKA   D  LGG DFD  L 
Sbjct  184  IYKSARNLFHESEPQHVMFIDMGHASYTVSIVAFVQGKLQVKAATFDRFLGGRDFDYALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                ++F+ KH+ +   + +A  +L  ACE+AK+ LS       Y+ I+ L D  D++  
Sbjct  244  VDVAKQFEEKHKINALNDAKARIKLLAACEKAKKNLSPHGVNATYVNIECLADEKDYSGQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +T   FE++      +  +P+++ L+DA + KSQ+  V +VGG+TR+             
Sbjct  304  VTLEHFEELIAPLLNRLEDPIQRALKDAGIDKSQLASVEIVGGATRVSSVKRRLSDILGL  363

Query  348  -KEP-----NKSINPDEAVAYGATVQAAILS------------------------GNdss  377
             KE      + ++N DE+VA G  +Q AILS                        GN   
Sbjct  364  DKEAQNYGLSTTLNADESVARGCALQCAILSPVFKVKEFHIADKVHLPVRVTWEDGN---  420

Query  378  eklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG  437
                 +   D     + +E AG     +  R    P  K  TF    D    +     E 
Sbjct  421  -ASAPMDTADDNDEDVNMEAAGDSTIVIFDRKDDYPKTKRITFRR--DAAFSIDAAYDET  477

Query  438  ERSMTRDNNLL--GKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------  484
             +     + +L  GK+ + G+P   +G  VP+I V    D NGI +V++ +         
Sbjct  478  AQPYLPPDYVLNLGKYTISGLPAGEKGAEVPKIRVNVSQDINGIFSVASSQLMQEIKEEE  537

Query  485  ----------------------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  522
                                  K   ++ ++ +  +   LS  +I     +      +D 
Sbjct  538  KPAEEAKEGEAKEAEEKPAEPKKKRFRKVELKVEANVPGLSPTEITSATEQELAMAHQDR  597

Query  523  ANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQS--AE  580
              +     +N LE++ Y++R  + D +L + IS D+K A+EDK+ E  +WL +++   + 
Sbjct  598  VIEETFNKRNELESFVYDMRAQVTD-RLAEYISSDEKNALEDKLNEVEDWLYSDEGFDST  656

Query  581  KEEYEGKQKELEGVANPI  598
            K  Y+ K  E+  + +P+
Sbjct  657  KSVYQSKLDEMRKITSPV  674

>PYAR_15468
Length=769

 Score = 245 bits (626),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 183/648 (28%), Positives = 310/648 (48%), Gaps = 70/648 (11%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G T   +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNTDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    F           + +++  E+ TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAFPCVELPNGDVGVVLRYNDEAVTFTCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVRPAYAVLSCPGFYTDVQRRALLNAAKIAGVNCLRLLNEHTAVALAYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +   ++V+  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  L 
Sbjct  184  IYKSARNLFAESEPQHVMFIDMGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
            +    +F+ K++ +  ++ +A  +L + CE+AK+ LS       ++ ++SL +  D++  
Sbjct  244  EDVAAQFEAKYKVNPLKDAKARIKLLSGCEKAKKNLSPHGVTATFLNVESLAEDRDYSGQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRI-------PKEPNK  352
            +T  RFE++      +   P+++ L DA + K+Q+  V +VGG+TR+       P    K
Sbjct  304  VTLERFEELIAPLLNRLEGPIQRALADAGIDKAQLASVEIVGGATRVSSCAILSPVFKVK  363

Query  353  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA-RNTT  411
              +  +   +   V     S N            D     + +E AG   T +I  R   
Sbjct  364  EFHIADKTHFPVRVSWENGSAN------TTDAAGDNDEEDVNMEAAGSDSTLVIFDRKDE  417

Query  412  VPTKKSQTFSTYADNQPGVLIQVFEGERS---MTRDNNL-LGKFNLDGIPPMPRGVPQID  467
             P  K  TF   A       I     E +   +  D +L LGK+ + GIP     +P+I 
Sbjct  418  YPKTKRITFRRDA----AFAIDAAYDETATPFLPADYSLALGKYTISGIPKTGDEIPKIR  473

Query  468  VTFDIDANGILNVSAVE----------------------KSTGKENK-------------  492
            V    D NGI +V++ +                      K    E+K             
Sbjct  474  VNVQQDLNGIFSVASSQLMQEIKEEEKSAEEAKEGADEAKDKAAEDKPAEPKKKRFRKVE  533

Query  493  ITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKD  552
            + +  D   LS  +I     +      +D   +     +N LE++ Y++RN +  E+L +
Sbjct  534  LKVDADVPGLSPQEISSATEQELAMAHQDRVIEETFNKRNELESFVYDMRNHIT-ERLAE  592

Query  553  QISEDDKKAIEDKVTETINWLDANQS--AEKEEYEGKQKELEGVANPI  598
             ISE +K ++EDK+TE  +WL +++   + K  Y+GK  EL  +++P+
Sbjct  593  YISESEKASLEDKLTEAEDWLYSDEGFDSTKSVYQGKLDELRKLSSPV  640

>PHALS_04095
Length=803

 Score = 243 bits (619),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 187/674 (28%), Positives = 309/674 (46%), Gaps = 89/674 (13%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +     A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDLKRLIGRKFKHPEVQKEIAQLAYTCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIASAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                 +F  K++ D   N ++  +L +ACE+AK+ LS        + I+ L D  D+N+ 
Sbjct  244  KDVAAKFAEKYKTDPLGNPKSRIKLLSACEKAKKNLSPYGVTATNLNIECLADDRDYNAQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +T   FE++      +  +PVE+ L DA + KSQ+  V +VGG TR+             
Sbjct  304  LTLEEFEELIAPLLLRLNDPVERALADAGIDKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  348  -KEP-----NKSINPDEAVAYGATVQAAILSGNdsseklqdlll-----------ldvtp  390
             KE      + ++N DE+VA G  +  AILS     ++                      
Sbjct  364  DKEQQNFGLSTTLNADESVARGCALNCAILSPMFKVKEFSVTDCVHLPVRVSWDGSAAAG  423

Query  391  lslglETAGGV-MTT------LIARNTTVPTKKSQTFSTYADNQPGVLIQVFE--GERSM  441
                 E  G V M T      + +R    P  K  TF     ++P  +  +++   +  +
Sbjct  424  TPSAAEEDGDVNMETEDSSLVIFSRKDEYPKTKRITFRR---DKPFSIDAMYDESAKSYL  480

Query  442  TRDNNL-LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE--------------  484
              D ++ +GK+ + G+P    G  +P+I V    D NG+ +VS+ +              
Sbjct  481  PPDYDMDIGKYTISGMPSQEAGTEIPKIRVNVQQDMNGLFSVSSSQLMQEILEEEKPAVA  540

Query  485  ------------------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKV  526
                              K   ++ ++++      LS  D+     +  K   +D   + 
Sbjct  541  DGAEVEGEKKDDKPVEPKKKRFRKVELSVHAAVSGLSAGDVAAATEQELKMAQQDRVIEE  600

Query  527  RIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWL--DANQSAEKEEY  584
                +N LE++ Y +RN + D KL   I+  +K  +E K+TET +WL  D    + K  Y
Sbjct  601  TFNKRNELESFVYEMRNQITD-KLAGFITSGEKSNLESKLTETEDWLYTDEGFDSTKSVY  659

Query  585  EGKQKELEGVANPI  598
            + K  ++  +++P+
Sbjct  660  QQKLDDMRKLSSPV  673

>CCA15913
Length=857

 Score = 241 bits (614),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 190/693 (27%), Positives = 311/693 (45%), Gaps = 117/693 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  43   IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  102

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQA+I    FK    A     I +++     TF  E+I +M+L 
Sbjct  103  ATDIKRLIGRKFKHPEVQAEIAQLSFKCDEMANGDVGIVLKYNDADVTFSCEQIIAMILN  162

Query  130  KMREVA-EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A  A  G      V++ P Y+ D QR+A  ++  IAGLN LR+INE TA A+AYG
Sbjct  163  KMQIIATSANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  222

Query  189  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN         V+  D+G  ++ V+++S   G  +V++ A D  LGG DFD  
Sbjct  223  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVSFVLGKLQVRSVAFDRFLGGRDFDYA  280

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  297
            L     + F+ KH+ D  +  ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  281  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  340

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK-----  352
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+     +     
Sbjct  341  SQITLEHFEELIAPLLDRLEAPITQALNDAGIEKSQLSNVEVVGGGTRVASVKRRLADIL  400

Query  353  -------------SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAG  399
                         ++N DE+VA G  +Q AILS      K   +      P+ +  ET+ 
Sbjct  401  SLDKSAQNYGLSTTLNADESVARGCALQCAILSP-LFKVKEFSIADRVYYPVRVSWETSA  459

Query  400  GVMTTLIARNTTVPTK---------------KSQTFSTYADNQPGVLIQVFEGERSMTRD  444
             V         +VP +                S    T+AD  P      F  E S + D
Sbjct  460  DV---------SVPMETGDDNEDGDLGNDGANSIVIFTHADEYPKTKRITFRREDSFSVD  510

Query  445  NNL---------------LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---  484
                              +GKF + G+P + +G  +P+I V    D NG++ +S+ +   
Sbjct  511  AKYDESAKALLPPDYDLGIGKFTISGLPEIEKGGEIPKIRVNIQHDLNGLVGISSSQLMQ  570

Query  485  -------------------------------------KSTGKENKITITNDKGRLSQADI  507
                                                 K   ++ ++ I  +   L+ +++
Sbjct  571  ELKEEKPADEAKETQENEENKEKKEGGKADEKAPEPKKKRFRKVELKIEAETKGLNVSEV  630

Query  508  DRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVT  567
            ++      +   +D   +     +N LE++ Y +RN ++D +L+D I+E++K  +E  + 
Sbjct  631  NKATEIELEMAHQDRVIEETCNKRNELESFVYEMRNQISD-RLRDFITEEEKSKLESSLA  689

Query  568  ETINWL--DANQSAEKEEYEGKQKELEGVANPI  598
            E   WL  D    + K  Y+ K   L  ++ PI
Sbjct  690  EVEEWLYTDEGFDSVKSVYQTKLDGLRKLSAPI  722

>SPRG_06720
Length=425

 Score = 230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 143/390 (37%), Positives = 204/390 (52%), Gaps = 33/390 (8%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  66
            +SVGIDLGTTYS V V Q D V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  31   HSVGIDLGTTYSVVAVNQKDNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  90

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES-KTFQPEEISS  125
             +T+F+AKR IGR F   +   +  H+ F L      +    +   G + +   P ++ +
Sbjct  91   RHTIFNAKRFIGRAFDATVETEEAPHYEFGLGRDEAHRVCFPLSVTGHATRCVSPVDVGA  150

Query  126  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             ++ +++  A  ++G  ++ +AVI VPA F+  QR AT  A   AGL V  ++ EPTAAA
Sbjct  151  HIVSQLKTSAMRYLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  210

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  211  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  270

Query  245  TQEFKRKHRKDITENQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  287
               F+             L R             +R   E+ KR L    S++A   IE 
Sbjct  271  VARFEELLATPALPPLSTLARTSDESAFPCTVSGMRGVAEKLKRDLSALPSAAASCVIEA  330

Query  288  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  345
             +        +T+  TR  +E +      +T+ P+  +L    ++ + + EVVLVGGS+R
Sbjct  331  STAQHAAGSLATVEMTRQEWEALVAPMLSRTLTPIHDMLDGNGMAPTDIDEVVLVGGSSR  390

Query  346  IP-----------KEPNKSINPDEAVAYGA  364
            IP           +EPN  I+PD AVA GA
Sbjct  391  IPWIQHALAALFGREPNAHIDPDVAVAVGA  420

>CCI46709
Length=819

 Score = 237 bits (604),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 187/693 (27%), Positives = 311/693 (45%), Gaps = 117/693 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQA+I    F+    A     I +++     TF  E+I +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQAEIAQLSFRCEEMANGDVGIVLKYNDADVTFSCEQIIAMILN  123

Query  130  KMREVA-EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A  A  G      V++ P Y+ D QR+A  ++  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQIIATTANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  183

Query  189  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN         V+  D+G  ++ V++++   G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVAFVLGKLQVKSVAFDRFLGGRDFDYA  241

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  297
            L     + F+ KH+ D  +  ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  242  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  301

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK-----  352
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+     +     
Sbjct  302  SQITLDHFEELIAPLLDRLEAPINQALNDAGIIKSQLSNVEIVGGGTRVASVKRRLADIL  361

Query  353  -------------SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAG  399
                         ++N DE+VA G  +Q AILS      K   +      P+ +  ET+ 
Sbjct  362  SLDNSAQNYGLSTTLNADESVARGCALQCAILSP-LFKVKEFSIADRVYFPVRVSWETSA  420

Query  400  GVMTTLIARNTTVPTK---------------KSQTFSTYADNQPGVLIQVFEGERSMTRD  444
             +         +VP +                S    T+AD  P      F  + S + D
Sbjct  421  DI---------SVPMETGDDNEDGDLGNDGANSIVIFTHADEYPKTKRITFRRDNSFSID  471

Query  445  NNL---------------LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---  484
                              +GKF + G P + +G  +P+I V    D NG++ +++ +   
Sbjct  472  AKYDESAKALLPPDYDLAIGKFTVSGFPELEKGGEIPKIRVNIQHDLNGLVGIASSQLMQ  531

Query  485  -------------------------------------KSTGKENKITITNDKGRLSQADI  507
                                                 K   ++ ++ I ++   L+ A++
Sbjct  532  ELKEEKPVEEPKEAQESDEKKEKKEGEQAEEKASEPKKKRFRKVELKIESEIKGLNVAEV  591

Query  508  DRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVT  567
            ++      +   +D   +     +N LE++ Y +RN ++D +L+D I+E++K  +E  + 
Sbjct  592  NKATETELEMAHQDRIIEETCNKRNELESFVYEMRNQISD-RLRDFITEEEKAKLESSLA  650

Query  568  ETINWL--DANQSAEKEEYEGKQKELEGVANPI  598
            E   WL  D    + K  Y+ K   L  ++ PI
Sbjct  651  EAEEWLYTDEGFDSVKSVYQTKLDGLRKLSAPI  683

>H257_04453
Length=423

 Score = 226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 144/388 (37%), Positives = 209/388 (54%), Gaps = 32/388 (8%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V V ++  V ++ +  GN   PS VAF      L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDANGNLLLPSIVAFKPHGGVLVGRDARHHRRVDP  91

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQIT--VQFKGESKTFQPEEIS  124
             +T+ +AKR IGRKF D  ++AD   + F L         +   +   G      P +I 
Sbjct  92   KHTISNAKRFIGRKF-DATIEADASLYDFPLLGNTTGDHHVCFGLSVPGHPSCVSPVDIG  150

Query  125  SMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
              V+  ++E A A++G  ++  AVI +PA F+ +QR+AT  A   AGL V  ++ EPTAA
Sbjct  151  YFVVKTLKETAMAYLGHDQIYGAVIAIPAGFDANQRKATVAAFERAGLKVRNVLVEPTAA  210

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            A+AYGL  K    NVL+FD GGGT DVSLL +++G F+V  TAGD HLGGED D++L  H
Sbjct  211  ALAYGLHTKPNVHNVLVFDFGGGTLDVSLLYLQKGSFQVMDTAGDNHLGGEDLDDQLSGH  270

Query  244  FTQEFKR----KHRKDITENQR------ALRRLRTACERAKRTLS------SSAQAYIEI  287
               +F++        D+  +            +R   E+ KR LS      +S      +
Sbjct  271  LKHQFEQLVGGHSLPDLQTSDEPNVFPCTAAGIRGVAEQLKRQLSFDVEGEASCVVQEAV  330

Query  288  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  347
             S+  G      +TR+ +E +C    ++TM PV++VL    ++   + EVVLVGGS+RIP
Sbjct  331  GSVAVGDVLRLRMTRSEWEALCLPTLQRTMAPVKEVLEGNMMTTDDIDEVVLVGGSSRIP  390

Query  348  -----------KEPNKSINPDEAVAYGA  364
                       +EPN  I+PD AVA GA
Sbjct  391  WIQAQLAQMFGREPNSHIDPDVAVAVGA  418

>SDRG_16559
Length=461

 Score = 226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 145/390 (37%), Positives = 207/390 (53%), Gaps = 34/390 (9%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  66
            +SVGIDLGTTYS V V Q   V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  68   HSVGIDLGTTYSVVAVNQKGNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  127

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES-KTFQPEEISS  125
             +T+F+AKR IGR F D  V+ +  H+ F L     ++    +   G + +   P ++ +
Sbjct  128  RHTIFNAKRFIGRAF-DAAVETEASHYEFGLDRDEANRVCFPLSVTGHATRCASPIDVGA  186

Query  126  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             ++ +++  A   +G  ++ +AVI VPA F+  QR AT  A   AGL V  ++ EPTAAA
Sbjct  187  HIVSQLKASAMRHLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  246

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  247  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  306

Query  245  TQEFKRKHRKDITENQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  287
               F+            +L R             +R   E+ KR L    S++A   +E 
Sbjct  307  VARFEALLATPALPALSSLARTSDASAFPCTVSGMRGVAEKLKRDLSATPSAAASCVVEA  366

Query  288  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  345
             +        +T+  TR  +E +      +T+ P+ ++L    ++ S V EVVLVGGS+R
Sbjct  367  ATPQHAAGDLATLEMTRVEWEALVAPLLSRTLSPIHEMLSGNGMAPSDVDEVVLVGGSSR  426

Query  346  IP-----------KEPNKSINPDEAVAYGA  364
            IP           +EPN  I+PD AVA GA
Sbjct  427  IPWIQEALGALFGREPNAHIDPDVAVAVGA  456

>HYAP_06818
Length=316

 Score = 219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 185/298 (62%), Gaps = 22/298 (7%)

Query  317  MEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK-----------EPNKSINPDEAVAYGAT  365
            M P +K ++DA L KS+++EV+LVGG +R+PK           +P+K +NPDE VA GA 
Sbjct  1    MGPCKKCVKDAGLEKSEINEVILVGGMSRMPKVQTTVEAFFGKKPSKGVNPDEVVAMGAA  60

Query  366  VQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYAD  425
            +Q  +L G+     L D+  L +       ET GGV T LI RNTT+PTKKSQ FST AD
Sbjct  61   IQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAAD  115

Query  426  NQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEK  485
            +Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI+NV A +K
Sbjct  116  SQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARDK  175

Query  486  STGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTL  545
            +TGKE  I I +  G LS A+I++MV++AE     D+  K  IEAKN  ++  Y    TL
Sbjct  176  ATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAVADQQRKELIEAKNEADSVLYTTEKTL  234

Query  546  NDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANPILQKMY  603
              E+ K++I  D  + ++  ++   +    ++S   EE +   KE++ +A  I + +Y
Sbjct  235  --EEHKEKIDADTLEKVKVALS---DLRQKSESENTEEIKAALKEVQEMAMKIGEAVY  287

>PHYSO_249932
Length=232

 Score = 215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 142/199 (71%), Gaps = 13/199 (7%)

Query  150  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  209
            +P +FN SQRQA K+AGA+AGLNV+R I   TAA+I YG +K G  R +L+FD+GG   D
Sbjct  2    MPLHFNQSQRQAIKNAGALAGLNVVRSIAGSTAASIGYGFEKTG-LRAILVFDMGGSALD  60

Query  210  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  269
            +SL++I++ I+EV AT G  HLGG              FKR H KD+  N RA+ RLR+A
Sbjct  61   LSLVTIDDDIYEVLATLGVPHLGGV------------PFKRTHGKDLRTNSRAMVRLRSA  108

Query  270  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL  329
            CE+AKR +S+S +A IE++SL++GID NSTI+R RF D+C D F K +  V KVLRDAK 
Sbjct  109  CEQAKRAVSTSTEAQIELESLYEGIDLNSTISRPRFNDLCADLFDKALGAVSKVLRDAKK  168

Query  330  SKSQVHEVVLVGGSTRIPK  348
            SK++V E+VLVGGS RIP+
Sbjct  169  SKTRVDEIVLVGGSPRIPR  187

>H310_12260
Length=424

 Score = 221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 145/390 (37%), Positives = 206/390 (53%), Gaps = 35/390 (9%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V V ++  V ++ +  G+   PS VAF  +   L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDVHGHFLLPSVVAFKPNGGVLVGRDARHYRRVDP  91

Query  67   HNTVFDAKRLIGRKFSDPIV-QADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  125
             +T+ +AKR IGR+F + I  +A +  +P    +         +   G      P +I  
Sbjct  92   KHTISNAKRFIGRQFDESIAAEAALYDFPLLANTTGDSHVCFGLNLPGHPSCISPVDIGY  151

Query  126  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             V+  ++E A AF+G  ++  AVI +PA F+ SQR+AT  A   AGL V  ++ EPTAAA
Sbjct  152  YVVKALKETAMAFLGHDQIYGAVIAIPAGFDASQRKATVAAFERAGLKVRNVLVEPTAAA  211

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYGL  K     VL+FD GGGT DVSLL ++ G F+V  TAGD HLGGED D+ L  H 
Sbjct  212  LAYGLHTKPNVHYVLVFDFGGGTLDVSLLYLQNGSFQVMDTAGDNHLGGEDLDDLLSAHL  271

Query  245  TQEFKR---KHR----------KDITENQRALRRLRTACERAKRTLS------SSAQAYI  285
              EF++    H            D+     A   +R   E+ KR LS      +S     
Sbjct  272  KHEFEQVVGGHSLPDVQTSGDMPDVFPCTAA--GVRGVAEQLKRRLSFANDGEASCVVQQ  329

Query  286  EIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  345
             +     G      +TRA +E++C    ++TMEPV++VL    ++   V EVVLVGGS+R
Sbjct  330  AVGEYVVGDTLRLRMTRAEWEELCLPTLQRTMEPVKEVLVGNMMTAGDVDEVVLVGGSSR  389

Query  346  IP-----------KEPNKSINPDEAVAYGA  364
            IP           + PN  I+PD AVA GA
Sbjct  390  IPWIQGQLTEMFGRAPNGHIDPDVAVAVGA  419

>PHALS_09281
Length=465

 Score = 221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 143/397 (36%), Positives = 208/397 (52%), Gaps = 44/397 (11%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V ++Q + V  IA+++G+   PS VA+  D   LIG  A+    ++ 
Sbjct  68   HVVGIDLGTTYSVVAIFQKNNVTAIADNEGHVLVPSTVAYLPDGGVLIGREARTHRTIDP  127

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFK-----LTSGAGDKPQITVQFKGESKTFQPE  121
             +T+F+AKR IG+ + D +++++    P++     L     D     +      +   P 
Sbjct  128  QHTIFNAKRFIGQSYDD-VIKSENGTMPYEFNIKPLQRNEYDGICFALNLPNHPECVTPV  186

Query  122  EISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EI + ++  +  +A  ++G  +V  AV+ VP  FN+ QR ATK A   AGL V R++ EP
Sbjct  187  EIGTAIVRHLHFMAHRYVGHNQVTKAVVAVPVDFNEKQRNATKAAFRAAGLEVSRVLEEP  246

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D RL
Sbjct  247  TAAAIAYGLHQDQNINFMLVFDFGGGTLDVSLLFARNGAITVVDTLGDNHLGGEDLDARL  306

Query  241  VDHFTQEFKRKHRKDI------TENQRALRR----------LRTACERAKRTLS-----S  279
                   F+ + +K I      TE +R L+           +R A E  KR L+     +
Sbjct  307  SAWLLMRFESQLKKKISTHNTKTEGKRVLKDRPEPPCTMAGVRQAAELLKRQLTNLSVVT  366

Query  280  SAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  339
            +A  + E D   + I     +TR +FE++C     +TM PV  +L    +   ++  VVL
Sbjct  367  AACVWNEGD---ESIQIEVDVTRLQFEELCKPLLERTMIPVRDILAANNIGTEEIDAVVL  423

Query  340  VGGSTRIP------------KEPNKSINPDEAVAYGA  364
            VGGS+RIP            + P  +I+PD AVAYGA
Sbjct  424  VGGSSRIPWVRQRLTEMFHGRAPLSNIDPDLAVAYGA  460

>H257_16484
Length=795

 Score = 229 bits (583),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 179/674 (27%), Positives = 304/674 (45%), Gaps = 94/674 (14%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKFS P VQ +I+++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIQNYGFKCVELPSGQVGIVLNYNDNPVTYSCEQVVAMMLN  123

Query  130  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            K++ +A  A  G      V++ P YF D QR+A  +A  IAGLN LR++NE TA A+ YG
Sbjct  124  KLQNIAAVANDGVNPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L 
Sbjct  184  IYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                ++F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S 
Sbjct  244  KDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSVLNIECLVDEIDYASK  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            ++   FE +     ++   P++  L DA L+  ++  V +VGG  R+             
Sbjct  304  VSLDEFETLIAPLLQRLEGPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLAEILGL  363

Query  348  --KEPN----KSINPDEAVAYGATVQAAILSG------------Ndsseklqdlllldvt  389
              ++PN     ++N DEAVA G  +Q AILS             N+   ++         
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAILSPLFKVKDFSISDINNYPIRVSWEGAASAD  423

Query  390  plslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNL--  447
              +   ET G V T   A +  + T+K        D+ P      F    ++  + N   
Sbjct  424  DDTNEDETDGAVQTPANANSILILTRK--------DDFPTTKRITFRRSEALVVEANYDE  475

Query  448  -------------LGKFNLDGIPPMPRG-VPQIDVTFDIDANGILNVSAVEKSTG-----  488
                         LGKF + G+     G  P++ V    D +G+  V++ +         
Sbjct  476  TATPFLPPSPYTNLGKFTISGMSAGENGEAPRVRVNVRQDIHGLFEVASGQMMVEIKEEE  535

Query  489  ----------------------KENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKV  526
                                  ++  + + +    L+ AD++R   E      +D   + 
Sbjct  536  TKEAEAKEGEEKKEEGPKKKRFRKVDLKVESQVNGLTAADVNRASEEELTMAQQDRVIEE  595

Query  527  RIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQS--AEKEEY  584
                +N LE + Y+ RN L+D K  + +S  D+ A + K+ +  +WL +++   + K  +
Sbjct  596  TANKRNELETFVYDNRNHLSD-KYSEFVSTSDRDAFDAKLNDMEDWLYSDEGFDSTKSVF  654

Query  585  EGKQKELEGVANPI  598
            + K  EL  +  P+
Sbjct  655  QTKLDELRALLKPV  668

>PYIW_14231
Length=1243

 Score = 232 bits (592),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 175/541 (32%), Positives = 282/541 (52%), Gaps = 56/541 (10%)

Query  8    YSVGIDLG-----TTYSCVGVWQNDRVEII-ANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61
            + +GID+G     TT S  GV  +  +E    +D      P+YV+ TD++ ++G  A+ +
Sbjct  12   WCIGIDIGAHFFSTTVSKDGVAVDVPLEEHEQDDTKTHLLPAYVSVTDSDFIVGSEARKR  71

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKT----  117
                  NT+FD  R++GRK SD +   D+  WPFK+  G  DK  + ++      T    
Sbjct  72   AKSGDSNTIFDFVRIVGRKISD-LNAGDLSKWPFKVVPGDNDKAVVEIRTSTNGSTASVS  130

Query  118  ---FQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVL  174
               F PEE+ ++++  ++E  E  +G  V +AV+ VP  FN +Q +A ++A  IAGL   
Sbjct  131  FRMFHPEELLAVLVRCIKEKVEMMLGAVVDSAVVCVPGGFNHTQCRAVRNAFTIAGLRTE  190

Query  175  RIINEPTAAAIAYGLDKKGGERN-----VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDT  229
            +++   TA AI++GLD +    N     VL+ D+G  T D++L+S+    FEVKA   D 
Sbjct  191  KLLGAATATAISFGLDIRTDIANAAMQLVLVVDIGASTTDIALVSVLANKFEVKAVDSDL  250

Query  230  HLGGEDFDNRLVDHF----TQEFKRKHRKDITENQ---RALRRLRTACERAKRTLSSSAQ  282
             LGG+DF +R+  H     TQE        +   Q   + + ++R ACE AK+ LSSS  
Sbjct  251  GLGGDDFTDRIAAHCHRKKTQEVTPSGENAVANTQGYVKGVHQIRHACELAKKLLSSSLT  310

Query  283  AYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVH  335
            A +       GIDF +       T+TR  FE +C D ++  +E V +V++++  SK  + 
Sbjct  311  AVV-------GIDFPTSDTFGYYTVTRTGFEALCMDPWQHALERVHRVIQESSASKDDIT  363

Query  336  EVVLVGGSTRIPKEPN--KSINPDEAVAYGATVQAAILS--------GNdsseklqdlll  385
             V+LVGGS +IP+     K   P + V         ILS         +     +    L
Sbjct  364  TVLLVGGSFQIPRLQTLFKESFPSQEVVVAGAQSPPILSPARGAAAFSSAVRRGVPGAEL  423

Query  386  ldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDN  445
            L+VTPLSLG+++  G    +I RNT++P  KS  F  YA+ Q  V++ V EG+ + ++ N
Sbjct  424  LEVTPLSLGIQSVAGTRIMMIPRNTSIPVHKS--FLYYANCQHAVIVYVIEGD-NFSKPN  480

Query  446  NLLGKFN---LDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRL  502
             +L + +   +DG       V +ID+T DI++   + V+A E+S+G++    I+ D   +
Sbjct  481  EILHRLSSIRVDGSLATKHLVLKIDITIDINSLDQMTVTAAERSSGRKIATAISGDDTGM  540

Query  503  S  503
            S
Sbjct  541  S  541

>PYU1_G008851
Length=795

 Score = 224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 136/393 (35%), Positives = 207/393 (53%), Gaps = 32/393 (8%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSVARAHFKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E+I +MVL 
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQIVAMVLN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G +   AV++VP Y+ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDGVQPGYAVVSVPGYYTDVQRRALLNASKIAGLNTLRLINEHTAIALAYG  183

Query  189  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSIVAFVQGKLQVKSAAYDRFLGGRDFDYA  241

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  297
            L     ++F+ K++ D     ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKKFQEKYKTDPLAEAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK-----  352
            S IT   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+     +     
Sbjct  302  SQITLELFEELIEPLLQRLEGPIERALNDAGVEKSQLTSVEIVGGGTRVSSVKRRLSEIL  361

Query  353  -------------SINPDEAVAYGATVQAAILS  372
                         ++N DE+VA G  +Q AI S
Sbjct  362  GLDKDAQNYGLSTTLNADESVARGCALQCAISS  394

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 86/185 (46%), Gaps = 32/185 (17%)

Query  445  NNLLGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------------  484
            N  +GKF + GIP + +G  +P+I V    D NG+  V++ +                  
Sbjct  486  NTTIGKFTVSGIPELEKGAELPKIRVNVQQDINGLFAVASSQLMQEIKEEEKPAEEGKEG  545

Query  485  ---------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALE  535
                     K   ++  + +T + G LS +D+     +  K   +D   +     +N LE
Sbjct  546  EAEKPTEPKKKRFRKVDLKVTAEVGGLSSSDVLAATEQELKMAHQDRIIEETFNKRNELE  605

Query  536  NYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAE--KEEYEGKQKELEG  593
             + Y +RN ++D KL + +++ +K A+EDK+ E  +WL +++  +  K  Y+ K  EL  
Sbjct  606  TFVYEMRNQVSD-KLAEFVTDSEKAALEDKLNEMEDWLYSDEGFDTTKSVYQAKLDELRQ  664

Query  594  VANPI  598
              +P+
Sbjct  665  STSPL  669

>PHYRA_53570
Length=395

 Score = 214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 146/395 (37%), Positives = 202/395 (51%), Gaps = 41/395 (10%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNAHN  68
            VGIDLGTTYS V + Q + V  IA+D+G    PS VAF    E L+G  A+     +  +
Sbjct  1    VGIDLGTTYSVVAISQKNNVTAIADDEGYILVPSTVAFLPHGEMLVGREARAHRTTDPQH  60

Query  69   TVFDAKRLIGRKFSDPIVQAD-----IKHWPFKLTSGAGD---KPQITVQFKGESKTFQP  120
            T+F+AKR IGRK+ D +V+++     I  + F +    G+       ++    +     P
Sbjct  61   TIFNAKRFIGRKY-DEVVRSEADSNGITPYEFVVKPAQGNVHGGVCFSLDLPEQPDCVTP  119

Query  121  EEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             +I S V+  +R +A  F+G  ++  AVI VP  F+  QR AT  A   AGL V R++ E
Sbjct  120  VQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVEFDAQQRDATVAAFREAGLEVSRVLEE  179

Query  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            PTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D  
Sbjct  180  PTAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDAL  239

Query  240  LVDHFTQEFKRKHRKDIT------------ENQRA----LRRLRTACERAKRTLS--SSA  281
            L D   ++F+ +    IT            E+  A    L  +R A E  KR L+  S+A
Sbjct  240  LADWLAKQFEAQLGTPITSRGTEANVKNFDEDGMAPPCTLAGVRHAAELLKRQLTDFSTA  299

Query  282  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  341
             A          +      TR +FE +CG    +TM PV ++L    +   ++  VVLVG
Sbjct  300  SAACVWRKGTKVVRAEVKTTRTQFEALCGSLLERTMVPVREILEANNMETEEIDAVVLVG  359

Query  342  GSTRIP------------KEPNKSINPDEAVAYGA  364
            GS+R+P            + P  +I+PD AVAYGA
Sbjct  360  GSSRVPWVRQHLTEMFQGRAPLSNIDPDLAVAYGA  394

>PHYCA_111740
Length=810

 Score = 223 bits (569),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 132/391 (34%), Positives = 208/391 (53%), Gaps = 28/391 (7%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +IK   +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIKQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE T+ A+AYG
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTSIALAYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +   ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                 +F  K++ +  EN ++  +L +ACE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +T   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+             
Sbjct  304  VTLEEFEELIAPLLQRLDGPIERALADAGIEKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  348  -KEP-----NKSINPDEAVAYGATVQAAILS  372
             KE      + ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 82/191 (43%), Gaps = 41/191 (21%)

Query  448  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------------------  484
            +GK+ + G+P    G  +P+I V    D NG+ +V++ +                     
Sbjct  490  IGKYTISGMPAQEAGAEIPKIRVNVQQDMNGLFSVASSQLMQEIKEEEKPAEAEGDKKEG  549

Query  485  ---------------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIE  529
                           K   ++ ++T+    G LS AD+     +  K   +D   +    
Sbjct  550  EEKDEKKDDKPAEPKKKRFRKIELTVQAQVGGLSPADVSTATEQELKMAQQDRVIEETFN  609

Query  530  AKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWL--DANQSAEKEEYEGK  587
             +N LE++ Y +RN + D KL   I+ D+K  +E K+ ET +WL  D    + K  Y+ K
Sbjct  610  KRNELESFVYEMRNQITD-KLAGFITGDEKSNLETKLMETEDWLYTDEGFDSTKSVYQQK  668

Query  588  QKELEGVANPI  598
              ++  +++P+
Sbjct  669  LDDMRKLSSPV  679

>SPRG_10476
Length=270

 Score = 209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 178/276 (64%), Gaps = 22/276 (8%)

Query  329  LSKSQVHEVVLVGGSTRIPK------------EPNKSINPDEAVAYGATVQAAILSGNds  376
            +  +++ E+VLVGGSTRIPK            E +KSINPDEAVAYGA VQ AILSG   
Sbjct  1    MKPNEITELVLVGGSTRIPKVQNMLSAVFGGKELSKSINPDEAVAYGAAVQGAILSG-IR  59

Query  377  seklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  436
            ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P KK++ ++T +D Q  V + ++E
Sbjct  60   NDATNSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIPVKKTRVYTTESDYQTQVNVVIYE  119

Query  437  GERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  496
            GER+    NN LG+F + GI    RG PQ++VTF+IDANGILNVSA +K T  + + TI+
Sbjct  120  GERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDANGILNVSARDKKTNAKAETTIS  179

Query  497  NDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISE  556
            N+ GRLSQADIDRMV EAEK+K ED     +IEA+N+LE + Y         +  +   E
Sbjct  180  NNHGRLSQADIDRMVEEAEKFKKEDAEALKKIEARNSLEGFIY---------RALELTRE  230

Query  557  DDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELE  592
                A E+ + E   WL+ ++ A   E E K++ LE
Sbjct  231  KGDAAAENTIREAREWLEDHEDATLRELEEKKRVLE  266

>PHYCA_120845
Length=444

 Score = 214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 141/392 (36%), Positives = 199/392 (51%), Gaps = 37/392 (9%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V + + + V  IA+ +G+   PS VAF  D   L+G  A+     + 
Sbjct  50   HVVGIDLGTTYSVVAISRKNNVTAIADSEGHVLVPSTVAFLPDGGVLVGREARVHRTTDP  109

Query  67   HNTVFDAKRLIGRKF--SDPIVQADIKHWPF---KLTSGAGDKPQITVQFKGESKTFQPE  121
             +T+F+AKR IG+ +  +    +  +  + F   ++     D    ++  +G+     P 
Sbjct  110  QHTIFNAKRFIGQSYVMTSETNEKGVTPYEFVVKQMHRDEHDGICFSLSLQGQPDCVTPV  169

Query  122  EISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            +I + V+  +R +A  F+G  ++  AVI VP  FN  QR+AT  A   AGL V R++ EP
Sbjct  170  QIGTSVVKHLRLMAHQFVGHDQITKAVIAVPVDFNQKQREATVAAFRGAGLEVSRVLEEP  229

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D +L
Sbjct  230  TAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDAQL  289

Query  241  VDHFTQEFKRKHRKDITENQRA----------------LRRLRTACERAKRTLSSSAQAY  284
                  EF+ +    IT                     L  +R A E  KR L+ ++ A 
Sbjct  290  TAWLVGEFEAQLGTAITSRGTGDEVKTFDNDGKDPPCTLSGVRHAAELVKRQLTDASTAT  349

Query  285  IEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGST  344
                S  +G      ITR +FE++CG    +TM PV +VL    +   ++  VVLVGGS+
Sbjct  350  AACISGNEGAKVE--ITRTQFEELCGSLLERTMVPVREVLEANNMESDEIDAVVLVGGSS  407

Query  345  RIP------------KEPNKSINPDEAVAYGA  364
            RIP            + P   I+PD AVAYGA
Sbjct  408  RIPWVRRRLTDMFQGRAPLSDIDPDLAVAYGA  439

>PPTG_09003
Length=449

 Score = 214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 146/396 (37%), Positives = 196/396 (49%), Gaps = 39/396 (10%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V + Q + V  I + +G    PS VAF      L+G  A+    ++ 
Sbjct  49   HVVGIDLGTTYSVVAISQKNNVTAIKDKEGYVLVPSTVAFLPHGGVLVGREARAHRTLDP  108

Query  67   HNTVFDAKRLIGRKFSDPIV-QAD---IKHWPF---KLTSGAGDKPQITVQFKGESKTFQ  119
             +TVF+AKR IG+ + D +  +AD   +  + F    L     D    T+   G+     
Sbjct  109  QHTVFNAKRFIGQSYGDVLASEADENGVTPYEFGVKMLQDNKHDGVCFTLDLSGQPGCVT  168

Query  120  PEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            P EI + V+  +R +A  F+G  ++  AVI VP  FN  QR AT  A   AGL V R++ 
Sbjct  169  PVEIGTAVVRHLRSMAHNFVGHDQITKAVIAVPVDFNARQRDATVAAFRAAGLEVSRVLE  228

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D 
Sbjct  229  EPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDA  288

Query  239  RLVDHFTQEFKRKHRKDIT----------------ENQRALRRLRTACERAKRTLS--SS  280
            RL     ++F+ +    IT                E    +  +R A E  KR L+  S 
Sbjct  289  RLSAWLLKQFEAQLGAAITSRGSESEGKVSENGSNEPPCTMAGVRQAAELVKRQLTDVSV  348

Query  281  AQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  340
              A          +    T+TRA+FE++C     +TM PV  VL    +   ++  VVLV
Sbjct  349  TTAACISSGNKKPVRVEVTVTRAQFEELCDSLLERTMIPVRDVLESNNMDTDEIDAVVLV  408

Query  341  GGSTRIP------------KEPNKSINPDEAVAYGA  364
            GGS+RIP            + P   I+PD AVAYGA
Sbjct  409  GGSSRIPWVRQRLTDMFQGRPPLSDIDPDLAVAYGA  444

>PYIR_21692
Length=468

 Score = 214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 143/397 (36%), Positives = 205/397 (52%), Gaps = 42/397 (11%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  67   VGIDLGTTYSVVAISQKNNVSVIPDAFGHVIIPSIVAFLPGGDVLVGRQARAHRTKDPEH  126

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFK----GESKTFQPEEIS  124
            T+F+AKR IGR + D     D + + + +   +  +P+  V F+    G  K   P  + 
Sbjct  127  TIFNAKRFIGRIYDDVKQSKDDESYEYTVARASLSEPESGVCFQLSLPGHPKCVTPVSVG  186

Query  125  SMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            S ++  +R +A +F+G  ++  AVI VP  F+  QR AT+ A A AGL V RI+ EPTAA
Sbjct  187  SAIVRHLRAMAHSFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRILEEPTAA  246

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D+++ + 
Sbjct  247  AIAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDIDSQVAEL  306

Query  244  FTQEFKRK-------HRKDITENQRALRR-----------LRTACERAKRTLSSSAQAYI  285
             T+    +          D+ E    L             +R A E  KRTLSS      
Sbjct  307  LTEAIAARIGTTLTSMASDMEETDSELHEDPGQLPCTPAGIRRAAELLKRTLSSEGSGSA  366

Query  286  EIDSLFDGIDFNST------ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  339
                   G    S       +TRA+FED+CG+  ++T+ PV++++    ++  ++  VVL
Sbjct  367  SCIVQRSGTLLQSAEKVTIDMTRAQFEDICGEILKRTLTPVQEIISANHMTPEEIDAVVL  426

Query  340  VGGSTRIP------------KEPNKSINPDEAVAYGA  364
            VGGS+RIP            + P   I+PD AVAYGA
Sbjct  427  VGGSSRIPWVREHLAELFDGRAPLSDIDPDIAVAYGA  463

>PPTG_19375
Length=809

 Score = 222 bits (565),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 206/391 (53%), Gaps = 28/391 (7%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +K    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +   ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                 +F  K++ +  EN ++  +L ++CE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSSCEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +T   FE +     ++   P+E+ L DA + KSQ+  V +VGG TR+             
Sbjct  304  VTLEEFETLIEPLLKRLDGPIERALADAGIDKSQLTNVEIVGGGTRVTSVKRHLADVLGL  363

Query  348  -KEP-----NKSINPDEAVAYGATVQAAILS  372
             KE      + ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 82/188 (44%), Gaps = 38/188 (20%)

Query  448  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAV--------------------EK  485
            +GKF + G+P    G  +P+I V    D NG+ +VS+                     E 
Sbjct  491  IGKFTISGMPAQEAGAEIPKIRVNVQQDMNGLFSVSSSQLMQEIKEEEKPAEAEGEQKEG  550

Query  486  STGKENK-------------ITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKN  532
               KE+K             +T+    G LS AD+     +  K   +D   +     +N
Sbjct  551  EDKKEDKPAEPKKKRFRKIELTVQAQVGGLSVADVTTATEQELKMAQQDRVIEETFNKRN  610

Query  533  ALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWL--DANQSAEKEEYEGKQKE  590
             LE++ Y +RN + D KL   I+ D+K  +E K+ ET +WL  D    + K  Y+ K  +
Sbjct  611  ELESFVYEMRNQITD-KLAGFITSDEKNTLESKLMETEDWLYTDEGFDSTKSVYQQKLDD  669

Query  591  LEGVANPI  598
            +  +++P+
Sbjct  670  MRKLSSPV  677

>PHYRA_82545
Length=806

 Score = 221 bits (563),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 131/391 (34%), Positives = 206/391 (53%), Gaps = 28/391 (7%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ ++    +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQELAQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+A+G
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAFG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSVVAFVQGRLTVKSAAFDRFLGGRDFDMVIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                 +F  K++ +  EN ++  +L +ACE+AK+ LS       ++ I+ L D  D+N+ 
Sbjct  244  KDVATKFADKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNAQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            +T   FE +      +  +PVE+ L+DA + KSQ+  V +VGG TR+             
Sbjct  304  VTLEEFETLIAPLLERLDDPVERALKDAGIDKSQLTNVEIVGGGTRVTSVKRHLAEVLGL  363

Query  348  -KEP-----NKSINPDEAVAYGATVQAAILS  372
             KE      + ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNFGLSSTLNADESVARGCALNCAILS  394

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 83/189 (44%), Gaps = 39/189 (21%)

Query  448  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSA-----------------------  482
            +GK+ + G+P    G  VP+I V    D NG+ +V++                       
Sbjct  490  VGKYTISGMPAQEAGAEVPKIRVNVQQDMNGLFSVASSQLMQEIKEEEKPAETEGEEKKE  549

Query  483  ---------VEKSTGKENKI--TITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAK  531
                     VE    +  KI  T+ +  G LS AD+     +  K   +D   +     +
Sbjct  550  GEEKKEDKPVEPKKKRFRKIELTVQSQVGGLSTADVSTASEQELKMAQQDRVIEETFNKR  609

Query  532  NALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWL--DANQSAEKEEYEGKQK  589
            N LE++ Y +RN ++D KL   I+ ++K  +E K+ +T +WL  D    + K  Y+ K  
Sbjct  610  NELESFVYEMRNQISD-KLAGFITSEEKGNLETKLNDTEDWLYTDEGFDSTKSVYQQKLD  668

Query  590  ELEGVANPI  598
            ++  +++P+
Sbjct  669  DMRKLSSPV  677

>H310_06229
Length=800

 Score = 220 bits (560),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 131/392 (33%), Positives = 207/392 (53%), Gaps = 30/392 (8%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKFS P VQ +IK++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIKNYGFKCVELPSGQVGIVLNYNDNPVTYTCEQVVAMMLN  123

Query  130  KMREVAEAFIGKEVKNA--VITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            K++ +A A   + V+ A  V++ P YF D QR+A  +A  IAGLN LR++NE TA A+ Y
Sbjct  124  KLQNIA-AVANENVRPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGY  182

Query  188  GLDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            G+ K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L
Sbjct  183  GIYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFAL  242

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNS  298
                 ++F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S
Sbjct  243  AKDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSALNIECLVDEIDYAS  302

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP-----------  347
             ++   FE +      +   P++  L DA L+  ++  V +VGG  R+            
Sbjct  303  KVSLEEFETLIAPLLERLEAPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLADILG  362

Query  348  ---KEPN----KSINPDEAVAYGATVQAAILS  372
               ++PN     ++N DEAVA G  +Q AILS
Sbjct  363  LDKEKPNMGLSTTLNADEAVARGCALQCAILS  394

>PYIW_19956
Length=459

 Score = 212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 144/396 (36%), Positives = 205/396 (52%), Gaps = 41/396 (10%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  67
            + VGIDLGTTYS V + Q + V +I +  G+   PS VAF   E L+G  A+     +  
Sbjct  61   HVVGIDLGTTYSVVAIAQKNNVSVIPDAFGHVIIPSIVAFLPGEVLVGRQARAHRTRDPK  120

Query  68   NTVFDAKRLIGRKFSDPIVQADIKHWPFKL--TSGAGDKPQITVQFKGESKTFQPEEISS  125
            +T+F+AKR IGR + D +   D   + + +  T   G   Q++V   G  K   P  I S
Sbjct  121  HTIFNAKRFIGRTYKDVVQSKDDASYEYTVARTPEGGVCFQLSV--AGHPKCVTPVAIGS  178

Query  126  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             ++  +R +A  F+G  ++  AVI VP  F+  QR AT+ A A AGL V R+++EPTAAA
Sbjct  179  AIVSHLRAMAHRFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRVLDEPTAAA  238

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D+++    
Sbjct  239  IAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDIDSQVAAFL  298

Query  245  T------------------QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIE  286
            T                  +E   +H +D  +       +R A E  KRTLSS + +   
Sbjct  299  TEAIAARIGTTLTSMASDMEESDSEHNEDPEQLPCTPAGIRRAAELLKRTLSSHSASSAS  358

Query  287  IDSLFDGIDFNST------ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  340
                  G    S       +TRA+FE+MC +   +T+ PV++++    ++  ++  VVLV
Sbjct  359  CVVQHSGTLLQSGEKVTIDVTRAQFEEMCAEILGRTLVPVQEIISANHMTPEEIDAVVLV  418

Query  341  GGSTRIP------------KEPNKSINPDEAVAYGA  364
            GGS+RIP            + P   I+PD AVAYGA
Sbjct  419  GGSSRIPWVRSNLATMFNGRAPLSDIDPDVAVAYGA  454

>PHALS_08498
Length=895

 Score = 220 bits (560),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 190/724 (26%), Positives = 319/724 (44%), Gaps = 139/724 (19%)

Query  4    SVSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            ++     G+D G  Y  V  V      EI+ N    R T + VAF   ERL G  A    
Sbjct  20   TIDAIVAGVDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAATVG  79

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
                       +RL+G K SDP V A  D +H P++L   A     + +Q  G+ + F  
Sbjct  80   VRRPQTAYMQIRRLLGTKLSDPQVIALRDEEHLPYELIQNATRGGTVMLQH-GKKQFFHA  138

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+ +MV    R++ + F    VK+ V+TVP YF+ +QRQA  DA  I+G+ VL +INE 
Sbjct  139  EELVAMVFTHARQITDTFAEASVKDWVLTVPTYFSQAQRQAMLDAADISGVRVLSLINEN  198

Query  181  TAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEE-------------GIFEVK  223
            TAAA+   +    D +   + +L +++G  +  VS+                   IF+  
Sbjct  199  TAAALQLAVHSSFDPEEKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISIFQTI  258

Query  224  ATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQA  283
            + A D  LGG  FD RL +H  QEF  K  +DI +  R + ++R   ++ K  LS++ + 
Sbjct  259  SNAWDESLGGAKFDLRLAEHLAQEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEI  318

Query  284  YIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGS  343
             + + SL + IDF +++TR + E +  D F +T++PVE  L  A L+ + + E+ L+GG 
Sbjct  319  PVVMQSLHNDIDFFTSMTRTKLEALSSDLFERTLKPVEVALEKAGLTAADIDEIELIGGG  378

Query  344  TRIPKEPNK------------SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtpl  391
             R+PK   +             +N DEA+A GA  +AA LS +    ++    +      
Sbjct  379  VRMPKIQQQLSEFFVGKDLGVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDIATYPIG  438

Query  392  slglETAGGVMT---------------TLIARNTTVPTKKSQTFSTYAD-------NQPG  429
               ++ +   +T                L + +  +  +KS +FS  +D       ++P 
Sbjct  439  VRLVDLSSSELTNNKEEEDMKQWMKRAALFSESHRLGVRKSVSFSHSSDLSCTFRYDKPS  498

Query  430  VL-IQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVS  481
            +L + V          N  +G FN+ G+            G P++ +TF++D+NGI  ++
Sbjct  499  MLPVGV----------NVHIGTFNVTGVEKFAARMADKNLGEPKVTLTFELDSNGIAQIA  548

Query  482  AVEKS-----------------------------------------------------TG  488
              E +                                                     T 
Sbjct  549  KAEATLEEEVEVEVVLKKEKKSKKSKKEDSSTDSSAAGDEKMVEEEEKPETRMEKQIKTH  608

Query  489  KENKITITNDKGRLSQADIDRM-VSEAEKYKS-------EDEANKVR--IEAKNALENYA  538
            +E  I +     R  + D+  + +SE  K +S       E++ NK R  +EAKN LE + 
Sbjct  609  REKLIVVRAHDAREPEDDVSVLPMSEHAKKESMRMLREMENDDNKRRADLEAKNNLETFI  668

Query  539  YNLRNTLN--DEKLKDQISEDDKKAIEDKVTETINWL-DANQSAEKEEYEGKQKELEGVA  595
            Y   + L+  + ++K     +  ++++ K+TET  WL +  + AE  EY+ + +EL+   
Sbjct  669  YTAHDALSAQESQIKLVTIPEQLESLQKKLTETEEWLYNDGEHAEAAEYKTRMEELKLEL  728

Query  596  NPIL  599
            + IL
Sbjct  729  DSIL  732

>PHYKE_6664
Length=804

 Score = 218 bits (555),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 129/391 (33%), Positives = 206/391 (53%), Gaps = 28/391 (7%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    ++    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYECVELASGDVGIVLSYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+A+G
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALMNATKIAGLNCLRLINEHTAIALAFG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                ++F  K++ D   + ++  +L +ACE+AK+ LS       +I I+ L D  D+N+ 
Sbjct  244  QDVAKKFAEKYKTDPLAHPKSRLKLLSACEKAKKNLSPYGVTATHINIECLADDRDYNAQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            ++   FE +     ++   P+E+ L+DA + KSQ+  V +VGG TR+             
Sbjct  304  VSLEEFEVLIAPLLKRLDGPIERALKDAGIDKSQLTSVEIVGGGTRVTSVKRQLADVLGL  363

Query  348  -KEP-----NKSINPDEAVAYGATVQAAILS  372
             KE      + ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 83/184 (45%), Gaps = 34/184 (18%)

Query  448  LGKFNLDGIPPMPRGV--PQIDVTFDIDANGILNVSAVE---------------------  484
            +GK+ + G+P    G   P+I V    D NG+ +VS+ +                     
Sbjct  491  VGKYTISGMPAQDAGAEAPKIRVNVQQDMNGLFSVSSSQLMQEIKEEEKPAEEKEGEEKV  550

Query  485  --------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALEN  536
                    K + ++ ++T+    G L+ AD+     +  K   +D   +     +N LE+
Sbjct  551  EDKPAEPKKKSFRKIELTVQAQVGGLTTADVSAATEQELKMAQQDRVIEDTFNKRNELES  610

Query  537  YAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWL--DANQSAEKEEYEGKQKELEGV  594
            + Y +RN ++D +L   I+ ++K  +E+++ ET +WL  D    + K  Y+ K   +  +
Sbjct  611  FVYEMRNQISD-RLAGFITAEEKSKLEEQLMETEDWLYTDEGFDSTKSVYQTKLDGMRKL  669

Query  595  ANPI  598
            ++P+
Sbjct  670  SSPV  673

>PHYSO_247517
Length=794

 Score = 217 bits (553),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 179/643 (28%), Positives = 298/643 (46%), Gaps = 93/643 (14%)

Query  45   VAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDK  104
            V     +R IG+AA +   M+  NT  D KRLIGRKF  P VQ +I    +K    A   
Sbjct  24   VCVQGKQRFIGEAAISMARMHYKNTATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGD  83

Query  105  PQITVQFKGESKTFQPEEISSMVLIKMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATK  163
              I + +  E  TF  E++ +M+L KM+ +A A   G      V++ P ++ D QR+A  
Sbjct  84   VGIVLNYNDEPVTFSCEQVVAMILNKMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALL  143

Query  164  DAGAIAGLNVLRIINEPTAAAIAYGLDK-------KGGERNVLIFDLGGGTFDVSLLSIE  216
            +A  IAGLN LR+INE TA A+AYG+ K       +   ++V+  DLG  ++ VS+++  
Sbjct  144  NATKIAGLNCLRLINEHTAIALAYGIYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFV  203

Query  217  EGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRT  276
            +G   VK+ A D  LGG DFD  +      +F  K++ +  EN ++  +L +ACE+AK+ 
Sbjct  204  QGRLTVKSAAFDRFLGGRDFDMVIAKDAAAKFAAKYKTNPLENPKSRIKLLSACEKAKKN  263

Query  277  LSSSA--QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  334
            LS       ++ I+ L D  D+NS +T   FE++      +   P+E+ L DA + KSQ+
Sbjct  264  LSPYGVTATHLNIECLADDRDYNSQVTLEEFEELIAPLLTRLDGPIERALADAGVEKSQL  323

Query  335  HEVVLVGGSTRIP-------------KEP-----NKSINPDEAVAYGATVQAAILSGNds  376
              V +VGG TR+              KE      + ++N DE+VA G  +  AILS    
Sbjct  324  ANVEIVGGGTRVTSVKRHLAEVLGLDKEQQNYGLSTTLNADESVARGCALNCAILSPMFK  383

Query  377  seklqdlllldvtplsl------------------glETAGGVMTTLI--ARNTTVPTKK  416
             ++      + +                        +ET     ++L+  +R    P  K
Sbjct  384  VKEFSVTDRVHLPVRVSWDGSASTATDAADDDEDVNMETPASEDSSLVILSRKDEYPKTK  443

Query  417  SQTFSTYADNQPGVLIQVF-EGERSMTRDNNLL--GKFNLDGIPPMPRG--VPQIDVTFD  471
              TF     ++P  +  V+ E  ++    + ++  GKF + G+P    G  +P+I V   
Sbjct  444  RITFRR---DKPFSIDAVYDESAKAYLPPDYVMDIGKFTVSGMPAQEAGAEIPKIRVNVQ  500

Query  472  IDANGILNVSAVE----------------------------------KSTGKENKITITN  497
             D NG+ ++++ +                                  K   ++ ++T+  
Sbjct  501  QDMNGLFSIASSQLMQEIKEEEKPAEAEGEEKKEGEEKKEDKPAEPKKKRFRKIELTVQA  560

Query  498  DKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLKDQISED  557
              G LS AD+     +  K   +D   +     +N LE++ Y +RN + D KL   I+ +
Sbjct  561  QVGGLSAADLTTATEQELKMAQQDRVIEETFNKRNELESFVYEMRNQITD-KLAGFITSE  619

Query  558  DKKAIEDKVTETINWL--DANQSAEKEEYEGKQKELEGVANPI  598
            +K  +E K+ ET +WL  D    + K  Y+ K  +L  +++P+
Sbjct  620  EKGNLEAKLMETEDWLYTDEGFDSTKSVYQQKLDDLRKLSSPV  662

>PITG_17383
Length=438

 Score = 209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 146/398 (37%), Positives = 196/398 (49%), Gaps = 41/398 (10%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V + Q + V  IA+  G+   PS VAF  +   L+G  A+     + 
Sbjct  36   HVVGIDLGTTYSVVAISQKNNVTAIADKNGHVLVPSTVAFLPSGAVLVGREARAHRTTDP  95

Query  67   HNTVFDAKRLIGRKFSDPIV-QADIKHW-PFK-----LTSGAGDKPQITVQFKGESKTFQ  119
             +T+F+AKR IG+ + D +  +AD     P++     L     D    T+  +   K   
Sbjct  96   QHTIFNAKRFIGQSYEDVLTSEADENGGTPYEFSVKMLRDNEHDGVCFTLDLQDHPKCVT  155

Query  120  PEEISSMVLIKMREVAEAFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            P  I + V+  +R +A  F+G E +  AVI VP  FN+ QR AT  A   AGL V R++ 
Sbjct  156  PVNIGTAVVQHLRSMAHQFVGHEQITKAVIAVPVDFNNRQRDATVAAFRAAGLAVSRVLE  215

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D 
Sbjct  216  EPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDA  275

Query  239  RLVDHFTQEFKRKHRKDIT------------------ENQRALRRLRTACERAKRTLS--  278
            RL     +EF+      IT                  E    +  +R A E  KR L+  
Sbjct  276  RLSAWLLKEFEAHLGTAITSRGAETETKATSVDNDSKEPPCTVAGVRQAAELLKRQLTDA  335

Query  279  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  338
            S A A    +     +      TR +FE +CG    +T+ PV +VL    +   ++  VV
Sbjct  336  SVATAACIWNDGKKTVRVEVRATRVQFEKLCGSLLERTIIPVREVLEANNMDTDEIDAVV  395

Query  339  LVGGSTRIP------------KEPNKSINPDEAVAYGA  364
            LVGGS+RIP            + P   I+PD AVAYGA
Sbjct  396  LVGGSSRIPWVRQRLTDMFEGRPPLSDIDPDLAVAYGA  433

>PYU1_G006843
Length=481

 Score = 208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 137/397 (35%), Positives = 198/397 (50%), Gaps = 42/397 (11%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNAHN  68
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  80   VGIDLGTTYSVVAISQKNNVTVIPDVLGHVLIPSMVAFVPGGKVLVGRDARAHRTKDPAH  139

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQ---ITVQFKGESKTFQPEEISS  125
            T+F+AKR IGR + D +   D   + F ++    D        V   G  K   P  I +
Sbjct  140  TIFNAKRFIGRTYEDVVQSKDAASYEFAVSKAPNDVHHGVCFPVNVPGHRKCVSPIAIGA  199

Query  126  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             ++  +R +A AF+G  ++  AVI VP  F+  QR AT+ A   AGL+V RI+ EPTAAA
Sbjct  200  TIVGHLRAMAHAFVGHNQITKAVIAVPVDFDGVQRAATQKAFFAAGLHVSRILEEPTAAA  259

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGL +      +L+FD GGGT DVSLL    G   V  T GD +LGGED D ++ +  
Sbjct  260  IAYGLHQDPSVNFILVFDFGGGTLDVSLLFTRAGSINVVDTIGDNNLGGEDLDAKVAEVL  319

Query  245  TQEFKRKHRKDITENQR-------------------ALRRLRTACERAKRTLS--SSAQA  283
            T +   +    +T                        L  +R A E  KRTLS  +SA A
Sbjct  320  THKIAERIGTTLTSATSDMEETYSDRTNDDPDQLPCTLAGIRRAAELLKRTLSYETSATA  379

Query  284  YIEIDSLFDGIDFNSTI----TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  339
               +    + +    T+    TR   E++C +   +T+ PV++++    ++  ++  VVL
Sbjct  380  SCVVQMSGELLQARETVSIEMTRTELEEICSELLARTLVPVKEIIEANHMTSEEIDAVVL  439

Query  340  VGGSTRIP------------KEPNKSINPDEAVAYGA  364
            VGGS+RIP            + P   I+ D AVAYGA
Sbjct  440  VGGSSRIPWVREHLAKMFDGRAPLSDIDRDVAVAYGA  476

>PYU1_G000896
Length=711

 Score = 213 bits (541),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 184/651 (28%), Positives = 313/651 (48%), Gaps = 73/651 (11%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEI----------IANDQGNRTTPSYVAFTDTERLIGDA  57
            + +GID GT + C      D + +          I +++     P++V+ TDT  LIG  
Sbjct  58   WVLGIDFGT-HLCSAAVSRDGIVVDVPVPGDAAAIDDNKSPLAVPAFVSVTDTGYLIGTE  116

Query  58   AKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES--  115
            A+        NTVFD  RL+GRK  D +  AD   WPF + +G  DK  + +     S  
Sbjct  117  ARTLARRGDLNTVFDLTRLVGRKVGD-LSDADQARWPFHVVAGDHDKVLVAILGTNNSVS  175

Query  116  --KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNV  173
              +   PEE+ +++ ++++E AEA +  +++ AV+ VP  FN +QR+A ++AG IAGL+V
Sbjct  176  NPRKLYPEELLAVLFLQLKENAEALLHTKLQTAVLCVPEGFNHTQRRAVRNAGMIAGLSV  235

Query  174  LRIINEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIE-EGIFEVKATAGD  228
             R++   TAAA+++G+          R ++  D+G    +++L++++   +FEVKA A D
Sbjct  236  TRLVCAATAAAVSFGIGSSVPSSLSTRVIMTVDIGASATNMALVAVKNRTVFEVKAVASD  295

Query  229  THLGGEDFDNRLVDHFTQEFKRKHRK------------DITENQ-RALRRLRTACERAKR  275
             +LGG D    +V H  +       +            D +E+Q   +R++R A E AK+
Sbjct  296  LNLGGHDLTEAIVAHCQRRRPTPSPRFCVSSASASTPADTSESQLHGMRQIRHASEVAKK  355

Query  276  TLSSSAQAYIEIDSLFDGIDFN-STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  334
             LS+S  A + ID   D   F    +TRA FE +C +++++  E + ++L+++  +K  +
Sbjct  356  LLSTSTNAVVGID-FPDPSAFGYYNVTRACFEALCEEHWQRIRELMNQLLQESLATKEGI  414

Query  335  HEVVLVGGSTRIPKEPN--KSINPDEAVAYG----ATVQAAILSGNds------seklqd  382
              +VL+GGS  IP+     +   P   V Y     ++ + A L G  S            
Sbjct  415  DAIVLLGGSAWIPRVQTLVQESFPLHHVLYTPEDVSSARGAALCGGKSRNTQNGISTAPA  474

Query  383  lllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMT  442
            + L DVT L LG+++A G    +I  NT +P  KS  F  YA+ Q  V+  V EG     
Sbjct  475  VELPDVTLLPLGIQSANGTKIVMIPSNTKLPVHKS--FLYYANCQHAVVFHVIEGRVFNI  532

Query  443  RDNNL-----------LGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKEN  491
            +  +L           L    +DG       V +ID+TFD+D    + V+A E+S+G++ 
Sbjct  533  KPGSLSKNPASAALHELASVRVDGRHATTHVVLKIDITFDVDTLDQIIVTATERSSGRKV  592

Query  492  KITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLK  551
             + I  D+  LS   I    + A  +    ++  + +  +N++    +   + L      
Sbjct  593  TVCIDGDETSLSVNAIAH--ANARLFHRIQDSTAMVLVPRNSVLQIPHLTGHLL------  644

Query  552  DQISEDDKKAIEDKVTETINW-LDANQSAEKEEYEGKQKELEGVANPILQK  601
              +S DD   + D+  + +   +DA+Q  E     G  KEL    +  L K
Sbjct  645  --LSTDDPMKLLDEYVQALRIAIDADQ-LEGTTISGHDKELVHTISSTLTK  692

>CCA27145
Length=463

 Score = 205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 134/402 (33%), Positives = 201/402 (50%), Gaps = 45/402 (11%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  66
            + +GIDLGTTYS V + Q++ V II +   +   PS V F  +   L+G  A+     + 
Sbjct  57   HVIGIDLGTTYSVVAISQHNNVTIIPDRHHHTLIPSIVTFLPEGALLVGRQARAYRTKDP  116

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHW---PFKLTSGAGDK----PQITVQFKGESKTFQ  119
             +T+++AKR IGR +++ I  A+   +   PF+  S +  +    P  ++   G      
Sbjct  117  RHTIYNAKRFIGRSYNESIQAAEPYGFSIEPFRNESASEPESLPGPCFSLSVSGHPACVT  176

Query  120  PEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            P EI S+++  +  +A  F+   ++   VI VP  F  +QR+AT  A   AGL V R++ 
Sbjct  177  PIEIGSLIIRHLHLMAHEFVKHNQLDRVVIAVPVDFKPAQRRATVQAYEKAGLKVARVLE  236

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G   V  T GD +LGGED DN
Sbjct  237  EPTAAAIAYGLHQAPNVNFILVFDFGGGTLDVSLLFVRSGSISVVDTLGDNNLGGEDLDN  296

Query  239  RLVDHFTQEFK------------------RKHRKDITENQRALRRLRTACERAKRTLSSS  280
             + +H T + +                   +  +D  +    +  +R A E  KR LS S
Sbjct  297  LVSNHLTSQLEALLGMKLAEASSEVMETDSEKNEDPDQLPCTIAGIRRAAEILKRKLSFS  356

Query  281  AQAYIEIDSLFDGIDF-------NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQ  333
              A         G            +++R  FE +C     + + PV ++LRD  ++   
Sbjct  357  DSAIASCIVQEPGGKLIPQDNRVEISMSRIEFEALCEPILERALIPVRQILRDNHMNPKS  416

Query  334  VHEVVLVGGSTRIP-----------KEPNKSINPDEAVAYGA  364
            + EVVLVGGS+RIP           K+P  +I+PD AVA+GA
Sbjct  417  IDEVVLVGGSSRIPWIHTQLEELFGKQPRITIDPDVAVAFGA  458

>PPTG_04054
Length=324

 Score = 200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 177/305 (58%), Gaps = 32/305 (10%)

Query  81   FSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIG  140
            FSD +++ D  ++ F       DK  I              EISSMV+++M E+AEAF+G
Sbjct  2    FSDKVMKKDATYFLFTTKESDDDKVLI--------------EISSMVVLRMSEMAEAFLG  47

Query  141  KEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGG----ER  196
            + +  AV+T PAYFN+ QRQ+TKD  +IAGL++ RI NE + AA+AYGLD   G      
Sbjct  48   QRISQAVVTAPAYFNNQQRQSTKDVVSIAGLDLQRINNETSVAALAYGLDTNAGTDGKAC  107

Query  197  NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRK-D  255
            NV IF LGGGT DVS+LSI     EVK+T GD+   GED DN +V H   EF+RK R  D
Sbjct  108  NVQIFVLGGGTVDVSILSIRVRHLEVKSTGGDS---GEDSDNNMVQHLLTEFERKIRNLD  164

Query  256  ITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST-ITRARFEDMCGDYFR  314
             + + RA   + TACE AKR L ++  A +E+ SLF+G++F+ST +TRA+FE +  + F+
Sbjct  165  PSGSARA--SVVTACESAKRMLLTTTSASVEVTSLFEGVEFSSTVVTRAKFESLNEELFK  222

Query  315  KTMEPVEKVLRDAKL-----SKSQVHEVVLVGGSTRIPKEPNKSIN-PDEAVAYGATVQA  368
            +    V KVL DAK+     S S+V   V       +P++    ++ P         VQ 
Sbjct  223  RCEVTVFKVLEDAKMKPEDWSGSEVLH-VFPHAVHAVPRQGAVQVSQPGRGSHLRCAVQG  281

Query  369  AILSG  373
            A L G
Sbjct  282  ATLDG  286

>HYAP_01538
Length=130

 Score = 191 bits (485),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 89/93 (96%), Positives = 92/93 (99%), Gaps = 0/93 (0%)

Query  1   MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
           MAQ+VSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1   MAQTVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61  QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHW  93
           QVAMNAHNTVFDAKRLIGRKFSD +VQAD+KHW
Sbjct  61  QVAMNAHNTVFDAKRLIGRKFSDAVVQADVKHW  93

>SDRG_03266
Length=792

 Score = 209 bits (531),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 129/391 (33%), Positives = 198/391 (51%), Gaps = 28/391 (7%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFSCEQVVGMFLN  123

Query  130  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A  A  G      VI+ P YF D QR+A   A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSASKIAGMNCLRLMNEHTAVALSYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFIDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
               +++F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+             
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  348  --KEPN----KSINPDEAVAYGATVQAAILS  372
              ++PN     ++N DEAVA G  +Q AILS
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAILS  394

>SPRG_08060
Length=793

 Score = 208 bits (530),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 129/391 (33%), Positives = 198/391 (51%), Gaps = 28/391 (7%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFTCEQVVGMFLN  123

Query  130  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A  A  G      VI+ P YF D QR+A   A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSAAKIAGMNCLRLMNEHTAVALSYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFVDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
               +++F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------  347
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+             
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  348  --KEPN----KSINPDEAVAYGATVQAAILS  372
              ++PN     ++N DEAVA G  +Q AILS
Sbjct  364  DKEKPNMGLSTTLNADEAVARGCALQCAILS  394

>HYAP_07918
Length=897

 Score = 209 bits (533),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 135/404 (33%), Positives = 212/404 (52%), Gaps = 37/404 (9%)

Query  5    VSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQV  62
            V     G+DLG+ +  V  V      EI+ N    R T + VAF   ERL G DAA   V
Sbjct  23   VDAVVAGVDLGSEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TV  80

Query  63   AMNAHNTVF-DAKRLIGRKFSDPIVQADI--KHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
             +    T +   +RL+G K SDP V + +  +H+P++L S A     I ++   ++ TF 
Sbjct  81   GVRKPQTAYAQIRRLLGTKLSDPQVVSLLTDEHFPYQLVSNATRGGAIALKHANDA-TFH  139

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+ +MVL   R++   F    VK+ V+TVP +F+ +QRQA  DA  IAG+ VL +IN+
Sbjct  140  AEELVAMVLTHARQITNTFAEVPVKDYVLTVPTFFSQAQRQALLDAAEIAGVRVLSLIND  199

Query  180  PTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEV  222
             TAAA+   +    D     + VL ++LG     VS+ ++   +             FE 
Sbjct  200  NTAAALQLAVHTSYDPTEAPKRVLFYNLGSTALQVSIAAMSSQVVPDGFKKNKTVSTFET  259

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQ  282
             + A D  LGG  FD RL +H   EF ++  +DI    RA+ ++R    + K  LS++ Q
Sbjct  260  LSNAWDESLGGSKFDLRLAEHLATEFSQQIGQDIRTVPRAMAKIRAQAMKTKTVLSANEQ  319

Query  283  AYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  342
              + + SL + +DF +++TR + E++  D F +T++PVE+ L  A L+ + + E+ L+GG
Sbjct  320  IPVVMQSLHNDVDFFTSMTRTKLEELSSDLFERTLKPVEQALEKAGLTVADIDEIELIGG  379

Query  343  STRIPKEPNK------------SINPDEAVAYGATVQAAILSGN  374
              R+PK  ++             +N DEA+A GA  +AA LS +
Sbjct  380  GVRMPKIQHQLSQFFAGKDLGVHLNGDEAMALGAAFRAANLSNS  423

 Score = 37.0 bits (84),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query  509  RMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTL--NDEKLKDQISEDDKKAIEDKV  566
            +M++E E   ++  AN   +EAKN+LE + Y   + +  +++++K     +  +A++ K+
Sbjct  649  QMLTEMENADNKRHAN---LEAKNSLETFIYKTHDAISAHEDEMKQVTVPEQIEALKKKL  705

Query  567  TETINWL-DANQSAEKEEYEGKQKELEGVANPIL  599
             ET  WL D  +  E  EY+ K   L+   + IL
Sbjct  706  EETEEWLYDDGERVEAVEYKKKMDALDSDLSAIL  739

>PHYCA_504114
Length=887

 Score = 207 bits (528),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 151/547 (28%), Positives = 260/547 (48%), Gaps = 82/547 (15%)

Query  5    VSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            V     G+DLG  +  +  V      EI+ N    R T + VAF   ERL G  A     
Sbjct  22   VDAIVAGVDLGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGV  81

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  121
                      +RL+G + SDP V +  D +H+P++L   A     I+++  G+S+TF  E
Sbjct  82   RRPQTAYAQIRRLLGTRLSDPQVSSLLDEEHFPYELVQNATRGGTISLKH-GKSQTFHAE  140

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            E+ +MV    R++ + F    VK+ V+TVP++F+ +QRQA  DA  I+G+ VL +INE T
Sbjct  141  ELVAMVFAHARQITDTFAEAAVKDWVLTVPSFFSQAQRQALLDAAEISGVRVLSLINENT  200

Query  182  AAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKA  224
            AAA+   +    D +   + +L +++G  +  VS+      +             F+  +
Sbjct  201  AAALQLAVHASYDPEDKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTIS  260

Query  225  TAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAY  284
             A D  LGG  FD RL +H   EF  K  +DI +  R + ++R   ++ K  LS++ +  
Sbjct  261  NAWDESLGGAKFDLRLAEHLATEFSEKIGEDIRKIPRPMAKIRAQAKKTKTVLSANEEIP  320

Query  285  IEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGST  344
            + + SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG  
Sbjct  321  VVMQSLYNDIDFFTSMTRSKLEELSSDLFDRTLKPVETALEKAGLTAADIDEIEIIGGGV  380

Query  345  RIPKEPNK------------SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtpls  392
            R+PK   +             +N DEA+A GA  +AA LS +    ++    L       
Sbjct  381  RMPKIQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDLATYPIGV  440

Query  393  lglETAG---------GVMT-------TLIARNTTVPTKKSQTFS-------TYADNQP-  428
              ++ +           V T       +L + +  +  +KS +FS       T+  ++P 
Sbjct  441  RLVDLSATEPKDNNDDDVETKQWMKRASLFSESHRLGLRKSVSFSHSNDISCTFRYDKPS  500

Query  429  ----GVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGI  477
                GV +Q+               KFN+ G+            G P++ ++F++D+NGI
Sbjct  501  MLPAGVSVQI--------------AKFNITGVEKFAARMADKNLGEPKVTLSFELDSNGI  546

Query  478  LNVSAVE  484
              ++  E
Sbjct  547  AQIAKAE  553

 Score = 40.4 bits (93),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query  509  RMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLN--DEKLKDQISEDDKKAIEDKV  566
            RM++E EK  ++  AN   +EAKN+LE + Y   + L+  + ++K+    +  ++++ K+
Sbjct  643  RMLNEMEKTDNKRRAN---LEAKNSLETFIYKAHDALSAQESQIKEVTVPEQVESLQRKL  699

Query  567  TETINWL-DANQSAEKEEYEGKQKELEGVANPIL  599
             ET  WL D     E  EY+ K  EL    + IL
Sbjct  700  EETEEWLYDDGDKVEAAEYKKKMDELNKDLSAIL  733

>PPTG_17083
Length=304

 Score = 194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 145/214 (68%), Gaps = 11/214 (5%)

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            EISSMV+++M+E+AEAF+G+ +  AV+T PAYFN+ QRQ+TKD  +I GL++ RI NE +
Sbjct  23   EISSMVVLRMKEMAEAFLGQRISQAVVTAPAYFNNQQRQSTKDVVSITGLDLQRINNETS  82

Query  182  AAAIAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
             AA+AYGLD   G      NV IF LGGGT DVS+LSI     EVK+T GD+    ED D
Sbjct  83   VAALAYGLDTNAGTDGKACNVQIFVLGGGTVDVSILSIRVRHLEVKSTGGDS---AEDSD  139

Query  238  NRLVDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
            N +V H   EF+RK R  D + + RA   + TACE AKR L ++  A +E+ SLF+G++F
Sbjct  140  NNMVQHLLTEFERKIRNLDPSGSARA--SVVTACESAKRMLLTTTSASVEVTSLFEGVEF  197

Query  297  NST-ITRARFEDMCGDYFRKTMEPVEKVLRDAKL  329
            +ST +TRA+FE +  + F +    V KVL DAK+
Sbjct  198  SSTVVTRAKFESLNEELFMRCEVTVFKVLEDAKM  231

>PYIR_25979
Length=438

 Score = 197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 202/387 (52%), Gaps = 53/387 (14%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQ-------GNRTTPSYVAFTDTERLIGDAAKN  60
            +SVGIDLGT      + ++  V  ++ D+        N   PS+V+ TD+  L+G  A+ 
Sbjct  34   WSVGIDLGTQVCSAALIRDGIVIDVSFDEEQQQDSSPNLLLPSFVSATDSGFLVGADARR  93

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGES-----  115
            +      +TVFD  RL+GRK  D   Q  +  WPFK+  G  DK  I +           
Sbjct  94   RARSGDPSTVFDFVRLVGRKIEDLSSQDILCKWPFKVVPGENDKAMIEISAIDTKDSAST  153

Query  116  ------KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIA  169
                  +TF PEE+ + +++K+++ AEA +  +V++ V+ VP  FN SQR+A ++A  IA
Sbjct  154  STSDVIRTFHPEELVAALIMKIKQKAEALVSAKVESTVVCVPGGFNHSQRRAVRNACVIA  213

Query  170  GLNVLRIINEPTAAAIAYGLDKKGG-------ERNVLIFDLGGGTFDVSLLSIEEGIFEV  222
            GL V +I++  TAA  ++G+ ++          + VL  D+G  + D+SL+S+    FEV
Sbjct  214  GLRVEKILSAATAAVTSFGMKEQNAGTAAGIPTQVVLAVDVGASSTDISLVSVLANKFEV  273

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITEN--------------QRALRRLRT  268
            KA   +  LGG+DF  R+V H  ++  R+      E                +   ++R 
Sbjct  274  KAVDSNLDLGGDDFTERIVTHCRRKKSREEAAAAPEPGDTVKTASSQTHGYSKGASQIRQ  333

Query  269  ACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVE  321
            ACE AK+ LSSS  A +       GIDF +       T+TR  FE +C D ++  +E V 
Sbjct  334  ACELAKKLLSSSENAVV-------GIDFPASDTFGYYTVTRFCFEALCEDLWQSLVEKVH  386

Query  322  KVLRDAKLSKSQVHEVVLVGGSTRIPK  348
            +V+ ++ + K  ++ V+L+GGS++IP+
Sbjct  387  RVIHESSVVKEDINAVLLMGGSSQIPR  413

>PYAP_19741
Length=885

 Score = 204 bits (520),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 127/401 (32%), Positives = 204/401 (51%), Gaps = 33/401 (8%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            +VS    G+D G  +  + + +     EI+ N    R T + VAF   ERL G  A    
Sbjct  21   AVSANVAGVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVG  80

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGES-KTFQ  119
                       +R +G    DP + + ++  ++P++L     +  + TV  K E+ + F 
Sbjct  81   VRRPQTCYAQVRRFLGTTPEDPAIASLLQEEYFPYELLQ---NDTRGTVALKHENDQVFH  137

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+ +MV    R++ +AF    VK+ V+TVP +F  +QRQA  DA  I+G+  L +INE
Sbjct  138  AEELVAMVFTHARQITDAFAEVPVKDWVLTVPDFFTQAQRQAMLDAAEISGVRALSLINE  197

Query  180  PTAAAIAYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKAT  225
             TAAA+   +     E R VL +++G  +  VS++     +             FEV + 
Sbjct  198  NTAAALQLAVHSTFPEPRRVLFYNMGSTSLQVSIVEFSSQVVPDGFKKNKTVSGFEVLSK  257

Query  226  AGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYI  285
            A D  LGG  FD RL +H   EF  K  +D+ +  R + ++R   ++ K  LS++ Q  +
Sbjct  258  AWDPLLGGAKFDLRLAEHLAAEFSEKLGEDVRQIPRPMAKIRAQAKKTKIVLSANEQIPV  317

Query  286  EIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  345
             + SL+  IDF +++TR +FE+MC D F + M+PVE+ L  A L+ + +HE+ ++GG  R
Sbjct  318  VMQSLYKDIDFFTSMTRGKFEEMCKDLFAQAMKPVEQALEKAGLTPADIHEIEIIGGGVR  377

Query  346  IPKEPNK------------SINPDEAVAYGATVQAAILSGN  374
            +PK   +             +N DEA+A GA   AA LS +
Sbjct  378  MPKIQQQLKEFFSGKDLGVHLNGDEAMALGAAFHAANLSNS  418

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 6/96 (6%)

Query  506  DIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLN--DEKLKDQISEDDKKAIE  563
            D  RM+ E E   ++  AN   +EAKN LE + Y  R+TL+  +E+ K   + +  +A+ 
Sbjct  642  DSMRMLREMEVADNQRRAN---LEAKNRLETFVYTARDTLSAQEEEFKAVTTSEQLEALN  698

Query  564  DKVTETINWL-DANQSAEKEEYEGKQKELEGVANPI  598
             K+ ET +WL D  +  E  EY  K K LE   N I
Sbjct  699  AKLEETEDWLYDEGEKVEAAEYNKKIKSLETDFNAI  734

>PHYRA_73661
Length=884

 Score = 204 bits (520),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 156/551 (28%), Positives = 261/551 (47%), Gaps = 88/551 (16%)

Query  5    VSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQV  62
            V     G+D G  +  +  V      EI+ N    R T + VAF   ERL G DAA   V
Sbjct  21   VEAIVAGVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TV  78

Query  63   AMNAHNTVFDA-KRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
             +    T +   +RL+G   SDP V A  D +H+P+ L   A     I+++  G+ + FQ
Sbjct  79   GVRRPQTAYSQIRRLLGTTLSDPQVSALLDEEHFPYDLVQNASRGGTISLK-HGKDQAFQ  137

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+ +MV    R++   F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE
Sbjct  138  AEELVAMVFAHARQITNTFAEAPVKDWVLTVPTFFSQAQRQALLDAAEISGVRVLSLINE  197

Query  180  PTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEV  222
             TAAA+   +    D +   + +L ++LG  +  VS+      +             FE 
Sbjct  198  NTAAALQLAVHASYDPEDKPKKILFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTISTFET  257

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQ  282
             + A D  LGG  FD RL ++   EF  K  +DI +  R + ++R   ++ K  LS++ +
Sbjct  258  ISNAWDESLGGAKFDLRLAEYLATEFSEKIGEDIRKVARPMAKIRAQAKKTKTVLSANEE  317

Query  283  AYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  342
              + + SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ L+GG
Sbjct  318  IPVVMQSLYNDIDFFTSMTRSKLEELSADLFERTIKPVEVALEKAGLTVADIDEIELIGG  377

Query  343  STRIP------------KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp  390
              R+P            K+ +  +N DEA+A GA  +AA LS +    ++    +     
Sbjct  378  GVRMPRIQQQLSEFFEGKDLSVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDIASYPV  437

Query  391  lslglETAGG-----------VMT-------TLIARNTTVPTKKSQTFS-------TYAD  425
                ++ +             V T        L + +  +  +KS +FS       T+  
Sbjct  438  GVRLVDLSASEPKDNDNNDDEVETKQWMKRAALFSESHRLGLRKSVSFSHSNDVSCTFRY  497

Query  426  NQP-----GVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDID  473
            ++P     GV +Q+              GKFN+ G+            G P++ ++F++D
Sbjct  498  DKPSMLPAGVSVQI--------------GKFNITGVEKFVARMADKNLGEPKVTLSFELD  543

Query  474  ANGILNVSAVE  484
            +NGI  ++  E
Sbjct  544  SNGIAQIAKAE  554

 Score = 37.7 bits (86),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query  509  RMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLN--DEKLKDQISEDDKKAIEDKV  566
            RM++E EK  ++  AN   +EAKN+LE + Y   + L+  + ++K     +  ++++ K+
Sbjct  646  RMLTEMEKADNKRSAN---LEAKNSLETFIYKAHDALSAQESQIKQVTVPEQVESLQSKL  702

Query  567  TETINWL-DANQSAEKEEYEGKQKELEGVANPIL  599
             ET  WL +  +  +  EY+ K   L+   + IL
Sbjct  703  EETEEWLYEDGEKVDAAEYKKKMDTLDSDLSAIL  736

>PYAP_21865
Length=481

 Score = 197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 138/410 (34%), Positives = 196/410 (48%), Gaps = 57/410 (14%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  67
            ++VGIDLGTTYS V + QN+ V +I ++ G+  TPS VA+    R    A + +   +  
Sbjct  71   HTVGIDLGTTYSVVAISQNNSVTVIPDEHGHLITPSIVAYLPNGRREARAYRTK---DPR  127

Query  68   NTVFDAKRLIGRKFSDPIVQADIKHWPFKLT-SGAGDKPQITVQFK----GESKTFQPEE  122
            +T+F+AKR IGR F D    A    WP++ T    G+    TV F+    G      P +
Sbjct  128  HTIFNAKRFIGRSFRDVSDDASTT-WPYEFTIKRYGEHDNATVCFELETVGHPNCISPVD  186

Query  123  ISSMVLIKMREVAEAFIGK-------------------EVKNAVITVPAYFNDSQRQATK  163
            + + ++  ++ +A  F+G                    ++  AVI VP  F+  QR AT 
Sbjct  187  VGTRIVQHLKTLAWRFVGHNQMGMIDNLLSGLTHNYCGQINRAVIAVPVDFDSKQRSATV  246

Query  164  DAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVK  223
             A   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V 
Sbjct  247  AAFNAAGLKVSRVLEEPTAAAIAYGLHQDASVNFILVFDFGGGTLDVSLLFARSGSISVI  306

Query  224  ATAGDTHLGGEDFDNRLVDHFTQEFKRK-------------HRK-DITENQRALRRLRTA  269
             T GD +LGGED D  +  H  Q  + K             H + D   +  AL   +  
Sbjct  307  DTMGDNNLGGEDLDAAIAHHLIQNLEVKLGAVSSGGSGVDAHEQLDHDGDSEALPCTKAG  366

Query  270  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTI---TRARFEDMCGDYFRKTMEPVEKVLRD  326
              RA   L  S  + +E  +     D N  I   +R   E +C    ++T+ PV ++L  
Sbjct  367  IRRAAEMLKRSLSSSLEASASCLTTDNNRVIMAMSRYELESICEAILKRTLVPVREILEA  426

Query  327  AKLSKSQVHEVVLVGGSTRIP------------KEPNKSINPDEAVAYGA  364
              ++   +  VVLVGGSTR+P            + P   I+PD AVAYGA
Sbjct  427  NSMTIQDIDAVVLVGGSTRLPWVRRELTAMFGGRPPLTDIDPDVAVAYGA  476

>PITG_15771
Length=883

 Score = 203 bits (517),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 126/402 (31%), Positives = 205/402 (51%), Gaps = 33/402 (8%)

Query  5    VSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            V     G+D G  +  V  V      EI+ N    R T + VAF   ERL G  A     
Sbjct  22   VEAIVAGVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGV  81

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  121
                      +RL+G   SDP V +  D +H+P++L   A     I+++  G+ +T+  E
Sbjct  82   RRPQTAYAQIRRLLGTTLSDPQVSSLLDEEHFPYELIQNATRGGTISLKH-GKEQTYHAE  140

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            E+ +MV    R++ + F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE T
Sbjct  141  ELVAMVFTHARQITDTFAEAPVKDWVLTVPTFFSQAQRQAMLDAAEISGVRVLSLINENT  200

Query  182  AAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKA  224
            AAA+   +    D +   + +L F++G  +  VS+      +             F+  +
Sbjct  201  AAALQLAVHASYDPEDKPKKILFFNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTIS  260

Query  225  TAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAY  284
             A D  LGG  FD RL +H  +EF  K  +DI +  R + ++R   ++ K  LS++ +  
Sbjct  261  NAWDESLGGAKFDLRLAEHLAKEFSDKIGEDIRKVARPMAKIRALAKKTKTVLSANEEIP  320

Query  285  IEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGST  344
            + + SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + EV ++GG  
Sbjct  321  VVMQSLYNDIDFFTSMTRSKLEELSSDLFERTLKPVEVALEKAGLTAADIDEVEIIGGGV  380

Query  345  RIPKEPNK------------SINPDEAVAYGATVQAAILSGN  374
            R+PK   +             +N DEA+A GA  +AA LS +
Sbjct  381  RMPKIQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

>HYAP_04460
Length=818

 Score = 199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 128/393 (33%), Positives = 201/393 (51%), Gaps = 30/393 (8%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +++   F     +     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFKHPEVQQELQQLAFTCVELSSGDVGIVLTYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P Y+ D QRQA  +A  IAGLN LR++NE TA A+AYG
Sbjct  124  KMQHIAAAANEGVTPAYCVLSCPGYYTDVQRQALLNASKIAGLNCLRLMNEHTAIALAYG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  D+G  ++ V++++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDVGHASYTVAVVAFVQGRLTVKSVAFDRFLGGRDFDLAIA  243

Query  242  DHFTQEFKRKHR--KDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  297
                 +F  K++    +  N +A  +L +ACE+AK+ LS    +   + I+ L +  D+N
Sbjct  244  KDAAAKFADKYKVANPLENNPKARMKLLSACEKAKKNLSPYGVSATQLNIECLAEDRDYN  303

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP----------  347
            + +T   FE +      +   PVE+ L DA L  + +  V +VGG TR+           
Sbjct  304  AQVTLEEFEALIAPLLERLNGPVEQALADAGLKATDLTNVEIVGGGTRVTSVKRHLAEVL  363

Query  348  ---KEP-----NKSINPDEAVAYGATVQAAILS  372
               KE      + ++N DE+VA G  +  AILS
Sbjct  364  GLDKEQQNYGLSSTLNADESVARGCALNCAILS  396

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 81/197 (41%), Gaps = 47/197 (24%)

Query  448  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------------------  484
            +GK+ + G+P    G  VP+I V    D NG+ +V++ +                     
Sbjct  492  IGKYTILGMPAQEAGAEVPKIRVNVQQDMNGLFSVASSQLMQEIKEEEKPADTEGDEKMD  551

Query  485  ---------------------KSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEA  523
                                 K   ++ ++ + +  G LS  D+     +  K   +D  
Sbjct  552  EKKEDESKKDDKKEDKVAGPKKKRFRKVELIVQSQVGGLSTTDVSSATEQELKMAQQDRV  611

Query  524  NKVRIEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWL--DANQSAEK  581
             +     +N LE++ Y +RN + D KL   I+ D+K  +E K+ +T +WL  D    + K
Sbjct  612  IEDTFNKRNELESFVYEMRNQITD-KLAAFITSDEKSNLEKKLVDTEDWLYTDEGFDSTK  670

Query  582  EEYEGKQKELEGVANPI  598
              Y+ K  ++  +++P+
Sbjct  671  SVYQQKLDDMRKLSSPV  687

>PHYSO_255506
Length=1228

 Score = 201 bits (511),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 153/551 (28%), Positives = 262/551 (48%), Gaps = 88/551 (16%)

Query  5    VSGYSVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQV  62
            V     G+D G  +  V + +     EI+ N    R T + VAF   ERL G DAA   V
Sbjct  358  VEAIVAGVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAAT--V  415

Query  63   AMNAHNTVF-DAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
             +    T +   +RL+G   SDP V A  D +H+P++L   A     +++Q   + + F 
Sbjct  416  GVRRPQTAYAQIRRLLGTTLSDPQVAALLDEEHFPYQLLQNATRGGTVSLQH-AKDRVFH  474

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+ +MV    R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE
Sbjct  475  AEELVAMVFAHARQITDTFAEAPVKDWVLTVPAFFSQAQRQAMLDAAEISGVRVLSLINE  534

Query  180  PTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEV  222
             TA+A+   +    D +   + +L +++G  +  VS+      +             F+ 
Sbjct  535  NTASALQLAVHASYDPEDKPKRILFYNMGSTSLQVSVAEFSSQVVPDGFKKNKTISTFQT  594

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQ  282
             + A D  LGG  FD RL +H  +EF  K  +DI +  R + ++R   ++ K  LS++ +
Sbjct  595  LSNAWDESLGGAKFDLRLAEHLAKEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEE  654

Query  283  AYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  342
              + + SL++ IDF ++ITR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG
Sbjct  655  IPVVMQSLYNDIDFFTSITRSKLEELSADLFDRTLKPVEVALEKAGLTVADIDEIEIIGG  714

Query  343  STRIPKEPNK------------SINPDEAVAYGATVQAAILSGNdssekl----------  380
              R+PK   +             +N DEA+A GA  +AA LS +    ++          
Sbjct  715  GVRMPKIQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDIASYPI  774

Query  381  -------qdlllldvtplslglETAGGV-MTTLIARNTTVPTKKSQTFS-------TYAD  425
                         D       +ET   +   +L + +  +  +KS +FS       T+  
Sbjct  775  GVRLVDLSATEPKDSDNNDDEVETKQWMKRASLFSESHRLGLRKSVSFSHSNDVSCTFRY  834

Query  426  NQP-----GVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDID  473
            ++P     GV +Q+               KFN+ G+            G P++ ++F++D
Sbjct  835  DKPSMLPAGVSVQI--------------SKFNITGVEKFVERMAEKNLGEPKVTLSFELD  880

Query  474  ANGILNVSAVE  484
            +NGI  ++  E
Sbjct  881  SNGIAQIAKAE  891

 Score = 38.1 bits (87),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query  509   RMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLN--DEKLKDQISEDDKKAIEDKV  566
             RM++E EK  ++  AN   +EAKN+LE + Y   + L+  + ++K+    +  ++++ K+
Sbjct  982   RMLTEMEKADNKRRAN---LEAKNSLETFIYKAHDALSAQESQIKEVTVPEQVESLQTKL  1038

Query  567   TETINWL-DANQSAEKEEYEGKQKELEGVANPIL  599
              ET  WL D     +  EY+ K   L+   + IL
Sbjct  1039  EETEEWLYDDGDKVDAAEYKKKMDALDSDLSAIL  1072

>PYAR_16202
Length=893

 Score = 200 bits (508),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 148/537 (28%), Positives = 247/537 (46%), Gaps = 68/537 (13%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            +A SV+G   G   G  +    V      EI+ N    R T + VAF   ERL G  A  
Sbjct  27   VAASVAGVDFG---GEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGEERLYGADAAT  83

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGES-KT  117
                         +R +G    DP + A I+  ++P++L     +  + TV  K +  + 
Sbjct  84   VGVRRPQTCYAQIRRFLGTTKEDPAISALIQDEYFPYELLH---NDTRGTVALKHDKGQV  140

Query  118  FQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  177
            F  EE+ +MV    R + +AF    VK+ V+TVP +F  +QRQA  DA  I+G+  L ++
Sbjct  141  FSAEELVAMVFTHARHITDAFAEVPVKDWVVTVPDFFTQAQRQAMLDAAEISGVRALSLL  200

Query  178  NEPTAAAIAYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVK  223
            NE TAAA+   +     E R VL ++LG  +  VS+      +             FEV 
Sbjct  201  NENTAAALQLAVHSTFAEPRRVLFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTVSGFEVL  260

Query  224  ATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQA  283
            + A D  LGG  FD RL +H   EF  K  +D+ +  R + ++R   ++ K  LS++ Q 
Sbjct  261  SKAWDASLGGAKFDLRLAEHLAAEFSEKLGEDVRQLPRPMAKIRAQAKKTKIVLSANEQI  320

Query  284  YIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGS  343
             + + SL+  +DF +++TR++ E++C D F + M+PVE+ L  A L K  +HE+ ++GG 
Sbjct  321  PVVMQSLYKDVDFFTSMTRSKLEEICKDLFAQAMKPVEQALEKAGLKKDDIHEIEIIGGG  380

Query  344  TRIPKEPNK------------SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtpl  391
             R+PK   +             +N DEA+A GA   AA LS +     +    +      
Sbjct  381  VRMPKIQQQLKDFFEGKDLGVHLNGDEAMALGAAFHAANLSNSFRVRHVGMTDIAPYAVG  440

Query  392  slglET--AGG--------VMTTLIARNTTVPTKKSQTF-------STYADNQPGVLIQV  434
               ++   AG            +L   ++ +  +K+ +F       +T+  ++P  L   
Sbjct  441  VRLVDIDHAGSDDSDKHWVKRASLFTESSKLGLRKAVSFLHSKDISATFRYDKPSSL---  497

Query  435  FEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAVE  484
                      ++ + KFN+ GI            G P++ +TF++D +G+  ++  E
Sbjct  498  ------PVGASSHIAKFNITGIEEFAAKFADKNLGEPKVSLTFELDGSGVTKIAKAE  548

 Score = 41.2 bits (95),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 6/100 (6%)

Query  506  DIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTL--NDEKLKDQISEDDKKAIE  563
            D  RM+ E E   ++  AN   +EAKN LE+Y Y  R+TL   +E+     + +  + + 
Sbjct  649  DSMRMLREMELADNQRRAN---LEAKNKLESYVYTARDTLGAQEEEFTAVTTSEQLEKLR  705

Query  564  DKVTETINWL-DANQSAEKEEYEGKQKELEGVANPILQKM  602
             K+ ET  WL D  +     EY  K K L+   + IL ++
Sbjct  706  TKLEETEEWLYDEGEKVSAAEYNKKVKSLDTDFSAILFRI  745

>PHYSO_339667
Length=160

 Score = 182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 111/152 (73%), Gaps = 0/152 (0%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            VGIDLGTT S  GVW+N+ VEII N  G  +TPSYVAFTDT  L G+AAK Q   NA NT
Sbjct  8    VGIDLGTTCSRDGVWRNEDVEIIPNGDGAYSTPSYVAFTDTALLTGNAAKRQPTRNAENT  67

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
            VF+  +LIGRKFSDP +Q  I++WPFK+  G  D  Q+ VQ+KGE+K FQP EI +++L 
Sbjct  68   VFNIHQLIGRKFSDPALQLSIRYWPFKVECGPKDTAQVVVQYKGETKRFQPIEIVAILLC  127

Query  130  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQA  161
            +MR++AE ++ +EV  AV+TVP  FN  QRQA
Sbjct  128  EMRKMAEIYLDQEVTKAVLTVPGSFNYFQRQA  159

>PHYKE_9011
Length=902

 Score = 198 bits (504),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 127/404 (31%), Positives = 209/404 (52%), Gaps = 37/404 (9%)

Query  5    VSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQV  62
            V     G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA   V
Sbjct  22   VEAIVAGVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAA--TV  79

Query  63   AMNAHNTVFDA-KRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESKTFQ  119
             +    T +   +RL+G K  +P V+A ++  H+P+ L         ++++ + +   +Q
Sbjct  80   GVRRPQTAYQQIRRLLGTKLENPQVKALLEEEHFPYNLLQNVTRGGTVSLKHR-DGHIYQ  138

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+ +MV    R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE
Sbjct  139  AEELVAMVFTHARQITDTFAEAAVKDWVVTVPAFFSQAQRQALLDAAEISGVRVLSLINE  198

Query  180  PTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEV  222
             TAAA+   +    D +   R +L +++G  +  VS+      +             F+ 
Sbjct  199  NTAAALQLAVHASYDPEDKPRRILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQT  258

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQ  282
             + A D  LGG  FD RL +H   EF  K  +D+ +  R + ++R   ++ K  LS++ +
Sbjct  259  ISNAWDESLGGARFDLRLAEHLATEFSEKIGEDVRKVPRPMAKIRAQAKKTKMVLSANEE  318

Query  283  AYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  342
              + + SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ LVGG
Sbjct  319  IPVVMQSLYNDIDFFTSMTRSKLEELSADLFERTLKPVEVALEKAGLTVADIDEIELVGG  378

Query  343  STRIPKEPNK------------SINPDEAVAYGATVQAAILSGN  374
              R+PK   +             +N DEA+A GA  +AA LS +
Sbjct  379  GVRMPKIQQQLAEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

 Score = 38.9 bits (89),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 54/97 (56%), Gaps = 6/97 (6%)

Query  509  RMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLN--DEKLKDQISEDDKKAIEDKV  566
            RM+ E EK  ++ +AN   +EAKN+LE + Y   + L+  + ++K     +  ++++ K+
Sbjct  648  RMLKEMEKADNKRKAN---LEAKNSLETFIYKAHDALSAQESEIKKVTVPEQVESLQTKL  704

Query  567  TETINWL-DANQSAEKEEYEGKQKELEGVANPILQKM  602
             ET  WL +    A+  EY+ K  +L+   + IL ++
Sbjct  705  EETEEWLYEDGDKADAAEYKKKMSDLDSDLSAILSRV  741

>H310_01493
Length=909

 Score = 198 bits (503),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 130/406 (32%), Positives = 203/406 (50%), Gaps = 37/406 (9%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59
            M   V     G+D G  +  + + +   + EI+ N    R T + V+F   ERL G  A 
Sbjct  19   MPAVVESNLAGVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAM  78

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-  116
            N             +RL+G   + P+V++ +K  ++P+ LT    +  + +V  K + + 
Sbjct  79   NIEVRRPQMAYSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQF  135

Query  117  TFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRI  176
            TF  EE+ +MV    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +
Sbjct  136  TFHAEELVAMVFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSL  195

Query  177  INEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------  219
            I+E TAAA+ + L     + G    VL++++G  +  VSL+     I             
Sbjct  196  IDENTAAALQHALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVID  255

Query  220  FEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRK--DITENQRALRRLRTACERAKRTL  277
            FEV   A D  LGG  FD RL D F  EF  K +K  D+ +  RA+ +LR A  + K  L
Sbjct  256  FEVLGKAWDDTLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVL  315

Query  278  SSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEV  337
            S++ +  + + SL   +DF S+  R  FE +C D F + + PVE VL+   L+K+ +  +
Sbjct  316  SANEEIPVVVPSLHADLDFKSSAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAI  375

Query  338  VLVGGSTRIPK-----------EPNKSINPDEAVAYGATVQAAILS  372
             ++GG  RIPK           +    +N DEA+A GA +  A LS
Sbjct  376  EIIGGGVRIPKIQSVLKTYFERDLGLHLNGDEAMALGAALHGANLS  421

>H310_01496
Length=904

 Score = 197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 130/406 (32%), Positives = 202/406 (50%), Gaps = 37/406 (9%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59
            M   V     G+D G  +  + + +   + EI+ N    R T + V+F   ERL G  A 
Sbjct  19   MPAVVESNLAGVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAM  78

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-  116
            N             +RL+G   + P+V++ +K  ++P+ LT    +  + +V  K + + 
Sbjct  79   NIEVRRPQMAYSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQF  135

Query  117  TFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRI  176
            TF  EE+ +MV    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +
Sbjct  136  TFHAEELVAMVFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSL  195

Query  177  INEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------  219
            I+E TAAA+ + L     + G    VL++++G  +  VSL+     I             
Sbjct  196  IDENTAAALQHALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVID  255

Query  220  FEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRK--DITENQRALRRLRTACERAKRTL  277
            FEV   A D  LGG  FD RL D F  EF  K +K  D+ +  RA+ +LR A  + K  L
Sbjct  256  FEVLGKAWDDTLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVL  315

Query  278  SSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEV  337
            S++ +  + + SL   +DF S   R  FE +C D F + + PVE VL+   L+K+ +  +
Sbjct  316  SANEEIPVVVPSLHADLDFKSNAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAI  375

Query  338  VLVGGSTRIPK-----------EPNKSINPDEAVAYGATVQAAILS  372
             ++GG  RIPK           +    +N DEA+A GA +  A LS
Sbjct  376  EIIGGGVRIPKIQSVLKTYFERDLGLHLNGDEAMALGAALHGANLS  421

>PPTG_14555
Length=703

 Score = 195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 171/546 (31%), Positives = 264/546 (48%), Gaps = 59/546 (11%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIA-----NDQGNRTTPSYVAFTDT---ERLIGDAAKN  60
            S+GID G T     V  +  V  +      N +   + PS+V+   T   E  +G  A N
Sbjct  43   SIGIDFGRTKCEAAVVSDTGVATLIPLEPQNKENCYSLPSFVSMGVTRTGEWEVGLQAIN  102

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGE-SKTFQ  119
            +       TVFD   L+G+K    +   D+  W F L +G   K  +    KG       
Sbjct  103  RAKAGHPYTVFDLTMLLGQKVK-ALSPQDVDRWAFNLQAGVAGKAVVECPAKGNVPDLLY  161

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
            PE++++M+L  ++  AE F  K V  AV+TVPA FN +QRQA  DA  IA LNV R++  
Sbjct  162  PEQVAAMLLSTIKNRAEIFTKKRVTGAVVTVPAAFNRTQRQAVWDACRIADLNVSRLVIS  221

Query  180  PTAAAIAYGLDKKGG---ERNVLIFDLGGGTFDVSLLSIEE------GI-FEVKATAGDT  229
             TA+A+A  +        E+ +++ D G G  DV+L  + E      GI  EV+ATAG+ 
Sbjct  222  STASAVADSIIDGAAAVFEKTIVVVDCGAGGLDVTLARVREADGSSSGIEVEVEATAGNL  281

Query  230  HLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDS  289
             LGGE   +RL +HF  E K       T N    RRLR AC   +R LS+S QA I++  
Sbjct  282  ELGGEALTDRLFEHFHNEVKAGDTSSKT-NPAFSRRLRRACALVQRILSTSQQAAIDLPW  340

Query  290  LFDG--------IDFNSTITRARFEDMCGDYFRKTME-PVEKVLRDAKLSKSQVHEVVLV  340
               G          F S+I RA F+++CG      +   VE+VL  AK+ K  +  V++ 
Sbjct  341  RTRGPGAVNGTAAGFTSSIWRADFDNLCGSEVWDNLPITVEQVLTRAKVKKEDLDAVLIT  400

Query  341  GGSTRIPK-----------EPNKSIN-PDEAVAYGATVQAAILSGNdsseklqdlllldv  388
            GG+ ++PK             N+ ++ P+   A GA++ AA  +G+        +L  + 
Sbjct  401  GGAMKVPKLREVLGDCLAEHWNRIMDLPEHTAAIGASMIAAQSTGH--------VLKNEP  452

Query  389  tplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG---ERS----M  441
            TPLSLG+ ++ G    ++  +T VPT ++Q +  YA  Q  +   + EG    RS     
Sbjct  453  TPLSLGIRSSSGDTLVVVPASTAVPTHQAQLY--YASCQREINFDILEGLTANRSPGAAP  510

Query  442  TRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGR  501
             R  + LG+  +DG       V ++++ F +DA G   V   +KS  +  ++ ++ D+  
Sbjct  511  NRLEHCLGRILVDGRRASTPLVLKLEIAFQLDATGRFTVVVSDKSNDRVTRLLVSGDETC  570

Query  502  LSQADI  507
            L +  I
Sbjct  571  LQEEAI  576

>PPTG_18280
Length=384

 Score = 187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 187/358 (52%), Gaps = 21/358 (6%)

Query  5    VSGYSVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            V     G+D G  +  V + +     EI+ N    R T + VAF   ERL G  A     
Sbjct  22   VEAIVAGVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGV  81

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQPE  121
                      +RL+G   SDP V +  D +H+P++L   A     I+++  G+ +TF  E
Sbjct  82   RRPQTAYAQIRRLLGTTLSDPQVSSLLDEEHFPYELVQNATRGGTISLK-HGKDQTFHAE  140

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            E+ +MV    R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE T
Sbjct  141  ELVAMVFAHARQITDTFAEAAVKDWVLTVPAFFSQAQRQAMLDAAEISGVRVLSLINENT  200

Query  182  AAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKA  224
            AAA+   +    D +   + +L +++G  +  VS+      +             F+  +
Sbjct  201  AAALQLAVHASYDPEDKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTIS  260

Query  225  TAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAY  284
             A D  LGG  FD RL +H  +EF  K  +DI +  R + ++R   ++ K  LS++ +  
Sbjct  261  NAWDESLGGSKFDLRLAEHLAKEFSEKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEIP  320

Query  285  IEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  342
            + + SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG
Sbjct  321  VVMQSLYNDIDFFTSMTRSKLEELSSDLFDRTLKPVEVALEKAGLTAADIDEIEIIGG  378

>PHYSO_285382
Length=379

 Score = 186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 174/353 (49%), Gaps = 40/353 (11%)

Query  51   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKH---WPFKLT-----SGAG  102
            E ++G  A+     +  +T+F+AKR IGR F D + ++++      P++ T       A 
Sbjct  23   EVIVGRKARAHRTTDPTHTIFNAKRFIGRSFDD-VGESEVDSNGVSPYEFTVKPVLDNAH  81

Query  103  DKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQA  161
            D     + F G+     P +I S V+  +R +A  F+G  ++  AVI VP  FN  QR A
Sbjct  82   DGVCFALGFPGQQDCVTPVQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVDFNARQRDA  141

Query  162  TKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  221
            T  A  +AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   
Sbjct  142  TVAAFRVAGLEVSRVLEEPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAIS  201

Query  222  VKATAGDTHLGGEDFDNRLVDHFTQEF----------------KRKHRKDITENQRALRR  265
            V  T GD HLGGED D  L     +EF                ++    D T+    L  
Sbjct  202  VLDTLGDNHLGGEDVDALLTAWLVREFEAQIGSRITSRGVEGEEKSLDDDATDPPCTLAG  261

Query  266  LRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKV  323
            +R A E  KR L+ +  A         G      +  +RA+FE++CG    +TM PV  V
Sbjct  262  VRRAAELLKRRLTDATTASATCVWSEGGSKARVEVKASRAQFEELCGPLLERTMIPVRDV  321

Query  324  LRDAKLSKSQVHEVVLVGGSTRIP------------KEPNKSINPDEAVAYGA  364
            L    +   ++  VVLVGGS+RIP            + P  +I+PD AVAYGA
Sbjct  322  LEANNMETEEIDAVVLVGGSSRIPWVRQRLTTMFQDRAPLSTIDPDLAVAYGA  374

>HYAP_01856
Length=289

 Score = 179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 164/289 (57%), Gaps = 13/289 (4%)

Query  35   DQGNRTTPSYVAFTDTERLI--GDAA-KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIK  91
            D+G RT PS V F    + +  GDAA + +      NT+   KRL+G+KF    V     
Sbjct  6    DRG-RTMPSVVHFDPQSQHVDVGDAAVEFETEPPVGNTIRSIKRLLGQKFVSKAVDVARI  64

Query  92   HWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKE--VKNAVIT  149
            +  + +   A     + V   G+    QPEE+ + VL +++  AEA+   +  + N VIT
Sbjct  65   YASYSVVPTAQGNVVLQVVRGGKRVQVQPEEVVASVLAELKASAEAYFDGQLSIDNVVIT  124

Query  150  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  209
            VPAYF+DSQR+AT  + ++AG   +R++NEPTAAA+AYGL    G++ V +FD GGGT D
Sbjct  125  VPAYFSDSQRKATLTSASMAGFKAVRLLNEPTAAAMAYGL-FLSGKKLVTVFDFGGGTLD  183

Query  210  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRA---LRRL  266
            VSLL IE+G FEV    GDT+LGG+D DN LVDH  +   R H  ++T  Q     + RL
Sbjct  184  VSLLRIEDGKFEVLGIGGDTNLGGDDIDNVLVDHLIEMLDRHH--NLTRAQVGDENMVRL  241

Query  267  RTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRK  315
            +   E AK  LS    A + +D + +      T+TR + E++CG   +K
Sbjct  242  KREVENAKIKLSEEEHAVVTVD-MANVPRITYTLTRRKLEELCGPIRKK  289

>CCA21519
Length=929

 Score = 191 bits (485),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 145/545 (27%), Positives = 252/545 (46%), Gaps = 75/545 (14%)

Query  11   GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  Y  V + +  +  EI+ N    R T + VAF   ERL G  A        H  
Sbjct  41   GLDFGGEYFKVALVKPGKPFEIVTNVHSKRKTETMVAFDGEERLYGADADTIGVRRPHTG  100

Query  70   VFDAKRLIGRKFSDPIVQADI--KHWPFKLTSGAGDKPQITVQFKGE-SKTFQPEEISSM  126
                +R +G       + + I  +++P+ L++   ++ + ++  K E  K +  EE+ +M
Sbjct  101  YAQIRRFLGSSLDQYGIVSLILEEYYPYSLST---NEKRGSIHIKHEDEKHYHAEEVVAM  157

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            V   +R++ + F   +VK+ VITVP Y+  +QRQA  DA  +AGL VL +INE TAAA+ 
Sbjct  158  VFSHVRQITDVFAETDVKDYVITVPEYYTQAQRQAVLDAAELAGLRVLSLINENTAAALQ  217

Query  187  YGLD---KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  230
              +    +    + V+ ++ G  +  V++  +   +             F+V + A + H
Sbjct  218  LCIHTTLEPDTPKRVIFYNQGSTSLQVTIAELFSYVVPVGSSSNKTIIGFKVLSKAWNQH  277

Query  231  LGGEDFDNRLVDHFTQEFKRK---HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEI  287
            LG    D RL +HF +EF  K   +++D+    + + +LR   ++ K  LS++ +  + +
Sbjct  278  LGSSQIDLRLAEHFAREFNEKVLHNKQDVRSLPKVMAKLRAQAKKTKIVLSANEEIPVVM  337

Query  288  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  347
             SL +  D  +T+TR   E++C D F + + PV + L  A L++  +HEV L+GG  R+P
Sbjct  338  QSLLEDYDLRTTVTRTLLEELCKDLFDQALGPVHEALEKANLTRQDIHEVELIGGGVRVP  397

Query  348  K------------EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslgl  395
            K            E    +N DEA+A GA  +AA LS +     +Q          +   
Sbjct  398  KVQRLLKEFFNVPELGAHLNGDEAMALGAAFRAANLSNSFRVRPIQMTDTASYGIGATLA  457

Query  396  ET------------AGGVMTT---LIARNTTVPTKKSQTFSTYADNQPGVL---IQVFEG  437
            +                + TT   L AR     T     F T+  +Q   L   + VF  
Sbjct  458  DVNAEDGKDSSWTKHAPLFTTAHRLGARKAVSLTHTRDMFCTFRYDQSVALPEGVSVF--  515

Query  438  ERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAVEKSTGKE  490
                      +G++++ GI            G P++ +TF +D++GI++++  E S  +E
Sbjct  516  ----------IGRYSISGIEAFYEQHLEKYLGDPKVTLTFLLDSSGIVSIAKAEVSLEEE  565

Query  491  NKITI  495
             +I +
Sbjct  566  YQIEV  570

 Score = 34.3 bits (77),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 69/133 (52%), Gaps = 21/133 (16%)

Query  478  LNVSAVEKSTGKENKITITNDKGRLSQ--ADIDRMVSEAEKYKSEDEANKVRIEAKNALE  535
            L V  VE+  G++ KI ++      SQ  A ++ M+ E +   S D   K  ++AKN LE
Sbjct  631  LKVELVEERLGEKRKIGMSILPMSASQKIASVE-MLREMD---SADNKRKADLDAKNRLE  686

Query  536  NYAYNLRNTL-NDEKLKDQISEDDKKAIEDKVTETINWLDANQS--------AEKEEYEG  586
             + Y+ R+TL +D+++  Q++      + ++VT  +  L+A +         AE  EY+ 
Sbjct  687  AFVYSARDTLESDDEVIRQVT------LPEQVTTVLAQLEAAEEWLYEDGDKAEASEYDA  740

Query  587  KQKELEGVANPIL  599
            K+ +++   + IL
Sbjct  741  KRSDMKTKLDEIL  753

>H257_00287
Length=893

 Score = 190 bits (483),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/406 (32%), Positives = 200/406 (49%), Gaps = 37/406 (9%)

Query  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59
            M   V     G+D G  +  + + +  +  EI+ N    R T + V+F   ERL G  A 
Sbjct  19   MPTVVESNLAGVDFGGEFFKIALVKPGKSFEIVTNVHSKRKTETIVSFNGEERLFGADAM  78

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-  116
            N       N     +RL+G   + P+V++  K  ++P+ LT    ++ + +V  K + + 
Sbjct  79   NIEVRRPQNAYSQIRRLLGTTVTHPLVESMTKSEYFPYTLTH---NETRGSVGLKHDDEH  135

Query  117  TFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRI  176
            TF  EE+ +MV    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +
Sbjct  136  TFHAEELVAMVFTHAKTITNEFAEGPVRDWVVTVPSYFAEAQRQAVIDAAEIAGIRVLSL  195

Query  177  INEPTAAAIAYGLD----KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------  219
            I+E TAAA+ + L     + G    V+ +++G  +  VS++     I             
Sbjct  196  IDENTAAALHHALSIDVPEVGKPTRVMFYNMGSTSLQVSVVEYTSRIVPDGFKKNKTIVD  255

Query  220  FEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRK--DITENQRALRRLRTACERAKRTL  277
            FEV   + D  LGG  FD RL D F  EF  K +K  DI    RA+ +LR A  + K  L
Sbjct  256  FEVLGKSWDETLGGSQFDLRLADKFADEFNTKLKKGDDIRLVPRAMAKLRAAARKTKIVL  315

Query  278  SSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEV  337
            S++    + + SL   +DF S   R+ FE +C D F + + PVE VL+   L+K+ +  +
Sbjct  316  SANEVIPVVVPSLHADLDFKSNAKRSEFEALCADLFGRVLGPVESVLQKTGLAKTDLSAI  375

Query  338  VLVGGSTRIPK-----------EPNKSINPDEAVAYGATVQAAILS  372
             ++GG  RIPK           +    +N DEA+A GA    A LS
Sbjct  376  EIIGGGVRIPKIQSLLKGYFERDLGLHLNGDEAMALGAAFHGANLS  421

>PYIR_18381
Length=747

 Score = 189 bits (479),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 194/393 (49%), Gaps = 55/393 (14%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEISQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  130  KMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A         AV++VP Y+ D QR+A  +A  IA LN LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDNVSPAYAVVSVPGYYTDVQRRALLNAAKIANLNCLRLINEHTAIALAYG  183

Query  189  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYA  241

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  297
            L     + F+ K++ D   + ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKNFQDKYKIDPLADAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKEPNK-----  352
            S +T  +F+++           +E +L+             +VGG TR+     +     
Sbjct  302  SQVTLEQFDEL-----------IEPLLQQ------------IVGGGTRVSSVKRRLSEIL  338

Query  353  -------------SINPDEAVAYGATVQAAILS  372
                         ++N DE+VA G  +Q AI S
Sbjct  339  GLDKDAQNFGLSTTLNADESVARGCALQCAISS  371

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 23/172 (13%)

Query  448  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------KSTGKENKI  493
            +GKF + GIP + +G  +P+I V    D NG+ +VS+ +               GKE + 
Sbjct  469  IGKFTVSGIPELEKGAELPKIRVNVQQDVNGLFSVSSSQLMQEIKEEEKPAAEEGKEGEA  528

Query  494  TITND-----KGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDE  548
               +      K R  + D+ ++ +E  K   +D   +     +N LE++ Y +RN ++D 
Sbjct  529  KADDKPAEPKKKRFRKVDL-KIHAEELKMAHQDRIIEETFNKRNELESFVYEMRNQVSD-  586

Query  549  KLKDQISEDDKKAIEDKVTETINWLDANQS--AEKEEYEGKQKELEGVANPI  598
            KL + I++ +K AIEDK+ E  +WL +++   + K  Y+ K  E+    +PI
Sbjct  587  KLAEFITDAEKAAIEDKLNEVEDWLYSDEGFDSTKSVYQNKLDEMRENTSPI  638

>PYIR_24220
Length=908

 Score = 190 bits (483),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 129/406 (32%), Positives = 216/406 (53%), Gaps = 37/406 (9%)

Query  2    AQSVSGYSVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAK  59
            A  V     G+D G  +  + + +     EI+ N    R T + VAF   ERL G DAA 
Sbjct  22   ASLVEAIVAGVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA-  80

Query  60   NQVAMNAHNTVFDA-KRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK  116
              VA+    T +   +R +G     P V + ++  ++P+ L   A  +  I+++   + K
Sbjct  81   -TVAVRRPQTAYSQIRRFLGATPDHPQVVSLLQEEYFPYTLLQNAT-RGTISLEHDNK-K  137

Query  117  TFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRI  176
             F  EE+ +MV    R++ +AF    VK+ VITVP++F+ +QRQA  DA  I+G+ VL +
Sbjct  138  VFHAEELVAMVFSHARQITDAFAEAPVKDWVITVPSFFSQAQRQAMLDAAEISGVRVLSL  197

Query  177  INEPTAAAIAYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEV  222
            INE TAAA+ + +     E R +L +++G  +  VS+   +  +             F+V
Sbjct  198  INENTAAALQHAVHSTFTEPRKILFYNMGSTSLQVSITEFKSEVVPDGFKKNKTVSGFQV  257

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRK--HRKDITENQRALRRLRTACERAKRTLSSS  280
             A A D +LGG  FD +L +H  +EF +K  + +DI    R L ++R   ++ K  LS++
Sbjct  258  LANAWDENLGGAKFDLQLAEHLAKEFNKKLGNGEDIRTIPRPLAKIRAQAKKTKIVLSAN  317

Query  281  AQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  340
             +  + + SL+  +DF +++TR++FE++  D F +++EPV++ L  A LS S + E+ +V
Sbjct  318  EEIPVVMQSLYKDMDFFTSMTRSKFEEINADLFARSLEPVKQALAKAGLSASDIDEIEIV  377

Query  341  GGSTRIP------------KEPNKSINPDEAVAYGATVQAAILSGN  374
            GG  R+P            K+    +N DEA+A G+  +AA LS +
Sbjct  378  GGGVRMPKIQAQLKEFFSGKDLGVHLNGDEAMALGSAFRAANLSNS  423

 Score = 42.7 bits (99),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 57/94 (61%), Gaps = 6/94 (6%)

Query  509  RMVSEAEKYKSEDEANKVRIEAKNALENYAYNLRNTLNDEKLK-DQISEDDK-KAIEDKV  566
            R++ E E+  ++ +AN   +EAKN LE + YN R+TL+ ++ +  Q++E ++ + ++ K+
Sbjct  656  RILREMEQADNQRKAN---LEAKNRLETFVYNARDTLSSKQEQMAQVAEPEQLEKLQSKL  712

Query  567  TETINWL-DANQSAEKEEYEGKQKELEGVANPIL  599
             ET  WL D  +  +  EY  K K+L+   + IL
Sbjct  713  EETEEWLYDDGEKVDAAEYNKKVKDLDKDLSAIL  746

 Score = 34.7 bits (78),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 38/71 (54%), Gaps = 9/71 (13%)

Query  530  AKNALENYAYNLRNTLNDE-KLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588
            A N  E YA++ R  + +  + K Q++ED++K + +KV E   WL ++Q         KQ
Sbjct  758  AINTAEEYAFSTRELMTEWVESKPQVTEDERKDVLEKVEELEAWLVSSQK--------KQ  809

Query  589  KELEGVANPIL  599
            K    V +P++
Sbjct  810  KAASAVEDPVV  820

>SDRG_01828
Length=866

 Score = 189 bits (481),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 147/557 (26%), Positives = 254/557 (46%), Gaps = 71/557 (13%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            +VS    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N  
Sbjct  17   TVSASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIE  76

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
                       +R +G     P+V +  + +++P+ LT     +  + +Q   E  TF  
Sbjct  77   VRRPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSE-HTFHA  134

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+++MV    +++   F    VK+ VITVP YF + QRQA  DA  IAG+ VL +I+E 
Sbjct  135  EELAAMVFGHAKQITNDFAEAPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDEN  194

Query  181  TAAAIAYGLDKKGGERN----VLIFDLGGGTFDVSLLSIEEGI-------------FEVK  223
            TAAA+ + +D +  E N    ++++++G  +  VS++  +  +             F+V 
Sbjct  195  TAAALHHAVDYEAAEPNTPERIMLYNMGSTSLQVSIVEYKTRVVPDGFKKNKTIVEFDVL  254

Query  224  ATAGDTHLGGEDFDNRLVDHFTQEF--KRKHRKDITENQRALRRLRTACERAKRTLSSSA  281
            A A D  LGG  FD RL + F  EF  K K+  D+ +  RA+ +LR A  + K  LS++ 
Sbjct  255  AKAWDETLGGAQFDLRLAEKFANEFNAKLKNGDDVRKIPRAMAKLRAAARKTKIVLSANE  314

Query  282  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  341
               + + SL   +D+    +R   E++  D F + +EPV+  L  A L+   +  V ++G
Sbjct  315  AIPVIVPSLHADLDYKGHASRTELEEIAADLFARVLEPVKSALDQAGLTVGDLSAVEIIG  374

Query  342  GSTRIPK-----------EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp  390
            G  RIPK           +  K +N DEA+A GA   AA LS +     +    +     
Sbjct  375  GGVRIPKIQALLQEFVQRDLGKRLNGDEAMALGAAFNAANLSTSFRVRHVGMTDISSFPI  434

Query  391  lslglETAGGVM-------------TTLIARNTTVPTKKSQTFS-------TYADNQPGV  430
                ++ A                   L      +  KKS +FS       T+  ++P  
Sbjct  435  GVRLVDLASHAADDDHPEAKHWVKRAALFGERQKLNVKKSVSFSHADDVSCTFRYDKPSA  494

Query  431  LIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAV  483
            L Q           ++++ ++N+ GI    +       G P++ ++F++DA+G+ ++   
Sbjct  495  LPQGV---------SSIISRYNITGIAAFAKKMEDKKLGEPKVTLSFNLDASGLASIVKA  545

Query  484  EKSTGKENKITITNDKG  500
            E +  +E ++     K 
Sbjct  546  EATLDEEIEVPAPTKKA  562

>PYVX_18450
Length=386

 Score = 180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 126/368 (34%), Positives = 180/368 (49%), Gaps = 54/368 (15%)

Query  2    AQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLI--GDAAK  59
            A+++    VGIDLGTTYS V + Q + V +I +  G+   PS VAF     +   G AA 
Sbjct  50   AEAIRVLVVGIDLGTTYSVVAISQRNNVTVIPDSHGHLIIPSMVAFLPDGEVTAAGIAAP  109

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  119
             + A+ +         L G   ++   + D+                      G      
Sbjct  110  YEFAIAS---------LEGNTTAEVCFELDVP---------------------GHPPCSA  139

Query  120  PEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            P  I S+V+  ++ +A+ F+G  ++ NAVI VP  FN+ QR AT +A   AGL V R++ 
Sbjct  140  PVSIGSIVVRHLKTMAQRFVGHDQITNAVIAVPVDFNERQRDATVEAFRAAGLVVSRVLE  199

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAAIAYGL +      VL+FD GGGT DVSLL +  G   V  T GD +LGGED D+
Sbjct  200  EPTAAAIAYGLHQDPTVNFVLVFDFGGGTLDVSLLFVRAGSIRVLDTLGDNNLGGEDVDS  259

Query  239  RLVDHFTQEFKRK----------------HRKDITENQRALRRLRTACERAKRTLSSSAQ  282
             +      EF R+                  +D  E    +  +R A E  KR LSS+  
Sbjct  260  TIAAFLADEFARQLGVDRITSASSEIEEADSEDPDELPCTIAGVRRAAESLKRKLSSATT  319

Query  283  AYIEIDSLFDGIDFNS---TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  339
            A      +  G  + +   ++TRA+ E +C   F +TM PV  VL    ++ +++  VVL
Sbjct  320  ATAM--CVVQGETYRTASVSMTRAQLETICRPLFERTMAPVRSVLEGNHMTPAEIDAVVL  377

Query  340  VGGSTRIP  347
            VGGS+RIP
Sbjct  378  VGGSSRIP  385

>PHYCA_558934
Length=489

 Score = 183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 149/488 (31%), Positives = 243/488 (50%), Gaps = 51/488 (10%)

Query  54   IGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKG  113
            +G  A N        TVFD   L+G+K  + +   D+  WPF + +G   K  +    + 
Sbjct  11   VGKRAVNHAKAGHPYTVFDLTMLLGQKM-ESLSPQDMDRWPFTIRAGVAGKALVECPQRL  69

Query  114  ESKTF-QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLN  172
            +S     PE++++M+L  ++  AE F GK V  AV+TV A +N +QRQA +DA +IAGL+
Sbjct  70   QSPALVYPEQVAAMLLSTIKHRAETFTGKTVTRAVVTVSAAYNRTQRQALRDACSIAGLS  129

Query  173  VLRIINEPTAAAIAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIE------EGIFEV  222
            V R++   TA+A+A            ++ +L+ D  G + +V+L S+       E   EV
Sbjct  130  VERLVVSSTASAVANAKSDTDATAVFDKTILVVD-SGASLNVTLASVNSNDNGAEVEVEV  188

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRAL-RRLRTACERAKRTLSSSA  281
             ATAGD   GGE   +RL +HF QE   +     T +  A  RRLR AC  A+R LSS  
Sbjct  189  TATAGDVEAGGEPLTDRLFEHFLQEINAEDVNSETTSSPAFSRRLRRACTLAQRVLSSFP  248

Query  282  QAYIEIDSL-FDGIDFNSTITRARFEDMCG-DYFRKTMEPVEKVLRDAKLSKSQVHEVVL  339
            Q   ++  L      F STI+R+ F+ +CG + + +  E VE+VL+ A++ K  V  +++
Sbjct  249  QVSFDVPPLQLRRGWFTSTISRSEFDSLCGLELWNRLPETVERVLKLAQVKKEDVDAILV  308

Query  340  VGGSTRIPK----------EPNKSIN--PDEAVAYGATVQAAILSGNdsseklqdlllld  387
             GG+ ++PK          E    I   P    A G    AA+++ N        +L  +
Sbjct  309  TGGAMQVPKFREVLGECFVEHWNRIKDLPKHTAAIG----AALIAKN-----NGYILKNE  359

Query  388  vtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG---------E  438
             T L+LG+ ++GG +  ++  +T VPT++S+ +  YA  Q  +   + EG          
Sbjct  360  PTSLALGIRSSGGDLLVIVPPSTCVPTRQSRVY--YASVQREIRFDILEGITEPDQEPTC  417

Query  439  RSMTRDNNL---LGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITI  495
             S T  N L   LG+  +DG       + ++++TF++   G L V   + S  +  ++ +
Sbjct  418  NSGTAPNKLEHCLGRVTIDGRRASAPLILKLEITFEVGETGSLVVLISDSSNNRVTRMQV  477

Query  496  TNDKGRLS  503
              D+  LS
Sbjct  478  GGDETCLS  485

>PYVX_15061
Length=891

 Score = 189 bits (479),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 126/404 (31%), Positives = 197/404 (49%), Gaps = 36/404 (9%)

Query  4    SVSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            +V     G+DLG  +  V  V      EI+ N    R T + VAF   ERL G  A    
Sbjct  20   AVQAIVAGVDLGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATIG  79

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIK--HWPFKLTSGAGDKPQITVQFKGESK-TFQ  119
                 +     +R +G    DP V A ++    P++L     D  + ++  K   K  F 
Sbjct  80   VRRPQSAYAQVRRFLGATLDDPQVVALLEDERLPYELEQ---DLARGSIALKHSDKQLFH  136

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+ +MV    R++ +AF    VK+ V+TVP YF+ +QRQA  DA  +AG+ VL +INE
Sbjct  137  AEELVAMVFSHARQITDAFAEAPVKDWVVTVPVYFSQAQRQALLDAAELAGVRVLSLINE  196

Query  180  PTAAAIAYGLD----KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEV  222
             TAAA+   +      +   + +L ++LG  +  VS+  +   +             F++
Sbjct  197  NTAAALQLAVHASVAPEDKPKRILFYNLGSTSLQVSVAELSAQVVPDGFKKNKTVSTFQM  256

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQ  282
             ++A D  LGG  FD RL DH  +EF  K  +D+    R + ++R   ++ K  LS++ Q
Sbjct  257  LSSAWDDSLGGAKFDLRLADHLAKEFSDKIGEDVRTLARPMAKIRAQAKKTKIVLSANEQ  316

Query  283  AYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  342
              + + SL+  +DF +++TR   E++C D F + + PV   L  A LS   + E+ LVGG
Sbjct  317  IPVVMQSLYKDVDFFTSMTRGDLENLCEDLFPRALAPVAAALEKAGLSVDDIDEIELVGG  376

Query  343  STRIPKEPNK------------SINPDEAVAYGATVQAAILSGN  374
              R+PK   +             +N DEA+A GA  +AA LS +
Sbjct  377  GVRMPKIQQQLKDYFGGKDLGVHLNGDEAMALGAAFRAANLSNS  420

>CCI11769
Length=372

 Score = 176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 175/360 (49%), Gaps = 48/360 (13%)

Query  51   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKL---------TSGA  101
            E L+G  A+     + H+T+++AKR IGR +++ I  A  K + F +         TS +
Sbjct  10   EILVGRQARAYRTKDPHHTIYNAKRFIGRSYNESIQAA--KPYGFSIEPIRNESATTSES  67

Query  102  GDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQ  160
               P  ++   G      P +I S+++  +  +A  F+   ++   VI VP  F  +QR+
Sbjct  68   LPGPCFSLNVSGHPSCVSPIDIGSLIIRHLHSMAREFVKHNQLDRVVIAVPVDFKAAQRR  127

Query  161  ATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF  220
            AT  A   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G  
Sbjct  128  ATVQAYEKAGLKVARVLEEPTAAAIAYGLHQTPNVNFILVFDFGGGTLDVSLLFVRSGSI  187

Query  221  EVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRR---------------  265
             V  T GD +LGGED DN + +H   + +      + E+   +                 
Sbjct  188  SVVDTLGDNNLGGEDLDNLVSNHLISQLEALIGMKLAESSSEVMETDSEKTEDPDQLPCT  247

Query  266  ---LRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRK  315
               +R A E  KR LS +  A         G    +       +++R  FE +C     +
Sbjct  248  IAGIRRAAEILKRKLSYTHTAIASCIVQEPGGKLIAQDNRVEISMSRDEFETLCESILER  307

Query  316  TMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP-----------KEPNKSINPDEAVAYGA  364
             + PV ++LRD  +  + + EVVLVGGS+RIP           K+P  +I+PD AVA+GA
Sbjct  308  VLLPVRQILRDNNMDPNSIDEVVLVGGSSRIPWIHTQLEELFGKQPRITIDPDVAVAFGA  367

>SPRG_06288
Length=869

 Score = 185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 146/551 (26%), Positives = 255/551 (46%), Gaps = 73/551 (13%)

Query  4    SVSGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            +VS    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N  
Sbjct  17   TVSASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIE  76

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120
                       +R +G     P+V +  + +++P+ LT     +  + +Q   E  TF  
Sbjct  77   VRRPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSE-HTFHA  134

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+++MV    +++   F    VK+ VITVP YF + QRQA  DA  IAG+ VL +I+E 
Sbjct  135  EELAAMVFGHAKQITNDFAEGPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDEN  194

Query  181  TAAAIAYGLDKKGGERN----VLIFDLGGGTFDVSLLSIEEGI-------------FEVK  223
            TAAA+ +G+D +  E N    ++++++G  +  VS++  +  +             F+V 
Sbjct  195  TAAALHHGVDYEAPEPNTPERIMLYNMGSTSLQVSIVEYKTRVVPDGFKKNKTIVEFDVL  254

Query  224  ATAGDTHLGGEDFDNRLVDHFTQEFKRK--HRKDITENQRALRRLRTACERAKRTLSSSA  281
            A A D  LGG  FD RL + F  EF  K  +  D+ +  RA+ +LR A  + K  LS++ 
Sbjct  255  AKAWDETLGGAQFDLRLAEKFANEFNAKLTNGDDVRKIPRAMAKLRAAARKTKIVLSANE  314

Query  282  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  341
               + + SL   +D+    +RA  E++  D F + ++PV+  L  A L+   +  V ++G
Sbjct  315  AIPVIVPSLHADLDYKGHASRAELEEIAADLFARVLDPVKSALDQAGLTVGDLSAVEIIG  374

Query  342  GSTRIPK-----------EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp  390
            G  RIPK           +  K +N DEA+A GA   AA LS +     +    +     
Sbjct  375  GGVRIPKIQALLQAFVQRDLGKRLNGDEAMALGAAFNAANLSTSFRVRHVGMTDIASFPV  434

Query  391  lslglETAGGVM-------------TTLIARNTTVPTKKSQTFS-------TYADNQPGV  430
                ++ A                   L      +  KKS +FS       T+  ++P  
Sbjct  435  GVRLVDLASHAADDDHPEAKHWVKRAALFGERQKLNVKKSVSFSHADDVSCTFRYDKPSA  494

Query  431  L-IQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSA  482
            L + V          ++++ ++N+ GI    +       G P++ ++F++DA+G+ ++  
Sbjct  495  LPLGV----------SSIISRYNITGIEAFAKKMEDKKLGEPKVTLSFNLDASGLASIVK  544

Query  483  VEKSTGKENKI  493
             E +  +E ++
Sbjct  545  AEATLEEEIEV  555

Lambda      K        H        a         alpha
   0.313    0.131    0.364    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 50513536077

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40