Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_126001475426726714320.0
PHALS_1442380283792678447e-112
PHALS_13512353892432677362e-97
PHALS_08480332072552677173e-94
PHALS_14425357673022246135e-78
PITG_19936157132492715913e-75
PPTG_2217436987712306072e-72
PHYCA_118674205112812715682e-71
PPTG_17245238632572345662e-71
PHYSO_526774157132492355634e-71
PPTG_0766037012162185588e-71
PHYSO_526623599492492365583e-70
PHYRA_74343698872492745573e-70
PHALS_13513157132402235563e-70
PHYSO_52607137012492365574e-70
PHYCA_9298368522482355548e-70
PITG_0426737012792325542e-69
PHYRA_74307422182492285487e-69
PHYCA_132252157132492715452e-68
PHYRA_74310599492492745401e-67
PPTG_19506247322232225344e-67
PPTG_07661600202232225345e-67
PHYSO_527352600202452265357e-67
PHYSO_254108170262462755174e-64
PHYRA_52440170262432244948e-61
PHYKE_6286599492502264959e-61
PPTG_15224963762462384895e-60
PITG_22053170262452254888e-60
PPTG_18464243182472284862e-59
PITG_04208205112452254834e-59
PHYCA_118548170262462264834e-59
PPTG_07664170262452374792e-58
PITG_0424836902452324792e-58
PPTG_0767136902462724783e-58
PITG_19938353892452254765e-58
PITG_0420036612472334671e-56
PHYRA_81103712622522254626e-56
PHYCA_11835636612522324611e-55
PHYSO_526832353892492724601e-55
PHYRA_74306205112452374592e-55
PHYCA_122048693172362234522e-54
PPTG_17049237772552294514e-54
PHYSO_25411236902242694477e-54
PHYCA_11855136902452304488e-54
PHYCA_12149480282482254471e-53
PHYSO_329843510942392674461e-53
PHYRA_81102147542512314462e-53
PHYRA_72504695162512314462e-53
PHYRA_72386459152452264452e-53
PHYRA_72344817002452264452e-53
PHYCA_10034368662742704447e-53
PHYSO_259736247322312724381e-52
PITG_22916720282482274373e-52
PHYCA_129784817002462264356e-52
PPTG_17409743732352234347e-52
PPTG_17125147542832324361e-51
PPTG_0889380282512264332e-51
PPTG_19331246513682234422e-51
PHYRA_74356698952442304313e-51
PHYSO_249692459152482264313e-51
PHYCA_107869246513422234383e-51
PPTG_16851236932492264304e-51
PHYCA_129485147542512344305e-51
PHYSO_26126580282472344295e-51
PPTG_00471720282392194286e-51
PPTG_15230817002522264281e-50
PHYRA_76249246513262234331e-50
PHYRA_5242336901931964212e-50
PITG_0971680282502264243e-50
PHYSO_334487517562582304245e-50
PHYRA_71404563202452234235e-50
PHYRA_72433694822452234226e-50
PHYCA_108039563202152234181e-49
PPTG_004608462592194211e-49
PHYKE_7564459204732234361e-49
PHYRA_71931510942392234191e-49
PYU1_G011231459142382284191e-49
PITG_23211177602452184192e-49
PPTG_19330563203162234242e-49
PPTG_07089202542552264193e-49
PYU1_G011237817002352224163e-49
PHYSO_468315563202552234174e-49
PHYRA_71477693172382674156e-49
PITG_18453147542522504166e-49
PHYKE_5753763302382274156e-49
PPTG_12847511263312204227e-49
PITG_0852270893822204257e-49
PHYKE_2376459153222234217e-49
PHYRA_72345517562402224148e-49
PPTG_1285370893422204211e-48
PHYSO_254223422182272264121e-48
PITG_22981175962592194151e-48
PHYSO_406265173642322264112e-48
PITG_009578462982254162e-48
PHYSO_51088870892552264104e-48
PHYRA_71618578972432244094e-48
PHYRA_4287689222132214075e-48
PHYRA_72475695022432244071e-47
PHYCA_10840970892822264091e-47
PHYSO_397673703072242204042e-47
PITG_22668173645192244242e-47
PHYCA_123779173642772244072e-47
PPTG_08017207076162204264e-47
PHYRA_7182580282542314044e-47
PHYKE_494670892632264037e-47
PHYRA_49009690712162223998e-47
PPTG_07277203402982204059e-47
PHYRA_74617699543372224089e-47
PPTG_13736226162362204001e-46
PHYCA_11951135312342184001e-46
PHYSO_507736135312362233972e-46
PHYRA_72438135312362423964e-46
PHYCA_18373353892462083964e-46
PHYRA_72165599392402233956e-46
PHALS_14424357661391383867e-46
PHALS_08945333882422203957e-46
PHYCA_9358368552522263958e-46
PHALS_03592310932592243968e-46
PYVX_22467135312362233939e-46
PHYKE_4438758943392194011e-45
PPTG_12852223223312204001e-45
PYU1_G011233694602392223922e-45
PPTG_15233231122352263894e-45
PHYRA_71308231122362423894e-45
PHYCA_69480391942132183875e-45
PHYSO_414520550602132213867e-45
PHYRA_5432770892192173867e-45
PHYCA_69477391922132183859e-45
PHYKE_7568608783722233961e-44
PPTG_14652229162572013881e-44
PITG_22734422181681863801e-44
PHYCA_119748423082612203871e-44
PYU1_G011235963762382213851e-44
PHYRA_71588693332422233861e-44
PHYRA_46230550602122163832e-44
PPTG_13769592663492193905e-44
PPTG_08005173647592244067e-44
PPTG_17295238912382373809e-44
PHYRA_74630202543432223871e-43
PHYCA_132529435382322323782e-43
PPTG_15234608782352283782e-43
PHYRA_43347688002202003772e-43
PHYCA_576423176762342243772e-43
HYAP_0924370892662263793e-43
PHALS_02474305472422233773e-43
PHYSO_329114510052362153755e-43
PHYSO_504553689972572483766e-43
PHYCA_683589222102163726e-43
PHYKE_7566459142602443759e-43
PPTG_15231135312582273751e-42
HYAP_08306563202862383761e-42
PHYSO_249751459202382433721e-42
PHALS_06162173644882473881e-42
PYIW_25259817002462273713e-42
PHYRA_83592763302372283703e-42
PHYRA_44405688542322223703e-42
PHALS_08947333902422233703e-42
PHYCA_123205425681772043653e-42
PYU1_G011236135312372183694e-42
PHYCA_12462369161772043635e-42
PYIR_13251817002362183685e-42
PHYCA_69479391932132173658e-42
PHYSO_560790608782372363678e-42
PHYKE_5655578972432213671e-41
PYU1_G011230817012382183661e-41
PHYRA_71307608782372223652e-41
PHYRA_72390592662372283642e-41
PHYSO_334498517572291933633e-41
PPTG_15262459142332193607e-41
PITG_23094176762372213591e-40
PHYSO_365942537682332273582e-40
PHYSO_490000575402412373582e-40
PHYSO_423056554102332263572e-40
PPTG_11469451342532463592e-40
PPTG_15220176762362243572e-40
PHYSO_365377537622202253553e-40
PYIR_13275135312372183573e-40
PYIR_13252817012362183563e-40
PHYRA_86968733682392243563e-40
PHALS_0608470892602683584e-40
PPTG_13004176512552423574e-40
PHYRA_41766511262092163535e-40
PHALS_05391318482422203556e-40
PHYCA_108964694282772653586e-40
PHYSO_255972205112152313527e-40
PHYRA_72385694602372183548e-40
PHYSO_526541599392392403531e-39
PHYRA_75425176762372223521e-39
PPTG_13026694282382243521e-39
PHYSO_334500517582352423512e-39
PHYRA_52960691982232183502e-39
PHYRA_52955691972232183502e-39
PHYRA_45457517571991923472e-39
PHALS_08445176762422223513e-39
PHYCA_129892608782342283503e-39
PHYCA_69457511262132213474e-39
PHYCA_109095413122772613524e-39
PHYRA_72531695292362253486e-39
PYVX_22469517584741953611e-38
PITG_22709173962812713491e-38
PHYRA_71310459142372183461e-38
PHYSO_336498177692382233452e-38
PHYSO_480321570042542353462e-38
PHYSO_482931571392542353452e-38
PHYCA_109089173962772633463e-38
PHYCA_109192413382782653464e-38
PHYRA_39489686262372223424e-38
PPTG_10591215032542473444e-38
PITG_23076176682762663454e-38
PPTG_18463452582542393434e-38
PHYSO_496064578972542343426e-38
PHYSO_521124595742542423427e-38
PHYSO_328418509152192063389e-38
PHYSO_52785036611952013342e-37
PHYRA_72403694692392353382e-37
PPTG_17453177692542503382e-37
PHYRA_72430461762382293373e-37
PHYRA_72306694282382293373e-37
PPTG_04799194622452523373e-37
PHYRA_52426600201521473293e-37
PHYRA_72477695042382313354e-37
PHYSO_330015511262412293356e-37
PPTG_11475451332702293359e-37
PPTG_05581173962752603351e-36
PHYCA_124383426672802653351e-36
PHYRA_47103689972262153311e-36
PHYRA_5242737011241283231e-36
PHYCA_544885451342562383331e-36
PHYRA_83851719182392283322e-36
PHYCA_10570176672782623342e-36
PHYRA_72541695342392353302e-36
PITG_16866135312382193302e-36
PHYKE_208743731871413262e-36
PHYCA_109162413302572613313e-36
PHYRA_76657703212392353303e-36
PHYSO_514298591312642133313e-36
PPTG_08703209012542463304e-36
PHYCA_124462426702802623324e-36
PHYRA_76603703072392353285e-36
PHYSO_516261592662272293275e-36
PHYSO_246397456772642103306e-36
PPTG_06202176582752613307e-36
PITG_23075176672762633298e-36
PHYRA_84277720282402313261e-35
PPTG_15219517562332273251e-35
PHYCA_123587176682782643281e-35
PHYCA_553546452582802613281e-35
PHYCA_69122177692492363252e-35
PHYCA_109174413332772593272e-35
PPTG_07991207012762233263e-35
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_12600

Length=267
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHALS_12600                                                           556        0.0   
PHALS_14423                                                           329        7e-112
PHALS_13512                                                           288        2e-97 
PHALS_08480                                                           280        3e-94 
PHALS_14425                                                           240        5e-78 
PITG_19936                                                            232        3e-75 
PPTG_22174                                                            238        2e-72 
PHYCA_118674                                                          223        2e-71 
PPTG_17245                                                            222        2e-71 
PHYSO_526774                                                          221        4e-71 
PPTG_07660                                                            219        8e-71 
PHYSO_526623                                                          219        3e-70 
PHYRA_74343                                                           219        3e-70 
PHALS_13513                                                           218        3e-70 
PHYSO_526071                                                          219        4e-70 
PHYCA_9298                                                            218        8e-70 
PITG_04267                                                            218        2e-69 
PHYRA_74307                                                           215        7e-69 
PHYCA_132252                                                          214        2e-68 
PHYRA_74310                                                           212        1e-67 
PPTG_19506                                                            210        4e-67 
PPTG_07661                                                            210        5e-67 
PHYSO_527352                                                          210        7e-67 
PHYSO_254108                                                          203        4e-64 
PHYRA_52440                                                           194        8e-61 
PHYKE_6286                                                            195        9e-61 
PPTG_15224                                                            192        5e-60 
PITG_22053                                                            192        8e-60 
PPTG_18464                                                            191        2e-59 
PITG_04208                                                            190        4e-59 
PHYCA_118548                                                          190        4e-59 
PPTG_07664                                                            189        2e-58 
PITG_04248                                                            189        2e-58 
PPTG_07671                                                            188        3e-58 
PITG_19938                                                            187        5e-58 
PITG_04200                                                            184        1e-56 
PHYRA_81103                                                           182        6e-56 
PHYCA_118356                                                          182        1e-55 
PHYSO_526832                                                          181        1e-55 
PHYRA_74306                                                           181        2e-55 
PHYCA_122048                                                          178        2e-54 
PPTG_17049                                                            178        4e-54 
PHYSO_254112                                                          176        7e-54 
PHYCA_118551                                                          177        8e-54 
PHYCA_121494                                                          176        1e-53 
PHYSO_329843                                                          176        1e-53 
PHYRA_81102                                                           176        2e-53 
PHYRA_72504                                                           176        2e-53 
PHYRA_72386                                                           176        2e-53 
PHYRA_72344                                                           176        2e-53 
PHYCA_10034                                                           175        7e-53 
PHYSO_259736                                                          173        1e-52 
PITG_22916                                                            172        3e-52 
PHYCA_129784                                                          172        6e-52 
PPTG_17409                                                            171        7e-52 
PPTG_17125                                                            172        1e-51 
PPTG_08893                                                            171        2e-51 
PPTG_19331                                                            174        2e-51 
PHYRA_74356                                                           170        3e-51 
PHYSO_249692                                                          170        3e-51 
PHYCA_107869                                                          173        3e-51 
PPTG_16851                                                            170        4e-51 
PHYCA_129485                                                          170        5e-51 
PHYSO_261265                                                          169        5e-51 
PPTG_00471                                                            169        6e-51 
PPTG_15230                                                            169        1e-50 
PHYRA_76249                                                           171        1e-50 
PHYRA_52423                                                           166        2e-50 
PITG_09716                                                            167        3e-50 
PHYSO_334487                                                          167        5e-50 
PHYRA_71404                                                           167        5e-50 
PHYRA_72433                                                           167        6e-50 
PHYCA_108039                                                          165        1e-49 
PPTG_00460                                                            166        1e-49 
PHYKE_7564                                                            172        1e-49 
PHYRA_71931                                                           166        1e-49 
PYU1_G011231                                                          166        1e-49 
PITG_23211                                                            166        2e-49 
PPTG_19330                                                            167        2e-49 
PPTG_07089                                                            166        3e-49 
PYU1_G011237                                                          164        3e-49 
PHYSO_468315                                                          165        4e-49 
PHYRA_71477                                                           164        6e-49 
PITG_18453                                                            164        6e-49 
PHYKE_5753                                                            164        6e-49 
PPTG_12847                                                            167        7e-49 
PITG_08522                                                            168        7e-49 
PHYKE_2376                                                            166        7e-49 
PHYRA_72345                                                           164        8e-49 
PPTG_12853                                                            166        1e-48 
PHYSO_254223                                                          163        1e-48 
PITG_22981                                                            164        1e-48 
PHYSO_406265                                                          162        2e-48 
PITG_00957                                                            164        2e-48 
PHYSO_510888                                                          162        4e-48 
PHYRA_71618                                                           162        4e-48 
PHYRA_42876                                                           161        5e-48 
PHYRA_72475                                                           161        1e-47 
PHYCA_108409                                                          162        1e-47 
PHYSO_397673                                                          160        2e-47 
PITG_22668                                                            167        2e-47 
PHYCA_123779                                                          161        2e-47 
PPTG_08017                                                            168        4e-47 
PHYRA_71825                                                           160        4e-47 
PHYKE_4946                                                            159        7e-47 
PHYRA_49009                                                           158        8e-47 
PPTG_07277                                                            160        9e-47 
PHYRA_74617                                                           161        9e-47 
PPTG_13736                                                            158        1e-46 
PHYCA_11951                                                           158        1e-46 
PHYSO_507736                                                          157        2e-46 
PHYRA_72438                                                           157        4e-46 
PHYCA_18373                                                           157        4e-46 
PHYRA_72165                                                           156        6e-46 
PHALS_14424                                                           153        7e-46 
PHALS_08945                                                           156        7e-46 
PHYCA_9358                                                            156        8e-46 
PHALS_03592                                                           157        8e-46 
PYVX_22467                                                            155        9e-46 
PHYKE_4438                                                            159        1e-45 
PPTG_12852                                                            158        1e-45 
PYU1_G011233                                                          155        2e-45 
PPTG_15233                                                            154        4e-45 
PHYRA_71308                                                           154        4e-45 
PHYCA_69480                                                           153        5e-45 
PHYSO_414520                                                          153        7e-45 
PHYRA_54327                                                           153        7e-45 
PHYCA_69477                                                           152        9e-45 
PHYKE_7568                                                            157        1e-44 
PPTG_14652                                                            154        1e-44 
PITG_22734                                                            150        1e-44 
PHYCA_119748                                                          153        1e-44 
PYU1_G011235                                                          152        1e-44 
PHYRA_71588                                                           153        1e-44 
PHYRA_46230                                                           152        2e-44 
PPTG_13769                                                            154        5e-44 
PPTG_08005                                                            160        7e-44 
PPTG_17295                                                            150        9e-44 
PHYRA_74630                                                           153        1e-43 
PHYCA_132529                                                          150        2e-43 
PPTG_15234                                                            150        2e-43 
PHYRA_43347                                                           149        2e-43 
PHYCA_576423                                                          149        2e-43 
HYAP_09243                                                            150        3e-43 
PHALS_02474                                                           149        3e-43 
PHYSO_329114                                                          149        5e-43 
PHYSO_504553                                                          149        6e-43 
PHYCA_6835                                                            147        6e-43 
PHYKE_7566                                                            149        9e-43 
PPTG_15231                                                            149        1e-42 
HYAP_08306                                                            149        1e-42 
PHYSO_249751                                                          147        1e-42 
PHALS_06162                                                           154        1e-42 
PYIW_25259                                                            147        3e-42 
PHYRA_83592                                                           147        3e-42 
PHYRA_44405                                                           147        3e-42 
PHALS_08947                                                           147        3e-42 
PHYCA_123205                                                          145        3e-42 
PYU1_G011236                                                          146        4e-42 
PHYCA_12462                                                           144        5e-42 
PYIR_13251                                                            146        5e-42 
PHYCA_69479                                                           145        8e-42 
PHYSO_560790                                                          145        8e-42 
PHYKE_5655                                                            145        1e-41 
PYU1_G011230                                                          145        1e-41 
PHYRA_71307                                                           145        2e-41 
PHYRA_72390                                                           144        2e-41 
PHYSO_334498                                                          144        3e-41 
PPTG_15262                                                            143        7e-41 
PITG_23094                                                            142        1e-40 
PHYSO_365942                                                          142        2e-40 
PHYSO_490000                                                          142        2e-40 
PHYSO_423056                                                          142        2e-40 
PPTG_11469                                                            142        2e-40 
PPTG_15220                                                            142        2e-40 
PHYSO_365377                                                          141        3e-40 
PYIR_13275                                                            142        3e-40 
PYIR_13252                                                            141        3e-40 
PHYRA_86968                                                           141        3e-40 
PHALS_06084                                                           142        4e-40 
PPTG_13004                                                            142        4e-40 
PHYRA_41766                                                           140        5e-40 
PHALS_05391                                                           141        6e-40 
PHYCA_108964                                                          142        6e-40 
PHYSO_255972                                                          140        7e-40 
PHYRA_72385                                                           140        8e-40 
PHYSO_526541                                                          140        1e-39 
PHYRA_75425                                                           140        1e-39 
PPTG_13026                                                            140        1e-39 
PHYSO_334500                                                          139        2e-39 
PHYRA_52960                                                           139        2e-39 
PHYRA_52955                                                           139        2e-39 
PHYRA_45457                                                           138        2e-39 
PHALS_08445                                                           139        3e-39 
PHYCA_129892                                                          139        3e-39 
PHYCA_69457                                                           138        4e-39 
PHYCA_109095                                                          140        4e-39 
PHYRA_72531                                                           138        6e-39 
PYVX_22469                                                            143        1e-38 
PITG_22709                                                            139        1e-38 
PHYRA_71310                                                           137        1e-38 
PHYSO_336498                                                          137        2e-38 
PHYSO_480321                                                          137        2e-38 
PHYSO_482931                                                          137        2e-38 
PHYCA_109089                                                          137        3e-38 
PHYCA_109192                                                          137        4e-38 
PHYRA_39489                                                           136        4e-38 
PPTG_10591                                                            137        4e-38 
PITG_23076                                                            137        4e-38 
PPTG_18463                                                            136        4e-38 
PHYSO_496064                                                          136        6e-38 
PHYSO_521124                                                          136        7e-38 
PHYSO_328418                                                          134        9e-38 
PHYSO_527850                                                          133        2e-37 
PHYRA_72403                                                           134        2e-37 
PPTG_17453                                                            134        2e-37 
PHYRA_72430                                                           134        3e-37 
PHYRA_72306                                                           134        3e-37 
PPTG_04799                                                            134        3e-37 
PHYRA_52426                                                           131        3e-37 
PHYRA_72477                                                           133        4e-37 
PHYSO_330015                                                          133        6e-37 
PPTG_11475                                                            133        9e-37 
PPTG_05581                                                            133        1e-36 
PHYCA_124383                                                          133        1e-36 
PHYRA_47103                                                           132        1e-36 
PHYRA_52427                                                           129        1e-36 
PHYCA_544885                                                          132        1e-36 
PHYRA_83851                                                           132        2e-36 
PHYCA_10570                                                           133        2e-36 
PHYRA_72541                                                           131        2e-36 
PITG_16866                                                            131        2e-36 
PHYKE_208                                                             130        2e-36 
PHYCA_109162                                                          132        3e-36 
PHYRA_76657                                                           131        3e-36 
PHYSO_514298                                                          132        3e-36 
PPTG_08703                                                            131        4e-36 
PHYCA_124462                                                          132        4e-36 
PHYRA_76603                                                           130        5e-36 
PHYSO_516261                                                          130        5e-36 
PHYSO_246397                                                          131        6e-36 
PPTG_06202                                                            131        7e-36 
PITG_23075                                                            131        8e-36 
PHYRA_84277                                                           130        1e-35 
PPTG_15219                                                            129        1e-35 
PHYCA_123587                                                          130        1e-35 
PHYCA_553546                                                          130        1e-35 
PHYCA_69122                                                           129        2e-35 
PHYCA_109174                                                          130        2e-35 
PPTG_07991                                                            130        3e-35 
PHYCA_114913                                                          128        3e-35 
PITG_23051                                                            130        3e-35 
PHYRA_52296                                                           128        4e-35 
PHYRA_52260                                                           127        8e-35 
HYAP_14846                                                            127        1e-34 
PHYCA_123797                                                          126        2e-34 
PHYCA_544875                                                          127        3e-34 
PPTG_04504                                                            126        4e-34 
PHYRA_84273                                                           125        4e-34 
PHYCA_133546                                                          126        8e-34 
PHYCA_109163                                                          125        8e-34 
PHYCA_118700                                                          124        1e-33 
PHYSO_253029                                                          125        1e-33 
HYAP_07436                                                            125        1e-33 
PHYSO_480350                                                          124        1e-33 
PHYSO_254099                                                          124        1e-33 
HYAP_05559                                                            124        2e-33 
PHYRA_72357                                                           123        4e-33 
PITG_23062                                                            124        4e-33 
PITG_23228                                                            123        5e-33 
HYAP_05558                                                            123        6e-33 
PHYSO_251206                                                          122        7e-33 
HYAP_04977                                                            123        8e-33 
PHYRA_45462                                                           120        9e-33 
PPTG_07667                                                            119        2e-32 
PPTG_07668                                                            117        4e-32 
PPTG_03796                                                            121        4e-32 
PHYSO_246660                                                          120        7e-32 
PHYCA_133455                                                          118        8e-32 
HYAP_07925                                                            120        9e-32 
PPTG_15218                                                            119        1e-31 
PHYRA_47241                                                           117        2e-31 
PPTG_16647                                                            119        2e-31 
PPTG_15860                                                            116        4e-31 
PPTG_05868                                                            117        9e-31 
HYAP_14784                                                            116        3e-30 
PHYCA_10715                                                           115        4e-30 
PHYCA_59113                                                           112        7e-30 
PHYSO_249691                                                          114        1e-29 
PHYCA_109151                                                          111        2e-29 
PHYSO_263794                                                          112        2e-29 
HYAP_06628                                                            113        3e-29 
HYAP_08846                                                            112        2e-28 
PHALS_01213                                                           110        4e-28 
PHYKE_5284                                                            109        6e-28 
PPTG_06973                                                            107        6e-28 
PPTG_00542                                                            109        8e-28 
PHYCA_11676                                                           107        2e-27 
PITG_23055                                                            108        2e-27 
PHALS_08447                                                           107        8e-27 
PYAP_24304                                                            106        1e-26 
PYAR_24955                                                            106        1e-26 
PHYSO_327911                                                          105        1e-26 
PHYSO_327912                                                          105        2e-26 
PHYSO_449487                                                          102        2e-26 
PYAP_24757                                                            105        4e-26 
PHYSO_338051                                                          103        7e-26 
PHYSO_481543                                                          103        1e-25 
PHYCA_5621                                                            102        2e-25 
PHYCA_132177                                                          102        3e-25 
PHYKE_7565                                                            99.8       2e-24 
PHYSO_327908                                                          104        3e-24 
PHYCA_109441                                                          97.8       1e-23 
PPTG_11648                                                            97.8       5e-23 
PHYSO_264058                                                          95.1       7e-23 
PPTG_07690                                                            92.4       1e-22 
PHYSO_342831                                                          93.6       2e-22 
PHYKE_4541                                                            92.0       3e-22 
PPTG_11479                                                            93.6       1e-21 
PHYSO_526791                                                          91.7       1e-21 
PHYCA_59410                                                           88.6       2e-21 
PYAR_25201                                                            89.7       4e-21 
PHYSO_257244                                                          91.7       8e-21 
HYAP_07033                                                            89.4       1e-20 
PYAR_21977                                                            88.6       5e-20 
PHYCA_73404                                                           84.3       5e-20 
PHALS_05247                                                           88.6       7e-20 
PHYSO_341539                                                          88.2       9e-20 
PHYSO_508915                                                          85.9       2e-19 
PYIW_24350                                                            85.9       2e-19 
PHYSO_444351                                                          82.4       3e-19 
PYAP_24339                                                            85.5       5e-19 
PHYSO_477165                                                          82.0       1e-18 
PHYSO_260049                                                          84.0       2e-18 
PITG_10839                                                            81.6       2e-18 
PHYSO_245789                                                          81.6       5e-18 
PHYSO_251461                                                          82.8       6e-18 
PHYRA_44618                                                           80.5       8e-18 
PPTG_23721                                                            85.1       1e-17 
PHALS_13274                                                           82.4       2e-17 
PHYCA_507156                                                          79.3       2e-17 
PHYKE_1224                                                            79.0       2e-17 
PHYRA_39485                                                           79.0       4e-17 
PHYSO_335497                                                          80.5       7e-17 
PHYKE_8391                                                            81.3       2e-16 
HYAP_05562                                                            75.9       2e-15 
PHYRA_52174                                                           75.1       4e-15 
PHYCA_73406                                                           71.2       6e-15 
PHYCA_73407                                                           71.2       6e-15 
PHYRA_39486                                                           73.2       6e-15 
PHYSO_526695                                                          70.5       2e-14 
PHYSO_333132                                                          71.6       2e-14 
PHYSO_261711                                                          72.8       3e-14 
PHYCA_18619                                                           70.1       5e-14 
HYAP_07922                                                            69.7       7e-14 
PITG_23039                                                            68.9       2e-13 
PHYCA_73400                                                           66.6       3e-13 
PPTG_05373                                                            68.2       7e-13 
PHYCA_119285                                                          65.5       9e-13 
PHYSO_245887                                                          64.3       7e-12 
PITG_22876                                                            63.9       7e-12 
PYU1_G011232                                                          60.8       4e-11 
PHYKE_6288                                                            61.2       4e-11 
PHYCA_108999                                                          61.2       6e-11 
PPTG_11420                                                            62.0       1e-10 
PHYSO_445618                                                          59.3       2e-10 
PHYSO_377094                                                          56.6       9e-10 
HYAP_07372                                                            58.5       2e-09 
PHYSO_264049                                                          55.8       5e-09 
PPTG_11472                                                            59.3       6e-09 
HYAP_08078                                                            56.2       7e-09 
PPTG_08713                                                            54.7       2e-08 
HYAP_07496                                                            53.9       2e-08 
PYAR_26314                                                            53.9       3e-08 
PPTG_19242                                                            52.0       1e-07 
PHYKE_7051                                                            52.4       1e-07 
PHYSO_336673                                                          51.2       3e-07 
PHYSO_509491                                                          49.7       4e-07 
PPTG_23679                                                            50.4       1e-06 
PYIW_25932                                                            46.6       5e-06 
PHYKE_4231                                                            47.4       5e-06 
PHYRA_85280                                                           48.1       2e-05 
PPTG_04456                                                            44.3       2e-05 
PHYSO_260072                                                          46.2       3e-05 
PPTG_17455                                                            45.1       3e-05 
PPTG_20067                                                            44.3       6e-05 
PHYKE_6287                                                            42.4       9e-05 
PYAR_26415                                                            43.1       1e-04 
PHYSO_335499                                                          45.4       2e-04 
HYAP_03446                                                            38.1       0.005 
PPTG_19622                                                            37.0       0.008 
PPTG_20194                                                            38.1       0.012 
HYAP_11184                                                            37.0       0.020 
HYAP_12828                                                            33.1       0.18  
HYAP_08850                                                            35.4       0.19  
PHYSO_333483                                                          34.7       0.24  
PYIR_26577                                                            32.7       0.30  
PYIW_15316                                                            31.2       0.51  
PPTG_23150                                                            30.8       0.97  
PHYSO_515401                                                          32.3       1.0   
PHYCA_4501                                                            33.9       1.1   
PITG_03180                                                            33.5       1.7   
PPTG_14422                                                            33.1       2.3   
SDRG_02028                                                            32.0       4.1   
PHYRA_46973                                                           32.0       4.6   
H310_13415                                                            32.0       5.0   
PYAP_24306                                                            30.0       5.7   

>PHALS_12600
Length=267

 Score = 556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/267 (100%), Positives = 267/267 (100%), Gaps = 0/267 (0%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT
Sbjct  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
            ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW
Sbjct  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI
Sbjct  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN  240
            KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN
Sbjct  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN  240

Query  241  FHRLEKRANPPIQDKLFYEVLEKSYPF  267
            FHRLEKRANPPIQDKLFYEVLEKSYPF
Sbjct  241  FHRLEKRANPPIQDKLFYEVLEKSYPF  267

>PHALS_14423
Length=379

 Score = 329 bits (844),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 195/267 (73%), Gaps = 0/267 (0%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M  RA+  G I IL  S   A W + NVS +  K   +      ++V+EVQPF QRKPTT
Sbjct  113  MSPRAVLLGAIAILVASHGFAKWADANVSKHSAKSRTIPDHYNFVNVNEVQPFKQRKPTT  172

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             SQ+SAIKY+PRLYV   C+PYP VQ +GSLSEG+ WK +F+  C GSPRGSQIYSRSDW
Sbjct  173  DSQKSAIKYQPRLYVLGACYPYPAVQADGSLSEGLPWKIFFQSRCNGSPRGSQIYSRSDW  232

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+GKWA++Y WYLP ALD   W VDGH HFW +VV+WTDSPDPD STILAAS SG G+ I
Sbjct  233  YRGKWAIMYAWYLPRALDQNIWDVDGHSHFWTFVVVWTDSPDPDVSTILAASTSGVGNRI  292

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN  240
            KKY+PLKSKYL++ K+LKVK  E+    K GL+LT++VGE Q LITWEQL+DEARAALS+
Sbjct  293  KKYSPLKSKYLLNHKSLKVKLHENHFWDKTGLKLTEKVGELQTLITWEQLTDEARAALSS  352

Query  241  FHRLEKRANPPIQDKLFYEVLEKSYPF  267
             H  + R   PIQDK F  +L  +YPF
Sbjct  353  VHYSDWRMESPIQDKWFRPMLSSAYPF  379

>PHALS_13512
Length=243

 Score = 288 bits (736),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 179/267 (67%), Gaps = 24/267 (9%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M  RA+F G I ILATS   A W + N                        PF Q  PTT
Sbjct  1    MSPRAVFLGVIAILATSHGNAEWADAN------------------------PFKQPTPTT  36

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             SQ+SAIKY+PRLYV   C+PYP VQ NGSLS G+ W+ +    C GSP GSQIYSRSDW
Sbjct  37   DSQKSAIKYQPRLYVVSDCYPYPAVQANGSLSYGLPWEVFAPTKCNGSPYGSQIYSRSDW  96

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+G WA++Y WYLP ALD ++W VDGHRHFW +VV+WT+SPDP+ STILAAS SG  + I
Sbjct  97   YRGMWAIMYAWYLPRALDHSSWLVDGHRHFWTFVVVWTNSPDPNVSTILAASTSGTDNRI  156

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN  240
            KKY P+KSKYL+  +TLKVK  ++    K GL+LT +VG+ Q LITWEQL+DEARAALS+
Sbjct  157  KKYLPVKSKYLLDRRTLKVKLYQNYWLDKTGLKLTDKVGDLQPLITWEQLTDEARAALSS  216

Query  241  FHRLEKRANPPIQDKLFYEVLEKSYPF  267
            FH  + R   PIQDK F  +L  +YPF
Sbjct  217  FHYPDWRMETPIQDKWFRYMLSSAYPF  243

>PHALS_08480
Length=255

 Score = 280 bits (717),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 185/267 (69%), Gaps = 12/267 (4%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M  RA  FG ITI   S    +++  +V + P         P L+D ++VQPF Q +P T
Sbjct  1    MTPRAFLFGAITIFTLSYANGYFVFRSVDLDP--------IPDLIDANQVQPFPQPQPET  52

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             SQ+SA+KYKP LY+D GCHPYP VQ NGSLS G++WK+  R SC GSP GSQ+YSRSDW
Sbjct  53   KSQKSAVKYKPSLYIDSGCHPYPAVQANGSLSSGVEWKHNPRASCRGSPLGSQVYSRSDW  112

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+GKWA++YTWY P ALD T  FV      WLW +IWT+SPDPD+ST+LA ++    D +
Sbjct  113  YKGKWAIMYTWYFPGALDPTTQFVS----HWLWAIIWTNSPDPDESTLLAVTLPRLADGV  168

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN  240
            KKY+PL SKY+ +  T+K+KS +S   K HG ELT R GEFQDLIT +QL+DEA+AAL  
Sbjct  169  KKYSPLHSKYVHNHTTVKIKSQQSFWLKMHGFELTSRSGEFQDLITLDQLTDEAKAALMT  228

Query  241  FHRLEKRANPPIQDKLFYEVLEKSYPF  267
             HR E  ANPP+QD  F EVL+ ++PF
Sbjct  229  NHRPEHFANPPLQDLRFNEVLQMAFPF  255

>PHALS_14425
Length=302

 Score = 240 bits (613),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 157/224 (70%), Gaps = 3/224 (1%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
             +  D V PF + K  T SQ+SA+ ++P+LY+++GCHPYP VQ NGSL+ G++++ +  P
Sbjct  80   FLGADSVHPFPRTKARTSSQKSALMFQPQLYIEDGCHPYPAVQSNGSLNAGLEYELFRDP  139

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
            +CEGSP GSQ+YSRS WYQ KWA +YTWY P+A D  + F  GHRH+WLW ++WT  P+P
Sbjct  140  TCEGSPLGSQVYSRSSWYQMKWATIYTWYFPVAYDHASPFSTGHRHYWLWAIVWTTDPNP  199

Query  164  DDSTILAASMSG-FGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
             +   LA SMSG FG  I  Y     K+L++  T+ +KS +S +  +  L+LT++ GE +
Sbjct  200  AEGHFLAVSMSGNFG--ISSYTLPHIKHLVNGTTVLLKSHKSLMSARLALDLTEKSGEKE  257

Query  223  DLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYP  266
            DLITWE+L+ EARAALS+  R E  AN P+QD  F+ +LEK+YP
Sbjct  258  DLITWEELTPEARAALSSVKRTEATANSPLQDNKFFSLLEKAYP  301

>PITG_19936
Length=249

 Score = 232 bits (591),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 168/271 (62%), Gaps = 26/271 (10%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA+ FG +  LAT                     V     ++D D VQPF Q +PT 
Sbjct  1    MNLRALLFGVVASLAT---------------------VTADVVMIDHDAVQPFAQPEPTM  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             SQ+SA+KYKP+L++  GCHPYP VQE+GS+S G++W  +    C+GS  GSQ+YSRSDW
Sbjct  40   ESQKSAVKYKPQLHISYGCHPYPAVQEDGSISAGLKWAGWPNGDCKGSALGSQVYSRSDW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+GKWA++Y WY P +      +  GHRH+W + ++WT++P+PD+STIL  SMS  G   
Sbjct  100  YKGKWAIMYAWYFPKSRQYVDKYRFGHRHYWSYAIVWTNNPNPDNSTILGVSMSS-GVGY  158

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALS-  239
             K +P KSKY++   T+K+    S    K GL+LT++ GE QDLITWEQLS+EAR ALS 
Sbjct  159  MKRSPPKSKYVVDGTTVKLDWYWSFWGSKQGLQLTEKSGETQDLITWEQLSEEARNALSE  218

Query  240  ---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
               +      +A  P++D +F   L+K+YPF
Sbjct  219  ADFDVSWAFTKAVMPLKDDIFTSRLKKAYPF  249

>PPTG_22174
Length=771

 Score = 238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 160/230 (70%), Gaps = 6/230 (3%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            PT+ D DEVQPF + +PTT S++SAIKYKP+L++ +GCHPYPVVQ +GS+S G++W   +
Sbjct  543  PTI-DHDEVQPFEEMEPTTDSEKSAIKYKPQLHISDGCHPYPVVQADGSVSAGLKWSGRY  601

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
            R  C+GS  GSQ+YSRS WY+GKWA++Y WY P   +  + F  GHRH+WL  ++WTDSP
Sbjct  602  RSGCKGSDLGSQVYSRSAWYKGKWAIMYAWYFPKGANPVSVFGSGHRHYWLHAIVWTDSP  661

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            +PD+STIL ASM+G  +  +K + +KSKYL +  +LK+ S          L LTK+ GE 
Sbjct  662  NPDNSTILGASMAGTTNN-EKTSTVKSKYLANGTSLKLDSFVGLWTGIQALRLTKKSGET  720

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANP----PIQDKLFYEVLEKSYPF  267
            QDLITWEQL+DEAR ALS+F      +      P++D  F  +L+ SYPF
Sbjct  721  QDLITWEQLTDEARDALSDFSFESSESREWVVMPLRDSAFKVLLKNSYPF  770

>PHYCA_118674
Length=281

 Score = 223 bits (568),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 160/271 (59%), Gaps = 27/271 (10%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M  RA F   I  LA        +N +V                ++ D+VQPF Q +PTT
Sbjct  34   MNFRAFFLAVIASLAA-------VNADVG--------------KINHDQVQPFTQPEPTT  72

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S++SA+KYKP+L++ +GCHPYP VQ NGS+S G++W       C+ S  GSQIYSRSDW
Sbjct  73   DSEKSAVKYKPQLHISDGCHPYPAVQANGSVSGGLKWAGRSDGDCKRSALGSQIYSRSDW  132

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            +  KWA++Y WY P   +  A F  GHRH+W + ++WT SP+P++ST+L  SMS  G   
Sbjct  133  HNDKWAIMYAWYFPKGNEFQANFDSGHRHYWSYAIVWTGSPNPENSTVLGVSMSSSG--Y  190

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALS-  239
             K AP KSKY+I   T+K  S  S    K  + LTK+ GE QDLITWEQL+ EAR ALS 
Sbjct  191  GKKAPPKSKYVIDGTTVKFDSYVSFWASKQAIRLTKKEGEAQDLITWEQLTQEARTALSE  250

Query  240  ---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
                      +   P++D +F  +L+K+YPF
Sbjct  251  ADFKAESTFSKVVMPLKDDVFSSILKKAYPF  281

>PPTG_17245
Length=257

 Score = 222 bits (566),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 152/234 (65%), Gaps = 12/234 (5%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            ++ D+VQPF + +PTT S++SAIKYKP+L++ +GC+PYP VQ NG++S G++W  +    
Sbjct  24   INHDQVQPFEEMEPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSD  83

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            CE   +GSQIYSRSDWY+GKWA++Y WY P      + +  GHRHFW   ++WTD+ +PD
Sbjct  84   CEKPVQGSQIYSRSDWYKGKWAIMYAWYFPKGAFRASKYNRGHRHFWSSAIVWTDNTNPD  143

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +STIL  SMSG    +KK +P K+KY+    TLK+ S          L LTK+ G  QDL
Sbjct  144  NSTILGVSMSGSKGYVKKPSP-KTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDL  202

Query  225  ITWEQLSDEARAALSNFHRLEKRANP-----------PIQDKLFYEVLEKSYPF  267
            +TWEQL+DEAR ALS F      ++            P++D +F  +LE+SYPF
Sbjct  203  VTWEQLTDEARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  256

>PHYSO_526774
Length=249

 Score = 221 bits (563),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 152/235 (65%), Gaps = 5/235 (2%)

Query  37   AVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQ  96
            AV     +++ D VQP  Q +PTT S+++A+KYKP+L++  GCHPYP VQ +GS+S G++
Sbjct  16   AVNADVKMINHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLK  75

Query  97   WKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVI  156
            W  +    C+GS  GSQ+YSRSDWY+GKWA++Y WY P        +  GH H+W + ++
Sbjct  76   WSGWANGKCKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGRRMGDGYNSGHHHYWSYAIV  135

Query  157  WTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTK  216
            W D+P+PD+STIL  SMS  G   +K +P KSKY++   T+K  S  S    K G+ LT 
Sbjct  136  WIDNPNPDNSTILGVSMSA-GVGYRKASPPKSKYVVDGVTVKFDSYRSFWGSKQGVRLTT  194

Query  217  RVGEFQDLITWEQLSDEARAALS----NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            + G+ QDLITWEQL+DEAR ALS    + +   K    P++D    E LEK+YPF
Sbjct  195  KSGDQQDLITWEQLTDEARTALSDADFDVNWSLKNVVMPLKDDALRERLEKAYPF  249

>PPTG_07660
Length=216

 Score = 219 bits (558),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 147/218 (67%), Gaps = 11/218 (5%)

Query  57   KPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYS  116
            +PTT S++SAIKYKP+L++  GCHPYP VQ NGS+S G++W       CE    GSQ+YS
Sbjct  2    EPTTDSEKSAIKYKPQLHISYGCHPYPAVQANGSISGGLKWSGKTNGDCEQPNLGSQVYS  61

Query  117  RSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGF  176
            RSDWY+GKWA++Y WYLP A      F  GHRHFWL+ ++WTDSP+PD+STIL  SMSG 
Sbjct  62   RSDWYKGKWAIMYAWYLPKAAQFMLKFDTGHRHFWLYSMVWTDSPNPDNSTILGVSMSGS  121

Query  177  GDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARA  236
               +KK +P K+KY+    T+K++S          L LTK+ GE QDL+TWEQL+DEAR 
Sbjct  122  RGYVKKPSP-KTKYIEKGTTIKLESYVGFWMGVQALRLTKKSGETQDLVTWEQLTDEARD  180

Query  237  ALSNFHRLEKRANP-------PIQDKLFYEVLEKSYPF  267
            ALS F   +  ++P       P++D +F  +L+ SYPF
Sbjct  181  ALSEF---DFESDPSISMVVMPLKDDVFRSILKDSYPF  215

>PHYSO_526623
Length=249

 Score = 219 bits (558),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 150/236 (64%), Gaps = 5/236 (2%)

Query  36   GAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGM  95
             AV     +++ D VQPF Q +PTT S+++A+K+KP+L++  GCHPYP V+ NGS+S G+
Sbjct  15   AAVNADVKMINHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVEANGSVSAGL  74

Query  96   QWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVV  155
            +W  +    C+GS  GSQ+YSRSDWY+ KWA++Y WY P      + +  GHRHFW + +
Sbjct  75   KWTGWADGDCKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYASQYRSGHRHFWSYAI  134

Query  156  IWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT  215
            +WTDS  PD+STI   SMS  G    K  P KSKY++   T+K  S  S    K G+  T
Sbjct  135  VWTDSDKPDNSTIQGVSMSA-GVGYGKATPPKSKYVVDGVTVKFDSYFSFWGSKVGIRTT  193

Query  216  KRVGEFQDLITWEQLSDEARAALS----NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             + GE QDLITWEQL+DEAR AL+    +     K+   P+ D +F E LEK+YPF
Sbjct  194  TKTGETQDLITWEQLTDEARTALTDADFDVDWSYKKVVMPLLDDVFTEKLEKAYPF  249

>PHYRA_74343
Length=249

 Score = 219 bits (557),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/274 (43%), Positives = 163/274 (59%), Gaps = 32/274 (12%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA     I  LA  +VKA                      ++D D VQPF Q +PTT
Sbjct  1    MNLRAFLLAAIASLA--VVKA-------------------DVEMIDHDTVQPFAQPEPTT  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S+++A+K+KP+L++  GCHPYP V  NGS++ G++W  +    C+GS  GSQ+YSRSDW
Sbjct  40   DSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWDDGDCKGSGLGSQVYSRSDW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMS---GFG  177
            Y+ KWA++Y WY P     T+ +  GHRH+W + ++WTDS  PD+STIL  SMS   GFG
Sbjct  100  YKDKWAIMYAWYFPKGRQYTSAYRTGHRHYWSYGIVWTDSSSPDNSTILGVSMSAGVGFG  159

Query  178  DEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAA  237
                K  P KSKY++   T+K  S  S    K G++LT + GE QDLITWEQ+++EAR A
Sbjct  160  ----KATPPKSKYVVDGTTVKFDSFRSFWGSKMGVKLTTKEGEMQDLITWEQMTEEARTA  215

Query  238  LS----NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            L+    +     ++   P+ D +F   L+K+YPF
Sbjct  216  LTDADFDVDWSVRKVVMPMSDDVFMTKLKKAYPF  249

>PHALS_13513
Length=240

 Score = 218 bits (556),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 150/223 (67%), Gaps = 5/223 (2%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D + VQPF ++KP T S+ SA+KYKP L+V EGCHPYP VQ+NGS+S G +W   +   
Sbjct  23   IDANSVQPFPEQKPQTDSERSALKYKPHLHVSEGCHPYPAVQQNGSVSAGFEWDEDYSQP  82

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  SP+GSQIYSRS WY+GKWA++Y WY P A       V G RH+WL  ++WTD  +P+
Sbjct  83   CGRSPQGSQIYSRSSWYKGKWAIMYAWYFPKAAVHIGRGVSGRRHYWLHAIVWTDEENPN  142

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +S+IL  +MS  G  + K   +KS Y+I   TLK+ S  S   ++  L+ T ++GE QDL
Sbjct  143  NSSILGVTMSA-GIGLLKRTKIKSHYIIGGTTLKLMSYVSFWGRRLALKFTVKLGETQDL  201

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            ITWEQLS EAR AL+    L+ +++ P+QD  F  +++++YPF
Sbjct  202  ITWEQLSHEARKALA----LDYKSDTPLQDYRFDGLIKEAYPF  240

>PHYSO_526071
Length=249

 Score = 219 bits (557),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 150/236 (64%), Gaps = 5/236 (2%)

Query  36   GAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGM  95
             AV     +++ D VQP  Q +PTT S+++A+KYKP+L++  GCHPYP VQ +GS+S G+
Sbjct  15   AAVNADVKMINHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGL  74

Query  96   QWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVV  155
            +W  +    C+GS  GSQ+YSRSDWY+GKWA++Y WY P      + +  GHRHFW + +
Sbjct  75   KWSGWANGKCKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGRQYVSKYRKGHRHFWSYAI  134

Query  156  IWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT  215
            +WTDS  PD+STI   SMS  G   +K  P KSKY+I   T+K  S  S    K G+  T
Sbjct  135  VWTDSDKPDNSTIQGVSMSA-GVGFRKATPPKSKYVIDGVTVKFDSYFSFWGSKVGIRTT  193

Query  216  KRVGEFQDLITWEQLSDEARAALSN----FHRLEKRANPPIQDKLFYEVLEKSYPF  267
             + GE QDLITWEQL+DEAR  L+N         ++   P+ D+ F + L+K+YPF
Sbjct  194  TKTGESQDLITWEQLTDEARTGLTNADFDVDWSYRKVVMPLSDEDFTDKLKKAYPF  249

>PHYCA_9298
Length=248

 Score = 218 bits (554),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 152/235 (65%), Gaps = 5/235 (2%)

Query  37   AVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQ  96
            A + +  ++D D+VQPF Q +PTT S++SA+KYKP+L++ +GCHPYP VQ +G++S G++
Sbjct  15   AAVNAVKMIDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHPYPAVQADGAVSAGLK  74

Query  97   WKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVI  156
            W       C+GS  GSQ+YSRSDWY+ KWA++Y WY P      + +  GHRHFW + ++
Sbjct  75   WAGTASGQCKGSGLGSQVYSRSDWYKNKWAIMYAWYFPKGRQYISKYRFGHRHFWSYAIV  134

Query  157  WTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTK  216
            W DS  PD+STIL  SMS  G    K  P KSKY++   T+K KS  S    K  + LT 
Sbjct  135  WMDSDVPDNSTILGVSMSA-GVGYSKETPPKSKYVVDGTTVKFKSYHSFWGSKLAVGLTT  193

Query  217  RVGEFQDLITWEQLSDEARAALS----NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            + GE QDLI WEQL+DEAR+ L+    +     ++   P+ D +F E L+K+YPF
Sbjct  194  KEGESQDLIAWEQLTDEARSGLTDADFDVDWSFRKVVMPMTDGVFTEKLKKNYPF  248

>PITG_04267
Length=279

 Score = 218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 151/232 (65%), Gaps = 11/232 (5%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            T ++ D+VQPF Q KP T S++SAIKYKP+L++ +GCHPYP VQ NGS+S G++W     
Sbjct  52   TTINHDQVQPFEQIKPATDSEKSAIKYKPQLHISDGCHPYPAVQSNGSISGGLKWSGKAN  111

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              C+    GSQ+YSRS W++GKWA++Y WY P        F  GHRHFW + ++WTD P+
Sbjct  112  GDCKEPGLGSQVYSRSAWFKGKWAIMYAWYFPKGPQFVLRFDTGHRHFWSYAILWTDDPN  171

Query  163  PDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
             D+STIL  SMSG    +K+ +P K+KY++   T+K+ S  S       L+LTK++GE Q
Sbjct  172  HDNSTILGVSMSGSRGYVKESSP-KAKYIVKGTTVKLDSYASFWMGVQALQLTKKLGETQ  230

Query  223  DLITWEQLSDEARAALSNFHRLEKRANP-------PIQDKLFYEVLEKSYPF  267
            DLITWEQL+DEA  AL+ F   +  ++P       P+ D  F  +L+ SYPF
Sbjct  231  DLITWEQLTDEACDALTEF---DFESDPSRAMVVMPLGDDNFTPILKDSYPF  279

>PHYRA_74307
Length=249

 Score = 215 bits (548),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 151/228 (66%), Gaps = 5/228 (2%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D VQPF Q +PTT S+++A+K+KP+L++  GCHPYP V  NGS++ G++W  +   
Sbjct  23   MIDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWADG  82

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C+GS  GSQ+YSRSD Y+ KWA++Y WY P        +  GHRH+W + ++WTDS  P
Sbjct  83   DCKGSGLGSQVYSRSDSYKDKWAIMYAWYFPKGRQYIHKYHSGHRHYWSYGIVWTDSSSP  142

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
            D+STIL  SMS  G   +K +P KSK++I   T+K  S +S    K G+ LTK+ G+ QD
Sbjct  143  DNSTILGVSMSA-GVGYRKVSPPKSKFVIDGTTVKFDSYKSFWGSKQGVRLTKKTGDTQD  201

Query  224  LITWEQLSDEARAALSNFH-RLE---KRANPPIQDKLFYEVLEKSYPF  267
            LITWEQ+++EAR AL +    +E   K+   P+ D  F E LEKSYPF
Sbjct  202  LITWEQMTEEARTALVDTDFDVEWSLKKVVMPLSDDAFTERLEKSYPF  249

>PHYCA_132252
Length=249

 Score = 214 bits (545),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/271 (42%), Positives = 159/271 (59%), Gaps = 26/271 (10%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M +R  F   I  LAT       +N +V               ++D D+VQPF Q +PTT
Sbjct  1    MNIRTFFLATIASLAT-------VNADVK--------------MIDHDQVQPFAQPEPTT  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S++SA+KYKP+L++ +GCH YP VQ +G++S G++W       C+GS  GSQ+YSRSDW
Sbjct  40   NSEKSAVKYKPQLHISDGCHSYPAVQADGAVSAGLKWAGSVSGQCKGSGLGSQVYSRSDW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+ KWA++Y WY P      + +  GHRHFW + ++W DS  PD+STIL  SMS  G   
Sbjct  100  YKDKWAIMYAWYFPKGRQYISKYRFGHRHFWSYAIVWMDSDVPDNSTILGVSMSA-GVGY  158

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALS-  239
             K  P KSKY++   T+K  S +S    K  + LT + GE QDLITWEQL+DE R  L+ 
Sbjct  159  NKKTPPKSKYVVDGTTVKFDSYQSFWGGKLAVGLTTKEGETQDLITWEQLTDEGRTGLTD  218

Query  240  ---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
               +     ++   P+ D +F + L+K+YPF
Sbjct  219  ADFDVDWSIRKVVMPMADDVFVKKLKKNYPF  249

>PHYRA_74310
Length=249

 Score = 212 bits (540),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 162/274 (59%), Gaps = 32/274 (12%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA     I  LA  +VKA                      ++D D VQPF Q +PTT
Sbjct  1    MNLRAFLLAAIASLA--VVKA-------------------DVDMIDHDTVQPFAQPEPTT  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S+++A+K+KP+L++  GCHPYP V  NGS++ G++W  +    C+GS  GSQ+YSRSDW
Sbjct  40   DSEKTAVKFKPQLHISYGCHPYPAVDANGSVNAGLKWAGWADGDCKGSAMGSQVYSRSDW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMS---GFG  177
            Y+ KWA++Y WY P     T+ +  GHRH+W + ++WTDS  PD+STIL  SMS   GFG
Sbjct  100  YKDKWAIMYAWYFPKGRQYTSKYRAGHRHYWSYGIVWTDSSSPDNSTILGVSMSAGVGFG  159

Query  178  DEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAA  237
                K  P KSKY+I   T+K  S  S    K G++LT + G  Q LITWEQ+++EAR A
Sbjct  160  ----KATPPKSKYVIDGTTVKFDSFWSFWGSKLGVKLTTKEGATQALITWEQMTEEARTA  215

Query  238  LS----NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            L+    +     ++   P+ D +F + L+K+YPF
Sbjct  216  LTDADFDVDWSFRKVVMPMSDDVFTKKLKKAYPF  249

>PPTG_19506
Length=223

 Score = 210 bits (534),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 143/222 (64%), Gaps = 12/222 (5%)

Query  57   KPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYS  116
            +PTT S++SAIKYKP+L++ +GC+PYP VQ NG++S G++W  +    CE   +GSQIYS
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  117  RSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGF  176
            RSDWY+GKWA++Y WY P      + +  GHRHFW   ++WTD+ +PD+STIL  SMSG 
Sbjct  62   RSDWYKGKWAIMYAWYFPKGAFRASKYNRGHRHFWSSAIVWTDNTNPDNSTILGVSMSGS  121

Query  177  GDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARA  236
               +KK +P K+KY+    TLK+ S          L LTK+ G  QDL+TWEQL+DEAR 
Sbjct  122  KGYVKKPSP-KTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDEARD  180

Query  237  ALSNFHRLEKRANP-----------PIQDKLFYEVLEKSYPF  267
            ALS F      ++            P++D +F  +LE+SYPF
Sbjct  181  ALSKFDFDADTSDAIFFSSGATVVIPLEDGVFTSILEESYPF  222

>PPTG_07661
Length=223

 Score = 210 bits (534),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 143/222 (64%), Gaps = 12/222 (5%)

Query  57   KPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYS  116
            +PTT S++SAIKYKP+L++ +GC+PYP VQ NG++S G++W  +    CE   +GSQIYS
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  117  RSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGF  176
            RSDWY+GKWA++Y WY P      + +  GHRHFW   ++WTD+ +PD+STIL  SMSG 
Sbjct  62   RSDWYKGKWAIMYAWYFPKGAFRASKYNRGHRHFWSSAIVWTDNTNPDNSTILGVSMSGS  121

Query  177  GDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARA  236
               +KK +P K+KY+    TLK+ S          L LTK+ G  QDL+TWEQL+DEAR 
Sbjct  122  KGYVKKPSP-KTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDEARD  180

Query  237  ALSNFHRLEKRANP-----------PIQDKLFYEVLEKSYPF  267
            ALS F      ++            P++D +F  +LE+SYPF
Sbjct  181  ALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  222

>PHYSO_527352
Length=245

 Score = 210 bits (535),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 153/226 (68%), Gaps = 8/226 (4%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWK--NYF  101
            ++  D+VQPF Q +PTT S++SA+KYKP+L++  GCHPYP VQ +GS++ G++W   ++ 
Sbjct  23   MIGHDQVQPFAQPEPTTESEKSAVKYKPQLHISYGCHPYPAVQADGSVNGGLKWTFWSWA  82

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C+GS  GSQ+YSRSDW++GKWA++Y WY P   D    F  GHRH+WL+ ++WTDSP
Sbjct  83   DSDCKGSGLGSQVYSRSDWHRGKWAIVYAWYFPKGRDFEHSFKRGHRHYWLYAILWTDSP  142

Query  162  DPDDSTILAASM-SGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGE  220
            +PD STIL  S+ +GF D   K A   ++++I  KT+K  S  S    +  L LT++ G+
Sbjct  143  NPDTSTILGVSVPNGFRD---KSAAPDAQFVIDGKTIKFDSYRSFTTGRQDLGLTEKTGD  199

Query  221  FQDLITWEQLSDEARAALS--NFHRLEKRANPPIQDKLFYEVLEKS  264
             QDLITWEQL++EAR ALS  NF    ++   P++D  F E L ++
Sbjct  200  TQDLITWEQLTEEARTALSNMNFDGPRQKIVVPMKDGDFAERLARA  245

>PHYSO_254108
Length=246

 Score = 203 bits (517),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/275 (42%), Positives = 156/275 (57%), Gaps = 37/275 (13%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA     +  LAT+   +                   S + ++ D+VQP  Q  P T
Sbjct  1    MNLRAFLLAAVVSLATTSAGS-------------------SISRINHDQVQPMAQPTPVT  41

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             +Q+ A+KYKP+L V  GCHPYP VQ NGS+S G++W       CEGS  GSQ+Y+RSDW
Sbjct  42   DAQKLAVKYKPQLRVSYGCHPYPAVQANGSVSGGLEWSGPADGDCEGSSLGSQVYARSDW  101

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            ++ KWA +YTWY P         V GHRHFW + +IWTDSP PD+ST L  SMS  G   
Sbjct  102  FKDKWATMYTWYFPKGRQD----VWGHRHFWEYAIIWTDSPSPDNSTFLGISMSA-GVGH  156

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN  240
             K  P+  KY+ +  ++K++S  S +  K  L+LTK  G+FQDLITW QL   AR AL+ 
Sbjct  157  GKQTPVLLKYM-NGNSVKLESHYSVLGNKAALQLTKDSGDFQDLITWGQLPVPARDALNG  215

Query  241  --------FHRLEKRANPPIQDKLFYEVLEKSYPF  267
                    F++ E     P++D++F  VL K+YP+
Sbjct  216  DAFDVTYFFNKFEM----PLKDRVFMSVLNKAYPW  246

>PHYRA_52440
Length=243

 Score = 194 bits (494),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 138/224 (62%), Gaps = 13/224 (6%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D VQPF Q  P T SQ+SA+KYKP+LY+  GCHPYP V+ NG  S G++W       C+G
Sbjct  27   DLVQPFAQPTPVTDSQKSAVKYKPQLYISYGCHPYPAVEANGYASGGLEWSGPNDGDCKG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+YSRSDWY  KWA++Y WY P       + V GHR++W + ++WTDS  PD+ST
Sbjct  87   SSLGSQVYSRSDWYHEKWAIMYAWYFPKG----RYGVTGHRNYWEYAIVWTDSTSPDNST  142

Query  168  ILAASMS-GFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLIT  226
            +L  SMS G G +  K  P   KY+ +  ++K+ S  S +  K  LELTK+ GEFQDLIT
Sbjct  143  LLGVSMSAGVGHD--KTTPPMLKYM-NGSSVKLNSHFSLLGSKAALELTKKEGEFQDLIT  199

Query  227  WEQLSDEARA-----ALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            W+QL+  AR      AL     L  +   P +D +F + LE +Y
Sbjct  200  WDQLTVAARETLNSDALDGNVWLSNKDEVPFKDDIFVDRLEDAY  243

>PHYKE_6286
Length=250

 Score = 195 bits (495),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 142/226 (63%), Gaps = 8/226 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q +P + ++++A+K+KP+L V  GC PYP V  NGS+S G++W       C G
Sbjct  27   DQVQPFAQPEPVSDAEKAAVKFKPQLAVTYGCDPYPAVDSNGSISAGLKWAGKPDGDCTG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            SP GSQ+YSR+DWY+ KWA++Y WY P A    + +  GHRH W W V+W D P  D+ST
Sbjct  87   SPLGSQVYSRADWYEDKWAIMYAWYFPKARQRLSKYFYGHRHMWQWAVVWIDDPASDNST  146

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKS-TESRIRKKHGLELTKRVGEFQDLIT  226
            +   SMS      +K +P KSKY + D ++K+ S  +     K  L LT+  GE QDLI 
Sbjct  147  VQGVSMSA-SVGYQKRSPPKSKY-VDDSSVKLDSYVDFWWSGKASLRLTEDTGETQDLIQ  204

Query  227  WEQLSDEARAALSNFHRLE-----KRANPPIQDKLFYEVLEKSYPF  267
            W+QL+D AR +LS+F   E     K+   P++D +F + L++SYPF
Sbjct  205  WDQLTDAARESLSSFDFDESLWNTKKIKMPLKDGVFTKNLKRSYPF  250

>PPTG_15224
Length=246

 Score = 192 bits (489),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 150/238 (63%), Gaps = 15/238 (6%)

Query  37   AVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQ  96
            AV    + ++ D+VQPF + KPTT S+++A+KYKP++YV  GCHPYP VQ +GS+S G++
Sbjct  16   AVHAKVSYINHDQVQPFDELKPTTDSEKAAVKYKPKVYVSYGCHPYPAVQADGSVSAGLK  75

Query  97   WKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAW-FVDGHRHFWLWVV  155
                    C GS  GSQ+YSRS WY+GKWA++Y WYLP       W +    RHFW   V
Sbjct  76   GTGPIDGECGGSDLGSQVYSRSSWYKGKWAIMYAWYLP-----KGWAYRSPRRHFWETAV  130

Query  156  IWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT  215
            +W D P P +S+IL  +++  G   KKY P++ +Y +   +++++S + R R +  L  T
Sbjct  131  VWIDDPSPTNSSILGVTLNS-GLRRKKYVPVERQY-VDGSSVQLESCKGRGRPRPMLRFT  188

Query  216  KRVGEFQDLITWEQLSDEARAALSN------FHRLEKRANPPIQDKLFYEVLEKSYPF  267
               GE QDLI WEQL+D+AR AL+N      F + +KR N P++D  F + LE ++PF
Sbjct  189  TISGESQDLIMWEQLTDKARYALANAEFDTGFFK-KKRRNMPLKDDRFEKGLEDAWPF  245

>PITG_22053
Length=245

 Score = 192 bits (488),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 135/225 (60%), Gaps = 11/225 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEVQPF Q  P T SQ+SA+KYKP+L++  GCHPYP V+ N   S G++W       C G
Sbjct  27   DEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGDCTG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            SP GSQ+YSRSDWY+ KWA++Y WY P       + + GHRH+W +VV+WTD+P   +S+
Sbjct  87   SPLGSQVYSRSDWYKNKWAIMYAWYFPKG----RYGLTGHRHYWEYVVVWTDTPTSTNSS  142

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            I   SMS      K   P+  KY IH  ++K+ S  S +  K  L+LTK  GE QDLITW
Sbjct  143  IQGVSMSAGVGHAKATPPML-KY-IHGSSIKLDSYFSFLGSKAALQLTKETGEIQDLITW  200

Query  228  EQLSDEAR-----AALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +Q++  AR      AL     L      P +D +F + LE ++PF
Sbjct  201  DQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLENAFPF  245

>PPTG_18464
Length=247

 Score = 191 bits (486),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 146/228 (64%), Gaps = 9/228 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            ++ D+VQPF Q +PTT S++SA+KYKP+L++  GCHPY  VQ +GS+S G+    +    
Sbjct  24   INHDQVQPFSQPEPTTDSEKSAVKYKPQLHISYGCHPYAAVQADGSVSGGLNRSGWANGD  83

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
             +GS  GSQ+YSRSDWY+GKWA++Y WY P     T     G RHFW ++V+WTDSP P+
Sbjct  84   RKGSDLGSQVYSRSDWYRGKWAIVYAWYYPKGPVFTETGPPGQRHFWSYIVVWTDSPKPN  143

Query  165  DSTILAASM-SGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
             STI   ++ +  G E++   P K  ++    T+KV+S  +   +   ++LT   GE QD
Sbjct  144  HSTIQGVTIPTEVGYEMQ--VPPKEDFIFEQATVKVESYLN--SENQAVQLTDESGEIQD  199

Query  224  LITWEQLSDEARAALSNFHRLEKRANP----PIQDKLFYEVLEKSYPF  267
            LITWEQL+D+ARA LS F    K A      P++D +F  +LE+++PF
Sbjct  200  LITWEQLTDQARATLSEFDFNIKWAYVDMVMPLKDDVFSTILEEAFPF  247

>PITG_04208
Length=245

 Score = 190 bits (483),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 134/225 (60%), Gaps = 11/225 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEVQPF Q  P T SQ+SA+KYKP+L++  GCHPYP V+ N   S G++W       C G
Sbjct  27   DEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGDCTG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            SP GSQ+YSRSDWY+ KWA++Y WY P       + + GHRH+W +VV+WTD+P   +S+
Sbjct  87   SPLGSQVYSRSDWYKNKWAIMYAWYFPKG----RYGLTGHRHYWEYVVVWTDTPTSTNSS  142

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            I   SMS      K   P+  KY IH  ++K+ S  S +  K  L+LTK  GE QDLITW
Sbjct  143  IQGVSMSAGVGHAKATPPML-KY-IHGSSIKLDSYFSFLGSKAALQLTKETGEIQDLITW  200

Query  228  EQLSDEAR-----AALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +Q++  AR      AL     L      P +D +F + L  ++PF
Sbjct  201  DQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLANAFPF  245

>PHYCA_118548
Length=246

 Score = 190 bits (483),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 136/226 (60%), Gaps = 13/226 (6%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q +P T SQ+SA+KYKP+L++  GCHPY  VQ +GS S G++W       C G
Sbjct  28   DQVQPFAQPEPITDSQKSAVKYKPQLHISYGCHPYAAVQADGSASGGLEWSGRVDGDCTG  87

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+YSRSDWY  KWA++Y WY P       + + GHRH+W + ++WTDSP   +S+
Sbjct  88   SQLGSQVYSRSDWYHDKWAIMYAWYFPKGR----YHLGGHRHYWEYAIVWTDSPTSSNSS  143

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            I   SMS  G    K  P   KY I   ++K  S  S +  K  L+LTK  GE QDLITW
Sbjct  144  IQGVSMSA-GVGYGKATPPMLKY-IDGNSIKFDSHFSLLGNKAALQLTKEAGERQDLITW  201

Query  228  EQLSDEARAALSNFHRLEKRA------NPPIQDKLFYEVLEKSYPF  267
            +QL+  AR  L N   L+ +A        P +D +F + L+K++PF
Sbjct  202  DQLTVAARDTL-NGDALDGKAWFTDKDEVPFKDDIFVKRLQKAFPF  246

>PPTG_07664
Length=245

 Score = 189 bits (479),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 140/237 (59%), Gaps = 11/237 (5%)

Query  36   GAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGM  95
             AV    + ++ D+VQPF Q +P T SQ+SA+KYKP+L++  GCHPYP VQ NGS S G+
Sbjct  15   AAVNAKVSRVNHDKVQPFAQLQPITDSQKSAVKYKPQLHISYGCHPYPAVQANGSASGGL  74

Query  96   QWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVV  155
            +W       C GSP GSQ+YSRS WY+ KWA++Y WY P       + + GHRH+W + +
Sbjct  75   EWSGPVDGDCTGSPLGSQVYSRSAWYKEKWAIMYAWYFPKGR----YGITGHRHYWEYAI  130

Query  156  IWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT  215
            +WTDS    +S+I   SMS      K   P+  KY +   ++K+ S  S +  K  L+LT
Sbjct  131  VWTDSATSTNSSIQGVSMSAGVGHAKATPPML-KY-VDGSSIKLDSYFSFMGNKAALQLT  188

Query  216  KRVGEFQDLITWEQLSDEAR-----AALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            K  GE QDLITW+QL+  AR      AL     L  +   P +D +F + L+ ++PF
Sbjct  189  KEHGETQDLITWDQLTVAARDTLNSDALDGNVWLTNKDEVPFKDDIFMQRLKNAFPF  245

>PITG_04248
Length=245

 Score = 189 bits (479),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 143/232 (62%), Gaps = 15/232 (6%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            T ++ DEV+PF Q KPTT S+ +A+KYKP+LYV  GC PYP VQ +GS+S G++      
Sbjct  22   TYINHDEVKPFAQPKPTTDSEVAAVKYKPQLYVSYGCRPYPAVQADGSVSAGLKGSGPMD  81

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              CEGSP GSQ+YSRS WY+ KWA++Y WYLP   ++        RHFW   V+W D P 
Sbjct  82   GECEGSPLGSQVYSRSTWYEDKWAIMYAWYLPKGRNTKY----QRRHFWEAAVVWIDDPA  137

Query  163  PDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
              +STIL  S++ +G   K  APL+ +YL     +K++S +   + +  L  T+  GE Q
Sbjct  138  LANSTILGVSLN-YGRRHKSKAPLERRYL-EGSNVKLESYKGYGKPRPRLRFTQLKGETQ  195

Query  223  DLITWEQLSDEARAALSN-------FHRLEKRANPPIQDKLFYEVLEKSYPF  267
             LITWEQL+ EAR ALSN       F R ++    P++D +F + L+ +YPF
Sbjct  196  HLITWEQLTKEARDALSNAKFNTGLFKRTKREM--PLKDGVFEKRLKDAYPF  245

>PPTG_07671
Length=246

 Score = 188 bits (478),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 151/272 (56%), Gaps = 32/272 (12%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA     I  L     + ++IN                      DEV+PF Q KPTT
Sbjct  1    MNLRAFVLAAIAALGVVHAEVNYINH---------------------DEVEPFAQPKPTT  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S+++A+KYKP+ +V  GCHPYP VQ +GS+S G++        CEGSP GSQ+YSRS W
Sbjct  40   DSEKAAVKYKPQFHVSYGCHPYPAVQADGSVSAGLKGSGPMDGECEGSPLGSQVYSRSGW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+  WA++Y WYLP    ST +     RH+W   V+W D P   +STIL  S++ +G   
Sbjct  100  YEDMWAIMYAWYLPKG-RSTKY---QRRHYWEVAVVWIDDPALANSTILGVSLN-YGRRH  154

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN  240
                P++ +YL H   +K++S +     +  L  T   GE QDLITWEQL++EAR ALSN
Sbjct  155  NSQVPVEEQYL-HGSRVKLESFKGFGVPRPRLRFTDLEGETQDLITWEQLTEEARDALSN  213

Query  241  --FHR---LEKRANPPIQDKLFYEVLEKSYPF  267
              F R      R + P++D +F + LE +YPF
Sbjct  214  AKFQRGLIKRLRGDMPLKDGVFEKRLEDAYPF  245

>PITG_19938
Length=245

 Score = 187 bits (476),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 136/225 (60%), Gaps = 11/225 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEVQPF Q  P T SQ+SA+KYKP+L++  GCHPYP V+ NGS S G++W       C G
Sbjct  27   DEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGDCTG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            SP GSQ+YSRSDWY+ KWA++Y WY P       + + GHRH+W +VV+W DS     S+
Sbjct  87   SPLGSQVYSRSDWYKNKWAIMYAWYFPKG----RYGLTGHRHYWEYVVVWADSSTSTSSS  142

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            I   SMS      K   P+  KY IH  ++K+ S  S +  K  L+LTK  GE QDLITW
Sbjct  143  IQGVSMSAGVGHAKATPPML-KY-IHGSSVKLDSYFSFLGSKAALQLTKETGETQDLITW  200

Query  228  EQLSDEARAALSNFHR-----LEKRANPPIQDKLFYEVLEKSYPF  267
            +Q++  AR  L++        L  +   P +D +F + LE ++PF
Sbjct  201  DQMTVAARDTLNSDTLDGNVWLTNKDEVPFKDTIFLKRLEDAFPF  245

>PITG_04200
Length=247

 Score = 184 bits (467),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 139/233 (60%), Gaps = 16/233 (7%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            T ++ DEV+PF Q  PTT S+++A+KYKP+LYV  GCHPYP VQ NG +S G++      
Sbjct  22   TYINHDEVKPFAQPTPTTDSEKAAVKYKPKLYVSYGCHPYPAVQANGFVSAGLKGSGPID  81

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              CEGS  GSQ+YSRS WY+ KWA++Y WYLP    S        RHFW   V+W D P 
Sbjct  82   GECEGSSLGSQVYSRSMWYEDKWAIMYAWYLPKGRSSKY----QRRHFWEAAVVWIDDPA  137

Query  163  PDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
              +STIL  S++ +G   K   PL+ ++L     +K++S     R +  L+ T+  GE Q
Sbjct  138  LANSTILGVSLN-YGRRQKSEVPLELQFL-DGSNVKLESYRGFGRPRPRLQFTQLEGETQ  195

Query  223  DLITWEQLSDEARAALSN--------FHRLEKRANPPIQDKLFYEVLEKSYPF  267
            DLITWEQL+DEAR  LS+        F R   R   P++D +F + L  +YPF
Sbjct  196  DLITWEQLTDEARDGLSDAEFNTGLFFKR--TRREMPLKDGVFEKRLIDAYPF  246

>PHYRA_81103
Length=252

 Score = 182 bits (462),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 136/225 (60%), Gaps = 7/225 (3%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF-RPSCE  106
            D+VQPF Q    T+SQ++A+K+KP+L   +GC+PYP VQ +GS S G++W     R  C 
Sbjct  30   DQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRGDCT  89

Query  107  GSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDS  166
              P GSQIY+RS WY+  WA++YTWY P   +++     GHRH W +VV+W D+P  D+S
Sbjct  90   DPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGLGHRHNWEFVVVWIDNPALDNS  149

Query  167  TILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLIT  226
            TIL  SMS       K AP KSKY I   ++KV    S +     LELT+  GE QDLI 
Sbjct  150  TILGVSMSA-SIGYSKRAPPKSKY-IDGTSVKVSYFYSIVFGNTALELTEDAGETQDLIM  207

Query  227  WEQLSDEARAALSNFHRLE----KRANPPIQDKLFYEVLEKSYPF  267
            W+QL D AR AL+            A  P++D +F + L+KS+PF
Sbjct  208  WDQLPDVARDALNTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252

>PHYCA_118356
Length=252

 Score = 182 bits (461),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/232 (43%), Positives = 138/232 (59%), Gaps = 14/232 (6%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            TLMD D+V+PF Q  PT   +E+A+KYKP L+V  GCHPYP VQ NGS+S G++      
Sbjct  22   TLMDHDKVKPFAQPIPTNSFEEAAVKYKPELFVSYGCHPYPAVQANGSVSAGLEGSGPDD  81

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              C+GS  GSQ+YSRSDWY  KWA++YTWYLP             RHFW   VIW D P 
Sbjct  82   GECKGSRLGSQVYSRSDWYNDKWAIMYTWYLPKGRSGKL----QDRHFWETAVIWIDDPT  137

Query  163  PDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
             +DS +L  S++     + K A +K ++L   K LK +S E+    K  L  T++ G+ Q
Sbjct  138  LEDSKLLGVSLNYEDRRVSKIA-IKGRHLNASKVLKFESYEAEKSPKPRLRFTEKAGKTQ  196

Query  223  DLITWEQLSDEARAALSN-------FHRLEKRANPPIQDKLFYEVLEKSYPF  267
            DLITW+QL  +AR  LS        F  +++    P++D++F + L+ ++PF
Sbjct  197  DLITWDQLPAKARKGLSTTKFYSSPFGSVKREM--PLKDEVFLKRLKDAWPF  246

>PHYSO_526832
Length=249

 Score = 181 bits (460),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/272 (36%), Positives = 151/272 (56%), Gaps = 28/272 (10%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M  RA+F   +   A    + +WIN                      D+V PF Q +P  
Sbjct  1    MQFRALFLAAVGCFAAVQAEVNWINH---------------------DQVHPFAQVEPVN  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S ++AIK+KP+L +  GCHPYP VQ +G++S+G++W       C+GS  GSQ+YSRS W
Sbjct  40   ASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWAGKADGKCKGSGLGSQVYSRSAW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            ++GK+A++Y WY P   +        HRH WL++V+W D+P+ ++  IL   +   G   
Sbjct  100  FEGKFAIMYAWYFPKGFEQRGKINYSHRHLWLYLVLWIDNPENENPAILGVWLRTAGGNE  159

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALS-  239
            ++  P  +K+L    +LKV   +S    K G++LT+  GEFQDLITWEQ+++EAR AL+ 
Sbjct  160  RR-TPPDAKFL-DGSSLKVDYYKSSWHGKTGIQLTENPGEFQDLITWEQMTEEARIALTE  217

Query  240  ---NFHRLEKR-ANPPIQDKLFYEVLEKSYPF  267
               + H  E++  + P  D  F   L+K++ F
Sbjct  218  ADFDGHWQERKDLDVPFIDGEFTVNLKKAWVF  249

>PHYRA_74306
Length=245

 Score = 181 bits (459),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 146/237 (62%), Gaps = 11/237 (5%)

Query  36   GAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGM  95
             +V    T +D D+VQPF + +P T S+++A+K+KP+L V  GC+PYP VQ +GS+S G+
Sbjct  15   ASVQAEVTYIDHDKVQPFAEPEPMTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGL  74

Query  96   QWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVV  155
            +        C GS  GSQ+YSRSDWY+ KWA++YTWYLP    +        RHFW   V
Sbjct  75   RGSGPADGECRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRSTR----HQRRHFWETAV  130

Query  156  IWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT  215
            +W D P   +STIL  SM+ +G   K+  P+K KYL    ++K++S  +    K  L+ T
Sbjct  131  VWIDDPALANSTILGVSMN-YGWRSKEQTPVKVKYL-DGSSVKLESYRAYGFPKPRLQFT  188

Query  216  KRVGEFQDLITWEQLSDEARAALS-----NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +  G+FQDLITWEQL++EAR ALS      +   +K+   P++D +F   L+ ++PF
Sbjct  189  QEDGQFQDLITWEQLTEEARDALSTADFDTYLIEQKKREMPLKDDIFEYRLKDAWPF  245

>PHYCA_122048
Length=236

 Score = 178 bits (452),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 132/223 (59%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D ++V PF Q + TTISQ++AIK+KP++++  GCHPYP V E G  S G++       S
Sbjct  22   IDHNQVVPFAQPEATTISQKAAIKFKPQIHITNGCHPYPAVNEAGETSGGLKTSGAPSSS  81

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS WY GKWA++Y+WY P    ST     GHRH W  VV+W D+PD  
Sbjct  82   CKGSGWGSQVYGRSTWYNGKWAIMYSWYFPKDSPSTGL---GHRHDWEHVVVWIDNPDVA  138

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            + TILA S S        YAP  S  +  D T    + ES     H L++T + GE QDL
Sbjct  139  NPTILATSPSAH-SGYSFYAPPSSDSV--DGTSVKVNYESNWPINHALDMTSKSGETQDL  195

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+QLS+ AR AL+       +AN P+ D  F   L K++PF
Sbjct  196  IMWDQLSEAARYALNTTDF--GKANVPMNDGNFVAKLGKAWPF  236

>PPTG_17049
Length=255

 Score = 178 bits (451),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 142/229 (62%), Gaps = 12/229 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V+PF Q +P T SQ++A+K+KP+L +  GCHPYP VQ +G++S G+++       C+G
Sbjct  28   DRVKPFPQPEPITTSQKAAVKFKPQLSIAFGCHPYPAVQADGAVSGGLKYSGKPDGDCKG  87

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALD--STAWFVDGHRHFWLWVVIWTDSPDPDD  165
            S  GSQ+YSRS WY+  WA+ Y WYLP   +  S    V+GHRHFW +V +W ++P  ++
Sbjct  88   SALGSQVYSRSTWYRDVWAITYAWYLPKGYERFSGLSMVEGHRHFWGYVTVWINNPAVEN  147

Query  166  STILAASMSG-FGDEIKKYAPLKSKYLIHDKTLKVK---STESRIRKKHGLELTKRVGEF  221
            + IL  SMSG  G + +  AP+  K  +   TLK++         + K GL   + VG+F
Sbjct  148  AYILGVSMSGQLGHDTQ--APVDKK-CVDGSTLKLEFDGHVMDGAKGKQGLRCVEAVGKF  204

Query  222  QDLITWEQLSDEARAALS--NFHRLEK-RANPPIQDKLFYEVLEKSYPF  267
            QDLITW+QL++ AR +L+  NF  + +     P++D +F  +L  ++PF
Sbjct  205  QDLITWDQLTEAARDSLNTYNFDSIGRDMGTVPLKDGVFTNLLNSTWPF  253

>PHYSO_254112
Length=224

 Score = 176 bits (447),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 139/269 (52%), Gaps = 50/269 (19%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA+    ++  AT   +  WIN                      D+VQPF Q +P T
Sbjct  1    MNLRALLLAAVSCFATIQAEVTWINH---------------------DQVQPFAQPEPAT  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S+ +A+K+KP L V  GC PYP V  NGS+S  ++W       CEGS  GSQ+YSRSDW
Sbjct  40   DSETAAVKFKPFLEVSYGCEPYPAVSANGSVSASLKWTGKNDGDCEGSALGSQVYSRSDW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+ KWAM+Y WY P      +     HRH WL  V+W D+P  D+STILA S        
Sbjct  100  YKDKWAMMYAWYFPKGWQGAS--TVSHRHLWLHAVVWIDNPALDNSTILAVSTP------  151

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALS-  239
                            +K+ ++      K  L+LT   GE QDLITW+Q+++EAR ALS 
Sbjct  152  ----------------VKLDASRGFWASKMLLKLTTDKGESQDLITWDQMTEEARTALSE  195

Query  240  -NFHR-LEKRANP--PIQDKLFYEVLEKS  264
             NF + L KR N   P +D +F + L+K+
Sbjct  196  ANFDKHLFKRKNTKVPFKDGVFTDKLKKA  224

>PHYCA_118551
Length=245

 Score = 177 bits (448),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 138/230 (60%), Gaps = 11/230 (5%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            T +D D V+PF Q KP T S+++A+KYKP+L V  GCHPYP VQ +GS+S G++      
Sbjct  22   TYIDHDTVKPFPQPKPKTDSEKAAVKYKPQLLVSYGCHPYPAVQADGSVSAGLKGTGPAA  81

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              C GS  GSQ+YSRSDWY+ KWA++Y+WYLP    +        RH W   V+W D P 
Sbjct  82   GECGGSALGSQVYSRSDWYKDKWAIMYSWYLPKGRPAKY----QRRHLWETAVVWIDDPS  137

Query  163  PDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
              +STIL  S++ +G   K  AP++S++L  D  +K++S       +  L  T  VGE Q
Sbjct  138  LANSTILGVSLN-YGWRHKTMAPIESEFL-DDSRVKLESYRGFSYPRPKLRFTTHVGETQ  195

Query  223  DLITWEQLSDEARAALSNFHR-----LEKRANPPIQDKLFYEVLEKSYPF  267
            DLITWEQL+ EAR ALSN           R   P++D +F + L+ ++PF
Sbjct  196  DLITWEQLTVEAREALSNAEFDSGLIKTTRREMPLKDGVFEKRLKDAWPF  245

>PHYCA_121494
Length=248

 Score = 176 bits (447),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 133/225 (59%), Gaps = 7/225 (3%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V P   +   T +Q++A+KY P+L++++GCHPY  VQ +G++S+G++W      +C+G
Sbjct  26   DTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPQDGACKG  85

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            SP GSQ+Y+RS W +GKWA++Y WY PM          GHR+ W + VIW D P  D+ST
Sbjct  86   SPLGSQVYARSTWVKGKWAIMYAWYFPMGQAPVPPVGLGHRNGWEYAVIWLDRPTADNST  145

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            +L  S+S       K AP K K++    +LKV    + I +   ++ T+  GEFQ LITW
Sbjct  146  LLGVSLSA-AVGWSKEAPAKQKWM-DGNSLKVSYYYNNIFRNTAVKYTEEKGEFQTLITW  203

Query  228  EQLSDEARAALSNFHRLE-----KRANPPIQDKLFYEVLEKSYPF  267
            +QL D AR AL N    E      R   P++D +F E L  +YPF
Sbjct  204  DQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  248

>PHYSO_329843
Length=239

 Score = 176 bits (446),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 141/267 (53%), Gaps = 28/267 (10%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LR  FF   TI+A S   A                      ++D D+V PF Q +  T
Sbjct  1    MNLRG-FFTVATIVAVSTASAQ-------------------AEIIDHDQVVPFAQPEAVT  40

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
            ISQ++A+K+KP++++  GCHPYP   E G  S G++       SC+GS  GSQ+Y RS W
Sbjct  41   ISQKAAVKFKPQIHITNGCHPYPAANEAGQTSGGLKPTGAPSSSCKGSGWGSQVYGRSTW  100

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y G+WA++Y+WY P    ST     GHRH W  VV+W D+PD ++ TIL+ S S      
Sbjct  101  YSGRWAIMYSWYFPKDSPSTGL---GHRHDWEHVVVWIDNPDVENPTILSTSPSAHSG-Y  156

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN  240
              Y P  +  +  D T    + ES     H L++T   GEFQDLI W+QLSD AR AL+ 
Sbjct  157  SYYVPPSADSI--DGTSVKVNYESHWPINHALDMTSESGEFQDLIMWDQLSDAARLALNT  214

Query  241  FHRLEKRANPPIQDKLFYEVLEKSYPF  267
                   AN P+ D  F   L K++PF
Sbjct  215  TSF--GSANVPMNDGNFLTKLGKAWPF  239

>PHYRA_81102
Length=251

 Score = 176 bits (446),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 140/231 (61%), Gaps = 15/231 (6%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V+PF Q  P T+SQ++A+K+KP+L +D GCHPYP VQ++GS+S G++W       C G
Sbjct  25   DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTA------WFVDGHRHFWLWVVIWTDSP  161
            S  GSQIY+RS W    WA++Y WY P    +T       +F  GHRH W +VV+W D+P
Sbjct  85   SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWIDNP  142

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
              +++T+L  SMS       K AP   KY +   ++KV    + +     L+LT+  GEF
Sbjct  143  GLENATVLGVSMSA-SIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200

Query  222  QDLITWEQLSDEARAALSNF---HRLEKRAN--PPIQDKLFYEVLEKSYPF  267
            QDLI W+QLS  AR +L++      L   A    P++D +F E+L+K++PF
Sbjct  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251

>PHYRA_72504
Length=251

 Score = 176 bits (446),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 140/231 (61%), Gaps = 15/231 (6%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V+PF Q  P T+SQ++A+K+KP+L +D GCHPYP VQ++GS+S G++W       C G
Sbjct  25   DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTA------WFVDGHRHFWLWVVIWTDSP  161
            S  GSQIY+RS W    WA++Y WY P    +T       +F  GHRH W +VV+W D+P
Sbjct  85   SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWIDNP  142

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
              +++T+L  SMS       K AP   KY +   ++KV    + +     L+LT+  GEF
Sbjct  143  GLENATVLGVSMSA-SIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200

Query  222  QDLITWEQLSDEARAALSNF---HRLEKRAN--PPIQDKLFYEVLEKSYPF  267
            QDLI W+QLS  AR +L++      L   A    P++D +F E+L+K++PF
Sbjct  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251

>PHYRA_72386
Length=245

 Score = 176 bits (445),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 131/226 (58%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            PT +  D+V+PF Q +P TIS+ +A+K+KP+L V +GCHPYP V + G +  G++     
Sbjct  28   PTTISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSP  87

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C+GS  GSQIY RS W++  WA++Y+WY P    ST     GHRH W  V++W D+P
Sbjct  88   TAGCKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNP  144

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            D  +  ILA S S       KYAP  +  L  D T      ES     H L+ T   GEF
Sbjct  145  DVPNPIILAVSPSAH-SGYSKYAPPGADIL--DGTSAKIRYESSYPMNHALDATTDAGEF  201

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI WEQ+SD AR AL+  +  +  AN P+ D  F   L+K++PF
Sbjct  202  QDLIMWEQMSDLARQALNTMNFGD--ANVPMNDGNFVGKLDKAWPF  245

>PHYRA_72344
Length=245

 Score = 176 bits (445),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 131/226 (58%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            PT +  D+V+PF Q +P TIS+ +A+K+KP+L V +GCHPYP V + G +  G++     
Sbjct  28   PTTISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSP  87

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C+GS  GSQIY RS W++  WA++Y+WY P    ST     GHRH W  V++W D+P
Sbjct  88   TAGCKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNP  144

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            D  +  ILA S S       KYAP  +  L  D T      ES     H L+ T   GEF
Sbjct  145  DVPNPIILAVSPSAH-SGYSKYAPPGADIL--DGTSAKIRYESSYPMNHALDATTDAGEF  201

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI WEQ+SD AR AL+  +  +  AN P+ D  F   L+K++PF
Sbjct  202  QDLIMWEQMSDLARQALNTMNFGD--ANVPMNDGNFVGKLDKAWPF  245

>PHYCA_10034
Length=274

 Score = 175 bits (444),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 149/270 (55%), Gaps = 12/270 (4%)

Query  3    LRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTTIS  62
            L AI       ++  L K + +N  V++Y     A   +   +  D V P   +   T +
Sbjct  12   LEAIERAKTEGVSKGLAKEYHVN-RVTLY----RACCQAQKAIPYDTVVPIPSQTSKTDA  66

Query  63   QESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQ  122
            Q++A+KY P+L++++GCHPY  VQ +G++S+G++W      +C+GSP GSQ+Y+RS W +
Sbjct  67   QKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPHDGACKGSPLGSQVYARSTWVK  126

Query  123  GKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKK  182
            GKWA++Y WY PM          GHR+ W + VIW D P  D+ST+L  S+S       K
Sbjct  127  GKWAIMYAWYFPMGQAPVPPVGLGHRNGWEYAVIWLDRPTADNSTLLGVSLSA-AVGWSK  185

Query  183  YAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFH  242
             AP K K++    +LKV    + I     ++ T+  GEFQ LITW+QL D AR AL N  
Sbjct  186  EAPAKQKWM-DGNSLKVSYYYNNIFHNTAVKYTEEKGEFQTLITWDQLPDAARNALINTD  244

Query  243  RLE-----KRANPPIQDKLFYEVLEKSYPF  267
              E      R   P++D +F E L  +YPF
Sbjct  245  WDETPFNVARVKMPMKDGVFMEKLTGAYPF  274

>PHYSO_259736
Length=231

 Score = 173 bits (438),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 145/272 (53%), Gaps = 46/272 (17%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M  RA+F   +   A    + +WIN                      D+V PF Q +P  
Sbjct  1    MQFRALFLAAVGCFAAVQAEVNWINH---------------------DQVHPFAQVEPVN  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S ++AIK+KP+L +  GCHPYP VQ +G++S+G++W       C+GS  GSQ+YSRSDW
Sbjct  40   ASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWGGKPDGKCKGSGLGSQVYSRSDW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            YQGKWA++                  HRH WL++V+W D+P+  +  IL   +   G   
Sbjct  100  YQGKWAII------------------HRHLWLYLVLWIDNPEAANPAILGVWLRTAGGNE  141

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALS-  239
            ++  P      I   +LKV+  +S    K G++LT+  GEFQDL+TWEQ+++EAR AL+ 
Sbjct  142  QRVPP--DAKFIDGSSLKVEYYKSSWHGKTGIQLTENPGEFQDLVTWEQMTEEARIALTE  199

Query  240  -NF--HRLEKR-ANPPIQDKLFYEVLEKSYPF  267
             NF  H  E++  + P  D  F   LEK++ F
Sbjct  200  ANFDGHWQERKDLDVPFIDGEFTVNLEKAWIF  231

>PITG_22916
Length=248

 Score = 172 bits (437),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 133/227 (59%), Gaps = 6/227 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q    T  +++A+KYKP+LY+++GCHPYP V+E+G++S G++W       
Sbjct  23   IDHDQVRPFAQPNAATTKEKAAVKYKPQLYIEDGCHPYPAVEEDGTISAGLEWSGDHNGH  82

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+ SPRGSQ+YSR   Y+ K+A++Y WY P     +    D HRH W + +IW D  D D
Sbjct  83   CKKSPRGSQVYSRGGSYKDKYAIMYAWYFPKGKGHSRKHHDEHRHDWEFGIIWFDR-DSD  141

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
              + +A   +  G ++    PL+  +++    +K++S  +    K GL LTK+ G+ QDL
Sbjct  142  TDSSIAGVTTNIGRDLHDEVPLQPVHVV-GSHIKLESYSTFWSAKQGLRLTKKKGDIQDL  200

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPI----QDKLFYEVLEKSYPF  267
            I WEQL   A+ AL++      +A  P+     D  F E +  SYPF
Sbjct  201  IQWEQLPKAAQTALNDADFDTDKAKTPVVVPFNDNYFQEKVAASYPF  247

>PHYCA_129784
Length=246

 Score = 172 bits (435),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 133/226 (59%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            P  +D D+V+PF Q +P TIS+ +A+K+KP+L+V +GCHPYP V + G    G++     
Sbjct  29   PATIDHDQVKPFPQPQPVTISERAAMKFKPQLHVVDGCHPYPAVNDAGETGGGLKTTGSP  88

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C+GS  GSQ+Y RS W++  WA++Y+WY P    ST     GHRH W  V++W  +P
Sbjct  89   TAGCKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWISNP  145

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            D  + TILA + S       KYAP  S   +   ++KV+  ES     H  ++T   GEF
Sbjct  146  DVPNPTILAVTPSAHSG-YSKYAP-PSADTVDGTSIKVRY-ESTYPMNHATDVTTEAGEF  202

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI W+Q++D AR AL+     +  AN P+ D  F   L+K++PF
Sbjct  203  QDLIMWDQMTDAARNALNTVSFGD--ANVPMNDGNFVPKLDKAWPF  246

>PPTG_17409
Length=235

 Score = 171 bits (434),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 131/223 (59%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P TIS+++A+K+KP+L++  GCHPYP V   G    G++       S
Sbjct  21   IDHDQVQPFAQPEPVTISEKAAVKFKPQLHITNGCHPYPAVNAAGDTGGGLKPTGAPSGS  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS W+ G WA++Y+WY P    S++    GHRH W  VVIW ++PD  
Sbjct  81   CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSSSL---GHRHDWENVVIWINNPDVP  137

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA   S  G    +YAP  +  +  D T    + ES     H  + T   G+FQDL
Sbjct  138  NPVILAICPSAHGG-YSRYAPPDADTI--DGTSAKVNYESHWPINHATDTTSEGGDFQDL  194

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+QL+D AR AL +    +  AN P+++  F   LEK++PF
Sbjct  195  IMWDQLTDAARTALQDTDFGD--ANVPMKEGSFLSNLEKAWPF  235

>PPTG_17125
Length=283

 Score = 172 bits (436),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 144/232 (62%), Gaps = 17/232 (7%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            ++V+PF + +P T SQ++A+KYKP+L +++GCHPYP VQ++GS+S G++W       C G
Sbjct  57   NQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTG  116

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDST----AWFVDGHRHFWLWVVIWTDSPDP  163
            S  GSQIY+RS W    WA++Y WY P    +        + GHRH W + ++W D+P+ 
Sbjct  117  SKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPEL  176

Query  164  DDSTILAASMS---GFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGE  220
            ++STIL  SMS   G+  +     P +++Y+  D ++K+K   + +     L+LT+  GE
Sbjct  177  ENSTILGVSMSASVGYASQ----TPPETRYVDGD-SVKLKYYYNHLLGSTSLQLTEATGE  231

Query  221  FQDLITWEQLSDEARAALSNFHRLEKRAN-----PPIQDKLFYEVLEKSYPF  267
            FQDLITW++LS  AR +L++    E   N      P++D +F E+L K++PF
Sbjct  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283

>PPTG_08893
Length=251

 Score = 171 bits (433),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 134/226 (59%), Gaps = 8/226 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D VQPF Q  PTT +Q++ +KYKP+L V+EGC PYP VQ++G++S G++W       C+G
Sbjct  28   DTVQPFPQPVPTTEAQKAILKYKPQLKVEEGCRPYPAVQQDGAISSGLRWSGPEDIGCKG  87

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAW-FVDGHRHFWLWVVIWTDSPDPDDS  166
            S RGSQIY+RS  ++ KWA++YTWY P            GHRH W + V+W D    D+S
Sbjct  88   SLRGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPGPRSSGHRHGWEYAVVWLDKLTADNS  147

Query  167  TILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLIT  226
            TIL  S+S      K+ +P   +YL    +LKV    +   K   ++ T+  G FQDLI 
Sbjct  148  TILGTSLSAAVGWAKE-SPTPKEYL-DGNSLKVAYYFNDDFKNTAVKYTQAGGAFQDLII  205

Query  227  WEQLSDEARAALSNFHRLE-----KRANPPIQDKLFYEVLEKSYPF  267
            W+QLSD ARA+LSN    E      R   P++D +F E L  +YPF
Sbjct  206  WDQLSDVARASLSNTDWDETPFNVARVKMPMKDGVFEEKLSGAYPF  251

>PPTG_19331
Length=368

 Score = 174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 134/223 (60%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q +P TIS+++A+K+KP++++  GCHPYP V E G  S G++ K      
Sbjct  152  IDHDQVKPFPQPEPVTISEKAAVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAK  211

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS W QG WA++Y+WY P    S+     GHRH W  V++W D+PD +
Sbjct  212  CKGSGWGSQVYGRSTWVQGIWAIMYSWYFPKDSPSSGL---GHRHDWEHVIVWIDNPDVE  268

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S      K+  P  +   +   ++KVK  ES     H LE T   G+FQDL
Sbjct  269  NPKILAVTPSAHDGYSKQVPP--NADCVDGTSVKVK-YESHWPINHALESTSEGGDFQDL  325

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+QLS++AR A++       +AN P  D  F   LEK++PF
Sbjct  326  IMWDQLSEDARRAMNGVGW--GKANTPFNDGNFKPKLEKAWPF  366

>PHYRA_74356
Length=244

 Score = 170 bits (431),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 141/230 (61%), Gaps = 12/230 (5%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            T +D D+VQPF + +PTT S+++A+K+KP+L V  GC+PYP VQ +GS+S G++      
Sbjct  22   TYIDHDQVQPFAEPEPTTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLKGSGPAD  81

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              C GS  GSQ+YSRSDWY+ KWA++Y WYLP        +    RH+W   V+W D P 
Sbjct  82   GECTGSSLGSQVYSRSDWYEDKWAIMYAWYLPKGN-----YKYQRRHYWETAVVWIDDPA  136

Query  163  PDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
              +STIL  SM+ +G   +   P+++++L    ++K+ S       K  L+ T+  GEFQ
Sbjct  137  LSNSTILGVSMN-YGRRSEFETPVQARFL-DGSSVKLDSYRGYGYPKPRLQFTQEEGEFQ  194

Query  223  DLITWEQLSDEARAALSNFH-----RLEKRANPPIQDKLFYEVLEKSYPF  267
            DLITWEQL++EAR ALS          +K+   P++D +F   L+ ++PF
Sbjct  195  DLITWEQLTEEARDALSTADFDGPLFKKKKRKMPLKDGIFEFRLKDAWPF  244

>PHYSO_249692
Length=248

 Score = 170 bits (431),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 131/226 (58%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            PT +  D+V+PF Q +P TIS+ +A+K+KP+L+V  GCHPYP V + G  S G++     
Sbjct  31   PTTISHDQVRPFAQPEPVTISERAAVKFKPQLHVTNGCHPYPAVNDAGETSGGLKTSGAP  90

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C+GS  GSQ+Y RS W++  WA++Y+WY P    ST     GHRH W  V++W ++P
Sbjct  91   SAGCKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWINNP  147

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            D  D  ILA + S       KY+P  +  L  D T    + ES     H  ++T   G+F
Sbjct  148  DVPDPIILAVTPSAHSG-YSKYSPPNADTL--DGTSIKVNYESNYPMNHATDVTTEGGDF  204

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI W+Q+SD AR AL+     +  AN P+ D  F   L++++PF
Sbjct  205  QDLIMWDQMSDLARRALNEVSFGD--ANVPMNDGNFVGKLDRAWPF  248

>PHYCA_107869
Length=342

 Score = 173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 133/223 (60%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q +P TIS+++A+KYKP++++  GCHPYP V E G  S G++ K      
Sbjct  128  IDHDQVKPFAQPEPVTISEKAAVKYKPQIHIVNGCHPYPAVNEAGETSGGLKTKGAPSAG  187

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS W +G WA++Y+WY P    S+     GHRH W  V++W D+PD +
Sbjct  188  CKGSGWGSQVYGRSTWVRGVWAIMYSWYFPKDSPSSGL---GHRHDWEHVIVWIDNPDIE  244

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S      K+  P      +   ++KVK  ES+    H L+ T   G+FQDL
Sbjct  245  NPKILAVTPSAHSGYSKQVPPKAD--CVDGTSVKVK-YESKWPVNHALDSTSEGGDFQDL  301

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+QLS+ AR A++       +AN P  D  F   L+K++PF
Sbjct  302  IMWDQLSENARRAMNGVGW--GKANTPFNDGNFLPKLDKAWPF  342

>PPTG_16851
Length=249

 Score = 170 bits (430),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 132/226 (58%), Gaps = 9/226 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D VQPF Q+ P T +Q++ +KYKP+L ++EGCHPYP VQ++GS+S G++W       C+G
Sbjct  27   DSVQPFSQQVPNTDAQKAILKYKPQLKIEEGCHPYPAVQKDGSISSGLKWSGPDNIGCKG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDST-AWFVDGHRHFWLWVVIWTDSPDPDDS  166
            SP GSQ+Y+R+ W +GKWA++Y WY P       A    GHRH W + V+W D     +S
Sbjct  87   SPLGSQVYARATWLKGKWAVMYAWYFPKGRAPIPAPRSYGHRHGWEYAVVWLDKASA-NS  145

Query  167  TILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLIT  226
            T+L  SMS      K+ +P   +YL    +LKV    +       ++ T+  GEFQDLI 
Sbjct  146  TLLGTSMSAAIGWAKE-SPTPKEYL-DGNSLKVAYYFNDDSINTAVKYTQDAGEFQDLII  203

Query  227  WEQLSDEARAALSNFHRLE-----KRANPPIQDKLFYEVLEKSYPF  267
            W+QL D AR AL N    E      R   P++D +F E L  +YPF
Sbjct  204  WDQLPDVARNALVNTDWDETPLNVARVKMPMKDGVFMEKLNGAYPF  249

>PHYCA_129485
Length=251

 Score = 170 bits (430),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 143/234 (61%), Gaps = 21/234 (9%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V+PF Q KP T+S ++A+K+KP+L + +GCHPYP VQ++GS++ G++W       C G
Sbjct  25   DQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQDGECTG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDS------TAWFVDGHRHFWLWVVIWTDSP  161
            S  GSQIY+RS W    WA++Y WY P    +      T  F  GHRH W +V++W D+P
Sbjct  85   SKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLF--GHRHNWEYVIVWIDNP  142

Query  162  DPDDSTILAASMS---GFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV  218
               +STIL  SMS   G+  +     P ++ Y+  D ++K++   + +     L+LT+  
Sbjct  143  KSKNSTILGVSMSAAVGYASQ----TPPEAMYVDGD-SVKLEYYYNHLLGSTSLQLTEDT  197

Query  219  GEFQDLITWEQLSDEARAALSNFHRLEKRAN-----PPIQDKLFYEVLEKSYPF  267
            GEFQDLITW++LS  AR +L++    E   +      P++D +F E+L+K++PF
Sbjct  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251

>PHYSO_261265
Length=247

 Score = 169 bits (429),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 133/234 (57%), Gaps = 16/234 (7%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN-YF  101
             ++  DEV PF Q  P T   ++ +KYKP L + EGCHPYP VQ+NG +S G++W +   
Sbjct  21   NVIPYDEVHPFAQPAPVTDLHKTMLKYKPHLKIKEGCHPYPAVQKNGDISGGLEWSSPTD  80

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C+GSP GSQ+Y+RS W +GK+A++Y WY PM       F  GHR+ W + ++W DS 
Sbjct  81   NAECKGSPLGSQVYARSSWVKGKFAIMYAWYFPMGRAPLLPF--GHRNGWEYAIVWLDSV  138

Query  162  DPDDSTILAASMS---GFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV  218
               +STIL  S+S   G+  E+    P   KYL     LKV    +R  +   +E T+ +
Sbjct  139  SSTNSTILGTSLSAAVGWAKEV----PRNRKYL-DGNNLKVAYYFNRDVRCTAVEYTEEI  193

Query  219  GEFQDLITWEQLSDEARAALSNFHRLEKRANP-----PIQDKLFYEVLEKSYPF  267
            GEFQD+ITW+QL    R +LSN        N      P++D +F E L  +YPF
Sbjct  194  GEFQDVITWDQLPAPTRDSLSNTDWDHTPFNVALLKMPMKDGVFQEKLNSAYPF  247

>PPTG_00471
Length=239

 Score = 169 bits (428),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 118/219 (54%), Gaps = 2/219 (1%)

Query  46   DVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSC  105
            D D+VQPF Q +P T ++++AIKYKP L V  GCHPYP V   G  S G++        C
Sbjct  21   DHDKVQPFAQPEPITDAEKAAIKYKPSLAVKAGCHPYPAVNAAGETSAGLKGTGAPDGEC  80

Query  106  EGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDD  165
            EGSP GSQ+YSRS WY+GKWA++Y WY P  +        G RH W+ +V+W D+P    
Sbjct  81   EGSPLGSQVYSRSTWYEGKWAIMYAWYFPKDIKDVGLIKKGLRHDWVNLVVWLDNPALAK  140

Query  166  STILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLI  225
              ILA + S FG   K   P K   +I+  T KV       +  H +      GE+QDLI
Sbjct  141  PKILATATSTFGAYYKISKPFKRSEVINGITPKVCYDNDDYKGWHTIFPFHEEGEYQDLI  200

Query  226  TWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKS  264
             W QL+D AR A  N    E  AN P  D  F   L+ +
Sbjct  201  QWNQLTDAAREAFENGDFGE--ANVPFNDAYFETNLKSA  237

>PPTG_15230
Length=252

 Score = 169 bits (428),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 130/226 (58%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            P  +  D+V+PF Q +P TIS+ +AIK+KP++++ +GCHPYP V + G    G++     
Sbjct  35   PATIGHDQVKPFAQPQPVTISERAAIKFKPQIHIGDGCHPYPAVNDIGETGGGLKTTGSP  94

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C+GS  GSQ+Y RS W++  WA++Y+WY P    ST     GHRH W  V++W ++P
Sbjct  95   TAGCKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWINNP  151

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            D  D  ILA + S       KYAP  +  L  D T    + ES     H  ++T   GEF
Sbjct  152  DVPDPIILAVTPSAH-SGYSKYAPPNADTL--DGTSVKVNYESTYPMNHATDVTTDPGEF  208

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI W+Q++D AR AL+     +  AN P+ D  F   L+K++PF
Sbjct  209  QDLIMWDQMTDAARLALNTVSFGD--ANVPMNDGNFIPKLDKAWPF  252

>PHYRA_76249
Length=326

 Score = 171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 133/223 (60%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q +P TIS+++ +K+KP+++V  GCHPYP V E G    G++ K      
Sbjct  112  IDHDQVKPFAQPEPITISEKAGVKFKPQIHVTNGCHPYPAVNEAGETGGGLKTKGAPSAG  171

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS WYQ  WA++Y+WY P    ST     GHRH W  V++W D+PD +
Sbjct  172  CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNPDVE  228

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S      K+  P      +   ++KV+  +S+    H LE T + G+FQDL
Sbjct  229  NPKILAVTPSAHSGYSKQVPPNADS--VDGTSVKVE-YKSKWPINHALESTSQGGDFQDL  285

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+QLS+ AR AL++    +  AN P+ D  F   L K++PF
Sbjct  286  IMWDQLSENARRALNSVPWGD--ANTPMNDGNFQNKLGKAWPF  326

>PHYRA_52423
Length=193

 Score = 166 bits (421),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 125/196 (64%), Gaps = 6/196 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF + +PTT S+++A+K+KP+L V  GC+PYP VQ +GS+S G++        
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C GS  GSQ+YSRSDWY+ KWA++YTWYLP    +        RHFW   V+W D P   
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRPTKY----QRRHFWETAVVWIDDPALA  116

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +STIL  S++ +G   K+  P+  ++L    ++K+ S       K  L+ T+  GEFQDL
Sbjct  117  NSTILGVSLN-YGWRSKEETPVAPRFL-DGSSVKLNSYRGYGFPKPRLQFTQIDGEFQDL  174

Query  225  ITWEQLSDEARAALSN  240
            ITWEQL++EAR ALS 
Sbjct  175  ITWEQLTEEARDALST  190

>PITG_09716
Length=250

 Score = 167 bits (424),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 130/226 (58%), Gaps = 8/226 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D +QPF Q  PTT +Q++ +KYKP+L V+EGCHPYP VQ NG +S G++W       C+G
Sbjct  27   DTLQPFPQPIPTTDAQKAILKYKPQLKVEEGCHPYPAVQRNGDISSGLRWSGPEDIGCKG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWF-VDGHRHFWLWVVIWTDSPDPDDS  166
            S  GSQIY+RS  ++ KWA++YTWY P            GHRH W + V+W D  D + S
Sbjct  87   SSLGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPGLRSSGHRHGWEYAVVWLDRLDANSS  146

Query  167  TILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLIT  226
            TIL  S+S      K+ +P   +YL    +LKV    +       ++ T+  G FQDLI 
Sbjct  147  TILGTSLSAAVGWAKE-SPTPKEYL-DGHSLKVAYYFNDDFSNTAVKYTQDGGAFQDLIQ  204

Query  227  WEQLSDEARAALSNFHRLE-----KRANPPIQDKLFYEVLEKSYPF  267
            W+QLSD ARA+L N    E      R   P++D +F E L  +YPF
Sbjct  205  WDQLSDPARASLINTDWDETLFNVARVKMPMKDGVFEEKLSGAYPF  250

>PHYSO_334487
Length=258

 Score = 167 bits (424),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 129/230 (56%), Gaps = 11/230 (5%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            +S  ++  D+V PF Q +PTTIS ++A+K+KP+L+++ GCHPYPVV   G    G++   
Sbjct  17   VSGGIIGHDQVVPFPQSQPTTISNKAALKFKPQLWINNGCHPYPVVNAAGDTGGGLKTHG  76

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPM--ALDSTAWFVDGHRHFWLWVVIW  157
                 C  S  GSQ+Y RS WY G WA++Y WY P     D T     GHRH W  V++W
Sbjct  77   SSAAGCRCSGYGSQVYGRSTWYNGVWAIMYCWYFPKDEPQDGT-----GHRHDWEHVIVW  131

Query  158  TDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKR  217
             D+PD ++  I+A + S        YA L    ++   + KV+ T S +   H LE T  
Sbjct  132  IDNPDVENPKIMAMTPSAH-SGYSTYA-LPPADMVDGTSCKVEYTSSWLFIDHHLEGTST  189

Query  218  VGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             GEFQDLI W  L+D AR AL+       +AN P+ D  F   ++K+YP+
Sbjct  190  AGEFQDLIMWSDLTDGARLALNTTSF--GKANTPMNDGNFLPKIQKAYPW  237

>PHYRA_71404
Length=245

 Score = 167 bits (423),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 129/223 (58%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q  P TIS+++ +K+KP+L++  GCH YP V + G  S G++        
Sbjct  31   IDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSAG  90

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS WYQ  WA++Y+WY P    ST     GHRH W  V++W D+PD +
Sbjct  91   CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPSTG---IGHRHDWEHVIVWIDNPDVE  147

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S       KYAP  +  +  D T    + ES     H L+ +   G+FQDL
Sbjct  148  NPKILAVTPSAH-SGYHKYAPPNADSI--DGTTTKVAYESHWPMDHALDSSSEAGDFQDL  204

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+QLS+ AR AL++ +     AN P+ D  F   L +++PF
Sbjct  205  IMWDQLSENARRALNSVNF--GNANVPMNDGNFQAKLGRAWPF  245

>PHYRA_72433
Length=245

 Score = 167 bits (422),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 129/223 (58%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q  P TIS+++ +K+KP+L++  GCH YP V + G  S G++        
Sbjct  31   IDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSAG  90

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS WYQ  WA++Y+WY P    ST     GHRH W  V++W D+PD +
Sbjct  91   CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPSTG---IGHRHDWEHVIVWIDNPDVE  147

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S       KYAP  +  +  D T    + ES     H L+ +   G+FQDL
Sbjct  148  NPKILAVTPSAH-SGYHKYAPPNADSI--DGTTTKVAYESHWPMDHALDSSSEAGDFQDL  204

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+QLS+ AR AL++ +     AN P+ D  F   L +++PF
Sbjct  205  IMWDQLSENARRALNSVNF--GNANVPMNDGNFQAKLGRAWPF  245

>PHYCA_108039
Length=215

 Score = 165 bits (418),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 130/223 (58%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            MD D+VQPF Q  P T+S+++A+K+KP++++  GCHPYP V   G  S G++ K      
Sbjct  1    MDHDQVQPFKQPDPVTVSEKAAVKFKPQIHITNGCHPYPAVTWWGETSGGLKTKGAPSAG  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS W +G WA++Y+WY P    ST     GHRH W  V++W D+PD +
Sbjct  61   CKGSGWGSQVYGRSTWVKGVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNPDIE  117

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S      K+  P  S   +   ++KVK  ES+    H LE T   GE QDL
Sbjct  118  NPKILAVTPSAHSGYSKQVPP--SADCVDGTSVKVK-YESKWPINHALESTTEGGETQDL  174

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W QLS+ A  A+++    +  AN P  D  F   L+K++PF
Sbjct  175  IMWNQLSENALRAMNSVTWGD--ANCPFCDGNFQAKLDKAWPF  215

>PPTG_00460
Length=259

 Score = 166 bits (421),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 120/219 (55%), Gaps = 1/219 (0%)

Query  46   DVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSC  105
            D D+VQPF Q +P T ++++A+K+KP L V  GCHPYP V   G  S G++        C
Sbjct  21   DHDKVQPFAQPEPITDAEKAAVKFKPSLAVKAGCHPYPAVNAAGDTSAGLKGTGAPDGEC  80

Query  106  EGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDD  165
            EGSP GSQ+YSRS WY+ KWA++Y WY P  + +      G RH W+ +V+W D+P   +
Sbjct  81   EGSPLGSQVYSRSKWYEDKWAIMYAWYFPKDMQNIGLIKKGVRHDWVNLVVWLDNPALAE  140

Query  166  STILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLI  225
             TILA S S +G   +   P K   +I+  T KV+  E      H +      GE+QDLI
Sbjct  141  PTILATSASTYGTGYEISKPPKRSDIINGTTPKVRYDEDNREGWHTIFQFHEEGEYQDLI  200

Query  226  TWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKS  264
             W QL++  R AL N       AN P  D  F   L+ +
Sbjct  201  QWNQLTNATRKALENTD-FGDFANVPFNDAYFETNLKAA  238

>PHYKE_7564
Length=473

 Score = 172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 130/223 (58%), Gaps = 7/223 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q   T+++  +A+KYKP+++++ GCHPYP V  NG  S G++        
Sbjct  257  IDHDQVQPFPQSAATSLTNTAALKYKPQIFINNGCHPYPAVNANGDTSGGLKTHGSGSAG  316

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C GS  GSQ+Y RS WY G WA++Y+WY P   DS    + GHRH W  V++W D+P+  
Sbjct  317  CRGSGYGSQVYGRSTWYNGVWAIMYSWYFPK--DSPVSGM-GHRHDWEHVIVWIDNPENV  373

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            + TILA + S        YAP  +  ++   ++KV+ T + +   H LE T   GE QDL
Sbjct  374  NGTILAMTPSAH-SGYSTYAPPPAD-MVDGASVKVEYTSTYLVINHHLEGTSTAGEMQDL  431

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W  ++D AR AL+        AN P++D  F   LEK+YP+
Sbjct  432  IMWGDMTDAARYALNTTDF--GNANVPMKDGNFLPKLEKAYPW  472

 Score = 154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 114/198 (58%), Gaps = 5/198 (3%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            +++ D+VQPF Q    +++  +A+K+KP+++++ GCHPYP V  NG  S G++       
Sbjct  21   IINHDQVQPFPQSTAISLTNTAALKFKPQIWINNGCHPYPAVNANGDTSGGLKTHGSSSA  80

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C GS  GSQ+Y RS WY G WA++Y+WY P   D    F  GHRH W  VV+W D+P  
Sbjct  81   GCRGSGYGSQVYGRSTWYNGVWAIMYSWYFPK--DEPQDFT-GHRHDWEHVVVWIDNPQN  137

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
             +  ILA + S        YAP  +  +I   ++KV+ T S +   H LE T   GE QD
Sbjct  138  VNPRILAMTPSAH-SGYSTYAPPDAD-MIDGTSVKVEYTSSWLFIDHHLEGTSTAGEMQD  195

Query  224  LITWEQLSDEARAALSNF  241
            LI W  ++D AR +L+ F
Sbjct  196  LIMWSDMTDAARNSLNTF  213

>PHYRA_71931
Length=239

 Score = 166 bits (419),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 127/223 (57%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            MD D+VQPF Q +P TIS+++ +K+KP++++  GCHPYP V  NG    G++       S
Sbjct  23   MDHDQVQPFAQPEPATISEKAGVKFKPQIHITNGCHPYPAVNWNGDTGGGLKPTGAPSSS  82

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS WY G WA++Y+WY P    ST     GHRH W  VV+W  +PD +
Sbjct  83   CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTGL---GHRHDWEHVVVWITNPDVE  139

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA S S         +P  S   I    +KV   ES     H L++T   G+ QDL
Sbjct  140  NPVILAVSPSAHSGYSYYVSP--SADTIDGTAVKVN-YESHWPINHALDITTEGGDTQDL  196

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+Q++D AR +L+     +  AN P+ D  F   L K++P+
Sbjct  197  IMWDQMTDAARNSLNTVSFGD--ANVPMNDGNFQNKLGKAWPW  237

>PYU1_G011231
Length=238

 Score = 166 bits (419),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 131/228 (57%), Gaps = 8/228 (4%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQW  97
            V +    +  D+V PF +  P++IS+++AIK+KP++++  GCHPYP V   G+ S G++ 
Sbjct  17   VAVQAGSISHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKP  76

Query  98   KNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIW  157
                   C+GS  G+Q+Y RS WY GKWA++Y+WY P     T     GHRH W  VV+W
Sbjct  77   SGSQSAGCKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFTGL---GHRHDWEHVVVW  133

Query  158  TDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKR  217
             D+P   + TILA S S      +KYAP K+   +   + KV  T S+I   H L+ T  
Sbjct  134  IDNPANANPTILAVSPSAH-SGYEKYAPPKAG-TVDGTSAKVDYT-SKIVINHALDSTTA  190

Query  218  VGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
             GE Q LI WEQ++  AR AL N    +  AN P++D  F + L K+Y
Sbjct  191  AGEKQPLIMWEQMTQAARTALENTGFGD--ANVPMKDGNFMDKLAKAY  236

>PITG_23211
Length=245

 Score = 166 bits (419),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 117/218 (54%), Gaps = 1/218 (0%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            I    +D D VQPF Q +PTT ++++A+K+KP L V  GCHPYPVV   G    G++   
Sbjct  1    IRAASIDHDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTG  60

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTD  159
                 C GSP GSQ+YSRS  Y+ KWA++Y WY P  + +      G RH W+ +V+W D
Sbjct  61   RSDGECTGSPLGSQVYSRSTLYENKWAIMYAWYFPKNMQNIGLIKKGVRHDWVNLVVWLD  120

Query  160  SPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVG  219
            +P     TILA S S +G +     P K   +I+  T KV+  E      H +      G
Sbjct  121  NPTLAKPTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFHEEG  180

Query  220  EFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLF  257
            E+QDLI W QL+D AR AL N       AN P  D  F
Sbjct  181  EYQDLIQWTQLTDAAREALENTD-FGDFANVPFNDAYF  217

>PPTG_19330
Length=316

 Score = 167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 127/223 (57%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q +P TIS+++A+K+KP+L++  GCH YP V E G  S G++ K      
Sbjct  102  IDHDQVKPFPQPQPVTISEKAAVKFKPQLHITNGCHSYPAVDEAGQTSGGLKTKGAPSAG  161

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS WYQG WA++Y WY P    ST     GHRH W  V++W D+P+  
Sbjct  162  CKGSGWGSQVYGRSSWYQGVWAIMYCWYFPKDEPSTG---IGHRHDWEHVIVWIDNPEIA  218

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S       KYAP      I   T KV + ES     H L  T   G+FQDL
Sbjct  219  NPKILAVTPSAHSG-YHKYAPPNPD-TIDGATTKV-AYESHWPMDHALGSTSEAGDFQDL  275

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W QLS+ A  AL+  +     AN P+ D  F   L K++PF
Sbjct  276  IMWGQLSENASRALNAVYW--GNANTPMNDGNFLPKLAKAWPF  316

>PPTG_07089
Length=255

 Score = 166 bits (419),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 133/226 (59%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            P  +   EV+PF + KP TIS+++ +K+KP++ V  GC PYP V E+G  S G+Q     
Sbjct  36   PKTISHKEVKPFAEPKPVTISEKAGVKFKPQIAVKTGCVPYPAVNEDGETSGGLQTSGSP  95

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
            +  C GS  GSQ+Y RS W+ G WA++Y+WY P    S+     GHRH W  +V++ D+P
Sbjct  96   QGGCRGSGHGSQVYGRSTWFNGLWAIMYSWYFPKDAPSSRM---GHRHDWEHIVVFIDNP  152

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            +  +  IL  S S +     KYAP  +  +I   ++KVK  E      H L++TK  G+F
Sbjct  153  EVPEPKILGCSPS-WHSGYNKYAPCPAD-VIDGSSVKVK-YEHSWPLNHALDITKEAGDF  209

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI W+Q+SD AR AL++      +AN P+ D  F   +EKS+PF
Sbjct  210  QDLIMWDQMSDLARRALNDTKF--GKANTPMNDWNFLGKVEKSWPF  253

>PYU1_G011237
Length=235

 Score = 164 bits (416),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 126/222 (57%), Gaps = 8/222 (4%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D+V PF +  P++IS+++AIK+KP++++  GCHPYP V   G+ S G++       
Sbjct  20   VIDHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSA  79

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C+GS  G+Q+Y RS WY GKWA++Y+WY P     T     GHRH W  VV+W D+P  
Sbjct  80   GCKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFTGL---GHRHDWEHVVVWIDNPAN  136

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
             + TILA S S      +KYAP K+  +  D T       S I   H L+ T   GE Q 
Sbjct  137  ANPTILAVSPSAH-SGYEKYAPPKAGTV--DGTSAKVDYSSTIVINHALDSTTTAGEKQP  193

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            LI WEQ++  AR AL N    +  AN P++D  F   L  +Y
Sbjct  194  LIMWEQMTQAARTALENTDFGD--ANVPMKDGNFMTKLANAY  233

>PHYSO_468315
Length=255

 Score = 165 bits (417),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 130/223 (58%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q +  TIS+++A+K+KP+L++  GCH YP V E G  S G++ K      
Sbjct  39   IDHDQVKPFAQPESVTISEKAAVKFKPQLHITNGCHAYPAVDEAGQTSGGLKTKGAPSAG  98

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS WYQ  WA++Y WY P    S+     GHRH W  VV+W D+PD +
Sbjct  99   CKGSGWGSQVYGRSGWYQDVWAIMYCWYFPKDEPSSG---IGHRHDWEHVVVWIDNPDVE  155

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S       KYAP  +   +   T KV + ES     H L+ T   G+FQDL
Sbjct  156  NPKILAGTPSAHSG-YHKYAPPNAG-TVDGVTTKV-AFESHWPMDHALDSTTEGGDFQDL  212

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+QL+D AR AL++       A+ P+ D  F   L +++PF
Sbjct  213  IMWDQLTDNARRALNSVSF--GSADTPMNDGNFQAELGRAWPF  253

>PHYRA_71477
Length=238

 Score = 164 bits (415),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/267 (38%), Positives = 136/267 (51%), Gaps = 29/267 (11%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA F+    + A + V+A  I                       DEV PF Q +P T
Sbjct  1    MNLRAFFYVVFALTAVAQVQADKIGH---------------------DEVVPFPQPEPVT  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
            IS+++A+++KP +++  GCHPYP V E G  S G+Q        C+GS  GSQ+Y RS W
Sbjct  40   ISEKAAVRFKPEIHITNGCHPYPAVSEAGMTSGGLQATGGPSSKCKGSGWGSQMYGRSTW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y G WA++YTWY P    ST     GHRH W  VV+W D+PD  +  +LA S S      
Sbjct  100  YSGVWAIMYTWYFPKDSPSTRL---GHRHDWEHVVVWIDNPDVSNPILLAVSPSAH-SGY  155

Query  181  KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN  240
             KY P  +  +  D T    + ES     H L+ T + GEFQDLI W Q+SD AR AL+ 
Sbjct  156  SKYVPPSADSV--DGTSVKINYESHWPVNHALDTTSKSGEFQDLIMWHQMSDAARLALNT  213

Query  241  FHRLEKRANPPIQDKLFYEVLEKSYPF  267
                  +A  P+ D  F   L  ++P+
Sbjct  214  TDF--GKAIMPMNDGSFLGKLAGAWPW  238

>PITG_18453
Length=252

 Score = 164 bits (416),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 146/250 (58%), Gaps = 21/250 (8%)

Query  37   AVLISPT----------LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQ  86
            AVLI+ T          ++  ++V+PF + +P T SQ++A+KYKP+L +++GCHPYP VQ
Sbjct  5    AVLIAATASLAAGVLGQVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQ  64

Query  87   ENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDST----AW  142
            ++GS+S G++W       C GS  GSQIY+RS W    WA++Y WY P    +       
Sbjct  65   KDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLIL  124

Query  143  FVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKST  202
             + GHRH W + ++W D+P+ ++STIL  S+S       +  P  +   +  +++K++  
Sbjct  125  RLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASETPPEANH--VDGESVKLEYY  182

Query  203  ESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRAN-----PPIQDKLF  257
             + +     L+LT+  GEFQDL+TW+QL+  AR +L+N    E   N      P++D  F
Sbjct  183  YNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEF  242

Query  258  YEVLEKSYPF  267
             E+L K++PF
Sbjct  243  DELLNKAWPF  252

>PHYKE_5753
Length=238

 Score = 164 bits (415),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 123/227 (54%), Gaps = 7/227 (3%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            I   ++  D+V PF Q   T+I+   A+K+KP+++++ GCHPYP V  NG  S G++   
Sbjct  17   IQADVISHDQVIPFAQSAATSITNTVALKFKPQIFINNGCHPYPAVNGNGDTSGGLKPSG  76

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTD  159
                 C+GS  GSQ+Y RS WY   WA++Y+WY P     T     GHRH W  VV+W D
Sbjct  77   SESAGCKGSGYGSQVYGRSTWYNNVWAIMYSWYFPKDNPVTGM---GHRHDWEHVVVWID  133

Query  160  SPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVG  219
            +P  ++ TILA + S        YAP      +   + KV+ T S I   H L+ T   G
Sbjct  134  NPAMENPTILAVTPSAH-SGYSTYAPPDPS-TVDGASAKVQYTSSWIVINHHLDTTSTAG  191

Query  220  EFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYP  266
            EFQDLI W  L+D AR AL N    E  AN P++D  F   L  +YP
Sbjct  192  EFQDLIMWGDLTDAARNAL-NTADFEA-ANVPMKDGNFESKLGNAYP  236

>PPTG_12847
Length=331

 Score = 167 bits (422),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 131/220 (60%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV+PF Q +P TIS+++ +K+KP++ +  GC PYP V E G  S G+Q     R  C G
Sbjct  118  DEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGGCRG  177

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W +G WA++Y+WY P    S+     GHRH W   +++ D+P+  +  
Sbjct  178  SGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSSRM---GHRHDWEHAIVFIDNPEVAEPK  234

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S+S   D  KKY+P    ++I   +LKV+   +     H L+ T   G FQDLI W
Sbjct  235  ILACSVSSH-DGYKKYSPC-PPWVIDGTSLKVRYKHA-WPLNHDLDTTGDAGTFQDLIMW  291

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +Q+S++AR AL++ H    +AN P  D  F   LEK++PF
Sbjct  292  DQMSNDARRALNSVHF--GKANTPFNDGNFRPKLEKAWPF  329

>PITG_08522
Length=382

 Score = 168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 131/220 (60%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V+ F Q +P TIS+++ +K+KP++ +  GC PYPVV E G  S G+Q     R  C G
Sbjct  129  DDVKLFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPVVNELGETSGGLQTSGNSRGGCRG  188

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W +G WA++Y+WY P    S+     GHRH W   +++ D+P+  +  
Sbjct  189  SGHGSQVYGRSTWMEGVWAIMYSWYFPKDFPSSRM---GHRHDWEHAIVFIDNPEVAEPK  245

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S+S   D  KKY P  S Y+I   +LKV+   +     H L+ T   G FQDLI W
Sbjct  246  ILACSVSSH-DGYKKYNPCPS-YVIDGTSLKVRYKHA-WPLNHDLDTTGDAGTFQDLIMW  302

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +Q+S++AR AL++ H    +AN P  D  F   LEK++PF
Sbjct  303  DQMSNDARRALNSVHF--GKANTPFNDGNFRPKLEKAWPF  340

>PHYKE_2376
Length=322

 Score = 166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 128/223 (57%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q +P TIS+++ +K+KP++++  GCHPYP V E G  S G++ K      
Sbjct  108  IDHDQVKPFGQPEPVTISEKAGVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAG  167

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS W    WA++Y+WY P    ST     GHRH W  V+IW D+PD +
Sbjct  168  CKGSGWGSQVYGRSGWKNDVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIIWIDNPDVE  224

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S        Y P  +  L  D T    + ES     H L+ T   G+FQDL
Sbjct  225  NPRILAVTPSAHSG-YSTYRPPNADTL--DGTSAKVNYESHWPVNHALDSTSEGGDFQDL  281

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I W+Q++D AR AL+     +  AN P+ D  F   L+K++PF
Sbjct  282  IMWDQMTDNARRALNEVSWGD--ANVPMNDGNFGPKLDKAWPF  322

>PHYRA_72345
Length=240

 Score = 164 bits (414),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 125/222 (56%), Gaps = 11/222 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V PF Q +PT+I+  +A+ +KP+++++ GCHPYPVV  NG    G++        C G
Sbjct  25   DQVVPFPQSQPTSITNTAALLFKPQIWINNGCHPYPVVNANGDTGGGLKTTGSSAAGCRG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS WY G WA++Y+WY P   D    F  GHRH W  VV+W D+P   +  
Sbjct  85   SGYGSQVYGRSAWYNGVWAIMYSWYFPK--DEPQDFT-GHRHDWEHVVVWIDNPQNTNPK  141

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA + S        YAP  +  ++   + KV+ T S +   H LE T   GE QDLI W
Sbjct  142  ILAMTPSAH-SGYSTYAPPDAD-MVDGTSCKVEYTSSWLFIDHHLEGTSTAGETQDLIMW  199

Query  228  EQLSDEARAAL--SNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
              ++D AR AL  +NF     +AN P+ D  F   L K+YP+
Sbjct  200  GDMTDAARYALNTTNF----GKANTPMNDGNFLPKLGKAYPW  237

>PPTG_12853
Length=342

 Score = 166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 131/220 (60%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV+PF Q +P TIS+++ +K+KP++ +  GC PYP V E G  S G+Q     R  C G
Sbjct  129  DEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGGCRG  188

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W +G WA++Y+WY P    S+     GHRH W   +++ D+P+  +  
Sbjct  189  SGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSSRM---GHRHDWEHAIVFIDNPEVAEPK  245

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S+S   D  KKY+P    ++I   +LKV+   +     H L+ T   G FQDLI W
Sbjct  246  ILACSVSSH-DGYKKYSPC-PPWVIDGTSLKVRYKHA-WPLNHDLDTTGDAGTFQDLIMW  302

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +Q+S++AR AL++ H    +AN P  D  F   LEK++PF
Sbjct  303  DQMSNDARRALNSVHF--GKANTPFNDGNFRPKLEKAWPF  340

>PHYSO_254223
Length=227

 Score = 163 bits (412),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 125/226 (55%), Gaps = 32/226 (14%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQ F Q +P T  ++ A+KYKP+L++  GCHPYP VQ                  
Sbjct  24   IDHDQVQSFPQPEPVTDFEKFAVKYKPQLHISNGCHPYPAVQ------------------  65

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
                   + +YSRSDWY+GKW ++Y WY P        F  GHRHFW  VV+W D+P+PD
Sbjct  66   -------ADVYSRSDWYRGKWTIMYAWYFPKGRACKDDFKTGHRHFWEDVVVWVDNPNPD  118

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +ST+L   M   G    K  P+  KYL   KT+K  S +S   +  G  LT+  GE QDL
Sbjct  119  NSTLLGVPMYA-GHRHIKVVPVDEKYLKDGKTVKFGSYKSLGAQVVG--LTEDYGEIQDL  175

Query  225  ITWEQLSDEARAALS--NFH--RLEKRANPPIQDKLFYEVLEKSYP  266
            ITWEQL+ EAR ALS  NFH     +    PI+D  F + LE +YP
Sbjct  176  ITWEQLTVEARTALSEANFHVDGGVREVVVPIKDGQFEKTLESAYP  221

>PITG_22981
Length=259

 Score = 164 bits (415),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 117/219 (53%), Gaps = 1/219 (0%)

Query  46   DVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSC  105
            D D VQPF Q +PTT ++++A+K+KP L V  GCHPYPVV   G    G++        C
Sbjct  21   DHDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGEC  80

Query  106  EGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDD  165
             GSP GSQ+YSRS  Y+ KWA++Y WY P  +        G RH W+ +V+W D+P    
Sbjct  81   TGSPLGSQVYSRSTLYENKWAIMYAWYFPKDMQDIGLIKKGVRHDWVNLVVWLDNPTLAK  140

Query  166  STILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLI  225
             TILA S S +G +     P K   +I+  T KV+  E      H +      GE+QDLI
Sbjct  141  PTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFLEEGEYQDLI  200

Query  226  TWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKS  264
             W QL+D AR AL N       AN P  D  F   L+ +
Sbjct  201  QWTQLTDAAREALENTD-FGDFANVPFNDAYFETNLKAA  238

>PHYSO_406265
Length=232

 Score = 162 bits (411),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 127/226 (56%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            P  +  DEV PF Q +P TIS+ +A+K+KP+L++  GCH YP V E G  S G++     
Sbjct  15   PKTIGHDEVVPFKQPEPVTISERAAVKFKPQLHISNGCHAYPAVNELGETSGGLKKTGAP  74

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C+GS  GSQ+Y RS WY G WA++Y+WY P    S+     GHRH W  V++W D+P
Sbjct  75   SSKCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSSGL---GHRHDWEHVIVWIDNP  131

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            D  +  ILA + S       +  P   K  +   ++KV + ES+    H LE T + G++
Sbjct  132  DMPEPKILAVTPSAHSGYSAQVPPDADK--VDGPSVKV-NYESKWPINHALESTTKGGDY  188

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI W Q++D AR AL N +     AN P+    F   L K++PF
Sbjct  189  QDLIMWTQMTDAARQALDNTNF--GSANVPMNSGNFLGKLGKAWPF  232

>PITG_00957
Length=298

 Score = 164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            I    +D D+VQPF Q +P T  +++A+K+KP L V  GCHPYP V   G  S G++   
Sbjct  53   IRAASIDHDKVQPFAQPQPITDVEKAAVKFKPSLAVMSGCHPYPAVNAAGETSAGLKGTG  112

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTD  159
                 CEGS  GSQ+YSRS WY+G+WA++Y WY P  + +      G RH W+ VV+W +
Sbjct  113  EPDGGCEGSELGSQVYSRSTWYEGRWAIMYAWYFPKDIQNGGLAKKGIRHDWVNVVVWLN  172

Query  160  SPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVG  219
            +P     TILA S S +G       P KS  +I   T K++  E    + H +      G
Sbjct  173  NPAVAAPTILATSASTYGTRYVISKPPKSSDIIDGITAKLRYDEEGGEEWHTIFQFYGEG  232

Query  220  EFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKS  264
            EFQDLI W+QL+D AR AL N        N P  D  F   L+ +
Sbjct  233  EFQDLIQWDQLTDAAREALQNTD-FGDYVNVPFNDAYFETNLKAA  276

>PHYSO_510888
Length=255

 Score = 162 bits (410),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 130/226 (58%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            P  +  DEV+PF Q  P TIS+++A+K+KP++ +  GC PYP V + G  S G+Q     
Sbjct  37   PKTIGHDEVKPFPQPDPVTISEKAAVKFKPQIDIVTGCVPYPAVNDAGETSGGLQTSGSP  96

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
            R  C GS  GSQ+Y RS W  G WA++Y+WY P    S+     GHRH W  VV++ D+P
Sbjct  97   RGGCRGSGHGSQVYGRSTWINGVWAIMYSWYFPKDAPSSKM---GHRHDWEHVVVFIDNP  153

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            D  +  IL  S S + +   KYAP  +  +I   ++KVK  E      H LE T + G F
Sbjct  154  DVPEPKILGCSPS-WHNGYNKYAPCPAN-VIDGTSVKVK-YEHSWPLNHALETTTKPGAF  210

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI W Q++D AR AL++      +AN P+ D  F   +EK++PF
Sbjct  211  QDLIMWNQMTDFARRALNDTKF--GKANTPMNDWNFLPKVEKAWPF  254

>PHYRA_71618
Length=243

 Score = 162 bits (409),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 125/224 (56%), Gaps = 5/224 (2%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q  P T+S+++A+++KP L +D GCHPYP V   G  S G++        
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y+R+ WY   WA++Y WY P    +   F  G RH W  VV+W D+P  +
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDKPT---FRKGERHDWANVVVWLDNPALE  140

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT-KRVGEFQD  223
              T++  S S +     KY P  +  L    ++     ++     H ++ T K  GEFQD
Sbjct  141  RPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNHGFHSVDTTWKTGGEFQD  200

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            LI WEQL+DEARAAL N     + A  P  D  F   LEK++P+
Sbjct  201  LIMWEQLTDEARAAL-NDTDFGEHALVPFIDANFKANLEKAWPY  243

>PHYRA_42876
Length=213

 Score = 161 bits (407),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 127/221 (57%), Gaps = 8/221 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P TIS++S +K+KP+++V  GCHPYP V   G    G++ K      
Sbjct  1    IDHDQVQPFAQPEPITISEKSGVKFKPQIHVTNGCHPYPAVNYKGETGGGLKTKGAPSAG  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y R+ W++  WA++Y+WY P    ST     GHRH W  V++W D+PD +
Sbjct  61   CKGSGWGSQVYGRAAWHRDVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNPDVE  117

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S      K+  P        D T      +S+    H LE T + G+FQDL
Sbjct  118  NPKILAVTPSAHSGYSKQVPPNADSV---DGTSAKVEYKSKWPINHALESTSQGGDFQDL  174

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            I W+QLS+ AR AL++    +  AN P+ D  F   L+K++
Sbjct  175  IMWDQLSENARRALNSVPWGD--ANTPMNDGNFLPKLDKAW  213

>PHYRA_72475
Length=243

 Score = 161 bits (407),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 124/224 (55%), Gaps = 5/224 (2%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P T+S+++A+++KP L +D GCHPYP V   G  S G++        
Sbjct  24   IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDTGCHPYPAVNAAGETSGGLKGTGMPSGD  83

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y+R+ WY   WA++Y WY P    +   F  G RH W  VV+W D+P  +
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDQPT---FSKGKRHDWANVVVWLDNPALE  140

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT-KRVGEFQD  223
              TI+  S S +     KY P  +  L    ++     ++     H ++ T K  GEFQD
Sbjct  141  RPTIIGVSPSSYVTTYSKYTPPPADGLSGTTSMINYLADANNHGFHSVDTTWKTGGEFQD  200

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            LI WEQL+DEAR A  N     + A  P  D  F   LEK++P+
Sbjct  201  LIMWEQLTDEARGAF-NDTDFGEHAPVPFIDPNFKANLEKAWPY  243

>PHYCA_108409
Length=282

 Score = 162 bits (409),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 127/226 (56%), Gaps = 20/226 (9%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV+PF + KP T+S+++ +K+KP++ +  GC PYP V E G  S G++     +  C G
Sbjct  71   DEVKPFPEPKPVTVSEKAGVKFKPQIQIRTGCVPYPAVDETGQTSGGLKPTGNSKGGCRG  130

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y R  W QG W ++Y+WY P    ST     GHRH W   +++ D+PD  +  
Sbjct  131  SGHGSQVYGRGTWIQGVWGIMYSWYFPKDSPSTGM---GHRHDWEHAIVFIDNPDVPEPK  187

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHG------LELTKRVGEF  221
            ILA S+S      KKY P    ++I   +LKV       R KHG      L+ T   G F
Sbjct  188  ILACSVSSHAG-YKKYNPC-PPWVIDGTSLKV-------RYKHGWPLNHDLDTTGDAGTF  238

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI W+Q++++AR AL++ H     AN P  D  F   LEK++PF
Sbjct  239  QDLIMWDQMTEDARRALNSVHF--GSANTPFNDGNFKPKLEKAWPF  282

>PHYSO_397673
Length=224

 Score = 160 bits (404),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 125/220 (57%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q +P TIS+++ +K+KP++ +  GCHPYP V E G  S G++         + 
Sbjct  13   DKVQPFAQPEPVTISEKAGVKFKPQIRIINGCHPYPAVNEAGETSGGLKTTGGHNSKSKR  72

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S   SQ+Y RS W++G WA++Y+WY P    S      GHRH W  V++W D+PD  +  
Sbjct  73   SGWNSQVYGRSTWFRGVWAIMYSWYFPKDSPSHGL---GHRHDWEHVIVWIDNPDASEPK  129

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA + S  GD  +KYAP  +  +  D T      ES     H L +T   GEFQDLI W
Sbjct  130  ILAVTPSAHGD-YQKYAPPNANTV--DGTSAKVVYESHWPMNHELSVTSDSGEFQDLIMW  186

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             Q+S+ AR A ++      +AN P+ D  F + L K++PF
Sbjct  187  SQMSENARRAFNSVSF--GKANTPMNDWGFEDRLGKAWPF  224

>PITG_22668
Length=519

 Score = 167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 128/224 (57%), Gaps = 8/224 (4%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D V PF Q +P TIS+++A+K+KP+L++  GCHPYP V   G  S G++       
Sbjct  303  IIDHDAVVPFKQTEPVTISEKAAVKFKPQLHITGGCHPYPAVNAIGQTSGGLKTSGAPSA  362

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C+GS  GSQ+Y RS WY G WA++Y+WY P    ST     GHRH W  V++W D+P+ 
Sbjct  363  GCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNPEL  419

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
             +  ILA S S  G    +  P  +K  +   ++KVK   S+    H LE T   G++QD
Sbjct  420  AEPKILAVSPSAHGGYSAQVPPDANK--VEGTSVKVKYL-SKWPINHALESTGEGGDYQD  476

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            LI W Q++D AR  LS       +AN P+ D  F   L +++PF
Sbjct  477  LIMWGQMTDAAREGLSRTGF--GKANVPMNDGNFESKLGRAWPF  518

>PHYCA_123779
Length=277

 Score = 161 bits (407),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 124/224 (55%), Gaps = 8/224 (4%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D V PF Q +P TIS ++AIK+KP+L++  GCHPYP V   G  S G++       
Sbjct  58   IIDHDAVVPFKQPEPVTISDKAAIKFKPQLHITNGCHPYPAVNAIGQTSGGLKTSGAPSA  117

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C+GS  GSQ+Y RS W+ G WA++Y+WY P    ST     GHRH W  V++W D+P+ 
Sbjct  118  GCKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNPEV  174

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
             +  IL  + S       +  P   K  +   ++KVK   S+    H LE T   G+FQD
Sbjct  175  PEPKILGVTPSAHSGYSSQVPPDADK--VDGSSVKVKYL-SKWPINHALESTGEGGDFQD  231

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            LI W Q++D AR  LS       +AN P+ D  F   L K++PF
Sbjct  232  LIMWTQMTDAAREGLSKTGW--GKANVPMVDGNFEAKLGKAWPF  273

>PPTG_08017
Length=616

 Score = 168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 128/220 (58%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV PF Q +P TI++++AIK+KP+L++  GCH YP V   G  S G++        C+G
Sbjct  403  DEVVPFKQPEPVTIAEKAAIKFKPQLHITNGCHAYPAVNVGGQTSGGLKTTGAPSAGCKG  462

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W+ G WA++Y+WY P    ST     GHRH W  V++W D+P+  +  
Sbjct  463  SGWGSQVYGRSTWHNGVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNPEIAEPK  519

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA + S       +  P  +K  +   ++KVK   S+    H LE T   G++QDLI W
Sbjct  520  ILAVTPSAHSGYSAQVPPDANK--VDGNSVKVKYL-SKWPINHALESTGEAGDYQDLIMW  576

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            EQL+D AR AL N      +AN P++D  F   L+K++PF
Sbjct  577  EQLTDAARLALQNTGF--GKANVPMKDGNFVSKLDKAWPF  614

>PHYRA_71825
Length=254

 Score = 160 bits (404),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/231 (40%), Positives = 131/231 (57%), Gaps = 15/231 (6%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V+PF Q +P T ++++A+KYKPRL V++GCHPY  VQ +G++S G++W       C G
Sbjct  28   DTVEPFAQPRPKTDAEKAAVKYKPRLLVEDGCHPYAAVQADGAISGGLEWSGPQDGECRG  87

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALD------STAWFVDGHRHFWLWVVIWTDSP  161
            SP GSQ+Y+R    +  WA++Y WY P          S  +F  GHR+ W + V+W D+ 
Sbjct  88   SPLGSQVYARWMKVKDVWAIMYAWYFPKGRAPLPVPLSLRFF--GHRNGWEYAVVWLDNL  145

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            +  +ST+LA S+S       K AP K KY     +L V    + I     ++ T+  GEF
Sbjct  146  NAKNSTVLATSLSA-AVGWSKEAPPKEKYF-DGTSLMVSYYYNHIFGNTAVKYTEDAGEF  203

Query  222  QDLITWEQLSDEARAALSNFH-----RLEKRANPPIQDKLFYEVLEKSYPF  267
            Q LITW+QL D AR AL+N           R   P++D +F E LE +YPF
Sbjct  204  QPLITWDQLPDLARKALNNTDWDATPSNVARVKMPMKDGVFLEKLEGAYPF  254

>PHYKE_4946
Length=263

 Score = 159 bits (403),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 132/226 (58%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            P  +   +V+PF Q +P TIS+++A+K+KP+L +  GC  YP V + G  S G+Q     
Sbjct  46   PKTIPHKDVKPFIQPEPITISEKAAVKFKPQLAILSGCVSYPAVNDIGETSGGLQESGSP  105

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
            +  C GS  GSQ+Y RS WY   WA++Y+WY P    S+     GHRH W  VV+W D+P
Sbjct  106  KGGCRGSGHGSQVYGRSVWYSDVWAIMYSWYFPKDSPSSRL---GHRHDWEHVVVWIDNP  162

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            +  +  ILA S S +    KKYAP  S  +I   ++KVK  E      H L++T + G+F
Sbjct  163  EVLEPKILAVSPS-YHSGHKKYAP-PSADVIDGTSVKVK-YEHSWPLNHALDVTDKAGDF  219

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI W+Q++D AR AL+       +AN P+ D  F   LE+++PF
Sbjct  220  QDLIMWDQMTDLARVALNETKF--GKANVPMNDHNFLRKLEQAWPF  263

>PHYRA_49009
Length=216

 Score = 158 bits (399),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 122/222 (55%), Gaps = 7/222 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P T+S+++A+++KP L +D GCHPYP V   G  + G++        
Sbjct  1    IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGMPSGD  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y+R+ W+   WA++Y WY P      A F  G RH W  VV+W D+P  +
Sbjct  61   CKGSGLGSQVYARAVWHSDLWAIMYAWYFP---KDKAIFGKGERHDWANVVVWLDNPAVE  117

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT-KRVGEFQD  223
              TI+  S S +     KY P  +  L     +            H ++ T K  GEFQD
Sbjct  118  RPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLANDMNNGFHTVDTTWKTGGEFQD  177

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            LI WEQL+DEARAALSN    +  A  P  D  F   LEK++
Sbjct  178  LIMWEQLTDEARAALSN---TDFGALVPFIDANFKANLEKAW  216

>PPTG_07277
Length=298

 Score = 160 bits (405),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 127/220 (58%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DE++PF Q  P TIS+++ +K+KP++ +  GC PYPVV E G  S G+Q     R  C G
Sbjct  87   DEIKPFPQPDPVTISEKAGVKFKPQIQIRTGCVPYPVVNEFGETSGGLQTSGSPRGGCRG  146

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W  G WA++Y+WY P    S+     GHRH W + V++ D+P   +  
Sbjct  147  SVHGSQVYGRSAWINGFWAIMYSWYFPKDSPSSRM---GHRHDWEFAVVFIDNPGIPEPK  203

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            I+  S+S   D  KKY P  S ++I   +LKV+   +     H L++T   G FQDLI W
Sbjct  204  IIGCSVSSH-DGRKKYNPCPS-WVIDGNSLKVRYKHA-WPMNHDLDVTGDAGTFQDLIMW  260

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +Q++D+AR AL++      +AN P  D  F   LE ++ F
Sbjct  261  DQMTDDARRALNSVSF--GKANTPFNDGKFLPTLESAWAF  298

>PHYRA_74617
Length=337

 Score = 161 bits (408),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 127/222 (57%), Gaps = 12/222 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV+PF Q +P TIS ++ +K+KP++ +  GC+PYP V E G +  G++     R +C G
Sbjct  126  DEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKTSGKSRGNCAG  185

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W+   WA++Y+WY P    S      GHRH W   V++ D+PD  +  
Sbjct  186  SGHGSQVYGRSTWHNQVWAIMYSWYFPKDSPSPGM---GHRHDWEHAVVFIDNPDVPEPK  242

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            IL  S+S   D  KKY P    ++I   +LKV+   S     H L+ T   G FQDLI W
Sbjct  243  ILGCSVSSH-DGYKKYNPC-PPWVIDGTSLKVRYKHS-WPINHDLDTTGDGGIFQDLIMW  299

Query  228  EQLSDEARAAL--SNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             Q++D AR AL  +NF      AN P+ D  FY  +EKS+PF
Sbjct  300  GQMTDNARRALNEANF----GSANTPMNDGNFYSKVEKSWPF  337

>PPTG_13736
Length=236

 Score = 158 bits (400),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 126/220 (57%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V+PF Q  P ++S+++A+K+KP+L++  GCHPYP V   G  S G+         C+G
Sbjct  25   DQVRPFGQPSPVSVSEKAAVKFKPQLHITNGCHPYPAVNAAGETSGGLAKSGAPSAGCKG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W++G+WA++Y+WY P    ST     GHRH W  V++W D+PD  +  
Sbjct  85   SGWGSQVYGRSTWHKGRWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNPDVANPK  141

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA + S       KYAP K+   +   T K+ + ES     H L+ T + GE Q LI W
Sbjct  142  ILAVTPSAH-SGYSKYAPPKAG-TVSGNTAKI-NYESHWPVNHALDSTDKGGETQPLIMW  198

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +Q++D AR +L+     +  AN P+ D  F   +  + P+
Sbjct  199  DQMTDAARRSLNTVSFGD--ANVPMNDGNFLRKIGNASPW  236

>PHYCA_11951
Length=234

 Score = 158 bits (400),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 120/218 (55%), Gaps = 8/218 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V PF Q  PT+ISQ +A+ +KP+L++  GCHPYP V  +G+ S G+         C+G
Sbjct  23   DQVVPFAQPTPTSISQTTAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPAGSSSAGCKG  82

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQIY RS WY G WA++Y+WY P    S+ +   GHRH W  +V+W D+P      
Sbjct  83   SGYGSQIYGRSAWYNGVWAIMYSWYFPKDSPSSGF---GHRHDWEHIVVWLDNPAVASPK  139

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S S        Y P  S YL + K+ K+    S +   H   +T   GE Q+LI W
Sbjct  140  ILAVSTSAHSGYTVYYPP-NSNYL-NGKSAKID-YYSILLINHAFRMTSDAGETQNLIMW  196

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +Q++D AR AL N    +  AN P +D  F   L  ++
Sbjct  197  DQMTDAARTALQNTDFGD--ANVPFKDGNFESKLANAW  232

>PHYSO_507736
Length=236

 Score = 157 bits (397),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 120/223 (54%), Gaps = 8/223 (4%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            +++D D+V PF Q  PT+ SQ +A+K+KP+L++  GCHPYP V  +G+ S G+       
Sbjct  20   SVIDHDQVVPFAQPTPTSTSQTAAVKFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSSS  79

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              C+GS  GSQIY RS WY G WA++Y+WY P    ++ +   GHRH W  +V+W ++P 
Sbjct  80   AGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPASGF---GHRHDWEHIVVWLNNPA  136

Query  163  PDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
                 +LA S S        Y P  S YL  D         + +   H   +T   GE Q
Sbjct  137  VTSPELLAVSTSAHSGYTTYYPP-SSSYL--DGNSAKIDYYNVLLINHAFRMTSDSGETQ  193

Query  223  DLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            DLI W+QL+D AR AL N    +  AN P +D  F   L  ++
Sbjct  194  DLIMWDQLTDAARTALENTDFGD--ANVPFKDANFETKLANAW  234

>PHYRA_72438
Length=236

 Score = 157 bits (396),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 124/242 (51%), Gaps = 8/242 (3%)

Query  24   INLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYP  83
            +NL   +     G   I   ++D D V PF Q  PT++SQ +A+ +KP+L++  GCHPYP
Sbjct  1    MNLRGLLVSAAVGLTAIYGAVIDHDTVVPFAQPTPTSVSQVAAVNFKPQLHITNGCHPYP  60

Query  84   VVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWF  143
             V  +G+ S G+         C+GS  GSQIY RS WY G WA++Y+WY P    ++ + 
Sbjct  61   AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPASGF-  119

Query  144  VDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTE  203
              GHRH W  +V+W ++P      ILA S S        Y P  S YL  D         
Sbjct  120  --GHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPP-DSDYL--DGNSAKIDYY  174

Query  204  SRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEK  263
            S +   H   +T   GE QDLI W+QL+D AR AL +    +  AN P +D  F   L  
Sbjct  175  SVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTDFGD--ANVPFKDTNFETKLAN  232

Query  264  SY  265
            ++
Sbjct  233  AW  234

>PHYCA_18373
Length=246

 Score = 157 bits (396),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 128/208 (62%), Gaps = 14/208 (7%)

Query  64   ESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQG  123
            ++A+K+KP+L++  GCHPYP VQ +G +S G++        C+GS  GSQIY+RSDWY+G
Sbjct  49   KAAVKFKPQLHISYGCHPYPAVQADGVVSAGLKPTGPDDGECQGSSLGSQIYARSDWYKG  108

Query  124  KWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKY  183
             +A++YTWYLP    S        RHFW  VV+W D P   +STIL  S++ +G ++KK 
Sbjct  109  VYAIMYTWYLPKGSAS--------RHFWESVVVWIDDPAASNSTILGVSLN-YGLQLKKE  159

Query  184  APLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSN--F  241
              +  KYL    +LK+ S          L LT+  GEFQDL+T++QL+D A  ALS+  F
Sbjct  160  TNIDPKYL-SGSSLKLDSFPGFAINNPKLRLTELDGEFQDLVTFDQLTDAAGIALSHAEF  218

Query  242  HR-LEKRANP-PIQDKLFYEVLEKSYPF  267
             + L K   P P+ D +F E L+ ++PF
Sbjct  219  SKGLIKAKTPMPLIDGVFNERLKDAWPF  246

>PHYRA_72165
Length=240

 Score = 156 bits (395),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 124/223 (56%), Gaps = 7/223 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P T+S+++A+++KP L +D GCHPYP V   G  + G++        
Sbjct  23   IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGPSSGD  82

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y+R+ WY   WA++Y WY P    +   F +G RH W  VV+W D+P  +
Sbjct  83   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDKPT---FGEGGRHDWANVVVWLDNPAVE  139

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT-KRVGEFQD  223
              TI+  S S +     KY P  +  L     +     +      H ++ T    GEFQD
Sbjct  140  RPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLADDMNNGFHTVDTTWLPGGEFQD  199

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYP  266
            LI WEQL+DEARAALS+    +  A  P  D  F   LEK++P
Sbjct  200  LIMWEQLTDEARAALSD---TDFGALVPFIDANFKANLEKAWP  239

>PHALS_14424
Length=139

 Score = 153 bits (386),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 98/138 (71%), Gaps = 1/138 (1%)

Query  128  LYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLK  187
            +Y WY PMALDS + FV GHRH+WLW ++WT  PDPD+ST L  SMSG     K+  P K
Sbjct  1    MYVWYFPMALDSVSTFVRGHRHYWLWAIVWTSGPDPDESTFLGVSMSGDHGITKQLRP-K  59

Query  188  SKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKR  247
            SKY+ ++ T+ +KS E     + GLELTK+ G  Q+L+TW+QL+ EAR +LS+  R E  
Sbjct  60   SKYVFNETTVLLKSHEGFFSTRQGLELTKKSGGTQNLVTWDQLTPEARTSLSSLFRTEVT  119

Query  248  ANPPIQDKLFYEVLEKSY  265
            ANPP+QD+ ++++L+K+Y
Sbjct  120  ANPPLQDRQYFDILKKAY  137

>PHALS_08945
Length=242

 Score = 156 bits (395),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 126/220 (57%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+++PF   K      E A+ ++P L ++ GCHPYP V +NG +S+G+   ++F   C G
Sbjct  31   DKIKPFPVAKRDCRINEIALDFQPMLRIESGCHPYPAVDKNGYVSDGLGVSHWFT-DCSG  89

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            SP GSQ+Y R+  ++G  A++Y WY P     T ++V GHRH W   ++W      D   
Sbjct  90   SPEGSQVYGRAYVFKGYLAIMYAWYFPRDFMVTPFYV-GHRHGWEHAILWIGGSTEDPVF  148

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            + A   S FG   KKY+P+ +KY+  D   K++ T   +   H L  TK +GEFQDL+ W
Sbjct  149  LAATVESTFG--YKKYSPVPTKYVKSDH-FKLEYTWLGV-THHYLTATKNMGEFQDLVMW  204

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
              L+DEAR +L+   ++    N P+ DK F+  L KSYPF
Sbjct  205  NNLTDEARVSLNE--KISLNFNSPLSDKRFFTALRKSYPF  242

>PHYCA_9358
Length=252

 Score = 156 bits (395),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 127/226 (56%), Gaps = 14/226 (6%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV PF Q +P TI++++AIK+KP+L++  GCH YP V   G  S G++        C+G
Sbjct  34   DEVVPFKQPEPVTIAEKAAIKFKPQLHISNGCHAYPAVNIGGQTSGGLKTTGAPSAGCKG  93

Query  108  SPRGSQIYSRSDW------YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
            S  GSQ+Y RS W      + G WA++Y+WY P    ST     GHRH W  V++W D+P
Sbjct  94   SGWGSQVYGRSTWHNVPSPHNGIWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNP  150

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            +  +  ILA + S       +  P   K  +   ++KV + ES+    H L  T + G++
Sbjct  151  EIAEPKILAVTPSAHSGYSAQVPPDADK--VEGTSVKV-NYESKWPINHALGSTTKGGDY  207

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI WEQL+D AR AL N      +AN P++D  F   L K++PF
Sbjct  208  QDLIMWEQLTDAARLALENTDF--GKANVPMKDGNFVGKLNKAWPF  251

>PHALS_03592
Length=259

 Score = 157 bits (396),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/224 (38%), Positives = 132/224 (59%), Gaps = 10/224 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +  DE++P    +  ++    A+ ++P L++  GCHPYP V E+G +S G+   + F   
Sbjct  45   LQYDEIKPIPGVESNSLINSIALHFQPMLFISSGCHPYPAVDEHGYISNGLGVSHLFT-D  103

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C GSP+GSQ+Y R+  ++G  A++Y+WY P     TA F  GHRH W   ++W   PD +
Sbjct  104  CMGSPQGSQVYGRAFAFRGHLAIMYSWYFPRDF-MTAPFYIGHRHGWEHAILWF-GPDTE  161

Query  165  DSTILAASM-SGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
            + T+LA ++ S FG   K YAP  SKY+ H    K+K T   +  +H L  T++ GEFQD
Sbjct  162  NPTLLAVTVESTFG--YKTYAPPPSKYM-HGDHFKLKYTWLGV-TQHYLTATEKSGEFQD  217

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            LI W+ + +  R +L+  H++    +PPI+D  F+  L KS+PF
Sbjct  218  LIMWDCMDEHVRHSLN--HKVSHNFDPPIRDDRFFHALRKSFPF  259

>PYVX_22467
Length=236

 Score = 155 bits (393),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 119/223 (53%), Gaps = 8/223 (4%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            +++D D+V PF Q   T+ S ++A+K+KP+L++ +GCHPYP V  +G+ S G++      
Sbjct  20   SVIDHDQVVPFAQPTATSTSHKAAVKFKPQLHISDGCHPYPAVDSSGNTSGGLKPSGSSS  79

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              C+GS  GSQIY RS WY G WA++Y+WY P    ST     GHRH W  VV+W  +P 
Sbjct  80   AGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPSTGL---GHRHDWEHVVVWISNPA  136

Query  163  PDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
             D  T+ A S S        Y P  S Y+  D           +   H   +T   GE Q
Sbjct  137  VDSPTVYAVSTSAH-SGYSIYYPPSSSYM--DGNSAKIDYFKIVVINHAFRMTSSAGETQ  193

Query  223  DLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            DLI W+Q++D AR AL N    +  AN P +D  F   L  ++
Sbjct  194  DLIMWDQMTDAARIALENTDFGD--ANVPFKDGNFMTKLASAW  234

>PHYKE_4438
Length=339

 Score = 159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 124/219 (57%), Gaps = 8/219 (4%)

Query  49   EVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGS  108
            EVQPF Q +P TIS+ +A+K+KP+L++  GCH YP V   G  S G++        C+GS
Sbjct  128  EVQPFPQPEPITISERAAVKFKPQLHISNGCHAYPAVNGAGETSGGLKTTGAPSGKCKGS  187

Query  109  PRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTI  168
              GSQ+Y RS W++  WA++Y+WY P    ST     GHRH W  V+IW ++P+  D  I
Sbjct  188  GYGSQVYGRSGWHKDVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIIWINNPEVADPKI  244

Query  169  LAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWE  228
            LA + S        YAP  +  +  D      + ES     H L +T + G+FQDLI W+
Sbjct  245  LAVTPSAHSG-YSTYAPPPADSM--DGVAAKVNYESFWPVNHALGMTTKGGDFQDLIMWD  301

Query  229  QLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QL+D AR AL+  +     AN P+ D  F   L+K++PF
Sbjct  302  QLTDNARRALNEVNW--GAANVPMNDGNFGGKLDKAWPF  338

>PPTG_12852
Length=331

 Score = 158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 131/220 (60%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V+PF Q +P TIS+++ +K+KP++ +  GC PYP V E G  S G++     R +C G
Sbjct  120  DDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETSGGLKTSGKSRGNCGG  179

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W +G WA++Y+WY P    S      GHRH W +VV++ ++P+  +  
Sbjct  180  SGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSPGM---GHRHDWEYVVVFINNPEVQEPK  236

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S++  G   KK+ P    ++I   +LKV+   +     H L+ T   G FQDLI W
Sbjct  237  ILACSVASHGG-YKKFNPCP-PWVIDGTSLKVRYKHA-WPMNHDLDTTGDGGSFQDLIMW  293

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +Q++++AR AL++      +AN P  D  F + LE ++PF
Sbjct  294  DQMTNDARRALNSVSF--GKANTPFIDGRFRKKLEDAWPF  331

>PYU1_G011233
Length=239

 Score = 155 bits (392),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 130/222 (59%), Gaps = 7/222 (3%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D+V+PF +  PTT++++ AIK+KP+++++ GCHPYP V   G++  G++       
Sbjct  23   VIDHDQVKPFAEPAPTTLAEKLAIKFKPQIFINNGCHPYPAVDAAGNVGGGLKPDGSQSA  82

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C+GS  G+Q+Y R+  Y   +A++Y+WY+P     T     GHRH W  VV+W D+P+ 
Sbjct  83   GCKGSGWGTQVYGRAAPYNDVYAIMYSWYMP---KDTPIPGIGHRHDWENVVVWIDNPNA  139

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
             +  ILA S S      +KYAP K+   +   + KV  + + +   H L+ T   GE Q 
Sbjct  140  ANPKILAVSPSAH-SGYEKYAPPKAG-TVDGTSAKVIYSTTNLVMDHSLDSTTHAGEQQP  197

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            LI WEQL+D AR+ L ++      AN P++D  F + L KSY
Sbjct  198  LIMWEQLTDAARSTLQDYDF--GNANVPMKDGNFMDKLGKSY  237

>PPTG_15233
Length=235

 Score = 154 bits (389),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 119/226 (53%), Gaps = 8/226 (4%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            +   ++D D+V PF Q  PT++SQ +A  +KP+L++  GCHPYP V  +G+ S G+    
Sbjct  16   VQAAVIDHDQVVPFAQPTPTSVSQIAAFNFKPQLHITNGCHPYPAVDTDGNTSGGLNPTG  75

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTD  159
                 C+GS  GSQIY RS WY G WA++Y+WY P    ++ +   GHRH W  +V+W +
Sbjct  76   SSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPASGF---GHRHDWEHIVVWLN  132

Query  160  SPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVG  219
            +P      ILA S S        Y P  S YL  D         S +   H   +T   G
Sbjct  133  NPAVTSPEILAVSTSAHSGYTVYYPP-SSDYL--DGNSAKIDYYSVLLINHSFRMTSDSG  189

Query  220  EFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            E QDLI W+QL+D AR AL +    +  AN P +D  F   L  ++
Sbjct  190  ETQDLIMWDQLTDAARTALEDTDFGD--ANVPFKDANFETKLANAW  233

>PHYRA_71308
Length=236

 Score = 154 bits (389),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 123/242 (51%), Gaps = 8/242 (3%)

Query  24   INLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYP  83
            +NL   +     G   I   ++D D V PF Q  PT++SQ +A+ +KP+L++  GCHPYP
Sbjct  1    MNLRGLLVSAAVGLTAIYGAVIDHDTVVPFAQPTPTSVSQIAAVNFKPQLHITNGCHPYP  60

Query  84   VVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWF  143
             V  +G+ S G+         C+GS  GSQIY RS WY G WA++Y+WY P    ++ + 
Sbjct  61   AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPASGF-  119

Query  144  VDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTE  203
              GHRH W  +V+W ++P      ILA S S        Y P    YL  D         
Sbjct  120  --GHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPP-DLDYL--DGNSAKIDYY  174

Query  204  SRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEK  263
            S +   H   +T   GE QDLI W+QL+D AR AL +    +  AN P +D  F   L  
Sbjct  175  SVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTDFGD--ANVPFKDTNFETKLAN  232

Query  264  SY  265
            ++
Sbjct  233  AW  234

>PHYCA_69480
Length=213

 Score = 153 bits (387),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 126/218 (58%), Gaps = 8/218 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV+PF Q +P TIS+++ +K+KP++ +  GC PYP V + G  S G+Q     +  C G
Sbjct  4    DEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGGCRG  63

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W QG WA++Y+WY P    S+     GHRH W   +++ D+PD  +  
Sbjct  64   SGHGSQVYGRSTWIQGVWAIMYSWYFPKDSPSSRM---GHRHDWEHAIVFIDNPDVPEPK  120

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S+S      KKY P    ++I   +LK++   S     H L+ T   G FQDLI W
Sbjct  121  ILACSVSSH-SGYKKYNPCP-PWVIDGTSLKLRYKHS-WPINHDLDTTGDSGTFQDLIMW  177

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +Q++++AR AL++      +AN P  D  F   LEK++
Sbjct  178  DQMTEDARRALNSVSF--GKANTPFNDGSFKPKLEKAW  213

>PHYSO_414520
Length=213

 Score = 153 bits (386),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 127/221 (57%), Gaps = 8/221 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            ++ D V+PF Q +P TIS+++AIK+KP++ +  GC PYP V + G  S G+Q     +  
Sbjct  1    INHDAVKPFPQPEPVTISEKAAIKFKPQIRIATGCVPYPAVNDVGETSGGLQTSGSPKGG  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C GS  GSQ+Y R+ W+   WA++Y+WY P    S+     GHRH W  VV+W ++PD  
Sbjct  61   CRGSGHGSQVYGRAGWFNDVWAIMYSWYFPKDSPSSRM---GHRHDWEHVVVWINNPDVP  117

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  IL  S S      KKY+    + L    ++KV + E      H L+ T + G FQDL
Sbjct  118  EPKILGISASAHSG-YKKYSSPPPENL-DGNSVKV-NYEHAWPINHALDTTDKAGTFQDL  174

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            I WEQ++++AR AL+  H    +AN P+ D  F   LE+++
Sbjct  175  IMWEQMTEDARRALNAVHF--GKANTPMNDGNFRHKLERAW  213

>PHYRA_54327
Length=219

 Score = 153 bits (386),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 127/217 (59%), Gaps = 8/217 (4%)

Query  49   EVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGS  108
            +V+PF Q +P TIS+++ +K+KP++ +  GC PYP V E G  S G+Q     R  C GS
Sbjct  11   DVKPFPQPEPITISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGGCRGS  70

Query  109  PRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTI  168
              GSQ+Y RS WY   WA++Y+WY P   DS A  + GHRH W  VV++ D+PD  +  I
Sbjct  71   GHGSQVYGRSTWYNQVWAIMYSWYFPK--DSPASGM-GHRHDWEHVVVFIDNPDLPEPKI  127

Query  169  LAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWE  228
            L  S+S   D  KKY P    ++I   ++KV+   S     H L+ T   G FQDLI W 
Sbjct  128  LGCSVSSH-DGYKKYNPC-PPWVIDGTSVKVRYKHS-WPLNHDLDTTGDGGTFQDLIMWN  184

Query  229  QLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            Q++D AR AL N  +  K AN P+ D  F+  +EKS+
Sbjct  185  QMTDNARRAL-NETKFGK-ANTPMNDWNFHSKVEKSW  219

>PHYCA_69477
Length=213

 Score = 152 bits (385),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 125/218 (57%), Gaps = 8/218 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV+PF Q +P TIS+++ +K+KP++ +  GC PYP V + G  S G+Q     +  C G
Sbjct  4    DEVKPFAQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGGCRG  63

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W QG WA++Y+WY P    S+     GHRH W   +++ D+PD  +  
Sbjct  64   SGHGSQVYGRSTWMQGVWAIMYSWYFPKDSPSSRM---GHRHDWEHAIVFIDNPDVPEPK  120

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S+S      KKY P    ++I   +LKV+   S     H L+ T   G FQDLI W
Sbjct  121  ILACSVSSH-SGYKKYNPC-PPWVIDGTSLKVRYKHS-WPINHDLDTTGDAGTFQDLIMW  177

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +Q++++AR AL++      +A  P  D  F   LEK++
Sbjct  178  DQMTEDARRALNSVSF--GKAMTPFNDGSFKPKLEKAW  213

>PHYKE_7568
Length=372

 Score = 157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 124/223 (56%), Gaps = 7/223 (3%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            T++  D+V PF Q  PTT  QE AIK+KP++Y++ GCHPYP V E+G+ S G+       
Sbjct  155  TVISHDQVVPFSQPTPTTTIQEVAIKFKPQIYINNGCHPYPAVDEDGNTSGGLAPTGSES  214

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              C+GS  GSQIY R+  Y+G +A +Y+WY+P   D T   + GHRH W   V+W D   
Sbjct  215  AGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPK--DETLPGL-GHRHDWEACVVWLDDIT  271

Query  163  PDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
             D+  I+A S S        Y P  S YL  D + K++ + S I   H L  T   GE Q
Sbjct  272  LDEPNIVALSASAHSG-YNVYYPPSSSYLDGD-SAKIEYSSSYIVIDHSLSATSTAGETQ  329

Query  223  DLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            DLI W+QL+D ARAAL +       AN P ++  F   L  +Y
Sbjct  330  DLIMWDQLTDAARAALEDTDF--GSANVPFKEANFQTKLGNAY  370

 Score = 65.1 bits (157),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 60/130 (46%), Gaps = 8/130 (6%)

Query  128  LYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLK  187
            +Y+WY P     T +   GHRH W  +V+W ++P      ILA S S        Y P  
Sbjct  1    MYSWYFPKDSPLTGF---GHRHDWEHIVVWLNNPAITSPEILAVSTSAHSGYTVYYPP-D  56

Query  188  SKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKR  247
            S YL  D         S +   H   +T   GE QDLI W+QL+D A+ AL +    +  
Sbjct  57   SDYL--DGNSAKIDYYSVLLINHAFRMTSDAGETQDLIMWDQLTDAAQTALEDTDFGD--  112

Query  248  ANPPIQDKLF  257
            AN P +D  F
Sbjct  113  ANVPFKDANF  122

>PPTG_14652
Length=257

 Score = 154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 113/201 (56%), Gaps = 0/201 (0%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            I    ++ D V+PF Q +P TI++++A+K+KP L V  GCHPYP+V   G  S G++   
Sbjct  15   IRAASINHDMVKPFAQPEPITIAEKAAVKFKPSLAVKSGCHPYPIVNAAGDTSTGLEGTG  74

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTD  159
                 CEG   GSQ+YSRS W + KWA++Y WY P  + +      G RH W+ +V+W D
Sbjct  75   PPDGGCEGPELGSQVYSRSTWCEDKWAIMYAWYFPKDIQNRGLVKTGVRHDWVNLVVWLD  134

Query  160  SPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVG  219
            +P      +LA S S +G+      P K+  +I+  T K++  E      H +      G
Sbjct  135  NPALVKPAMLATSASTYGNLYVISKPPKTSDVINGTTPKLRYDEDGYEAWHTVFQFHEEG  194

Query  220  EFQDLITWEQLSDEARAALSN  240
            E+QDLI W QL+D AR AL+N
Sbjct  195  EYQDLIQWNQLTDAAREALTN  215

>PITG_22734
Length=168

 Score = 150 bits (380),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 100/186 (54%), Gaps = 25/186 (13%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA     +  LA +  K   +N                      DEVQPF Q  P T
Sbjct  1    MNLRAFLIAAVASLAVANAKVSRVNH---------------------DEVQPFTQPLPIT  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             SQ+SA+KYKP+L++  GCHPYP V+ NGS S G++W       C GSP GSQ+YSRSDW
Sbjct  40   DSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGDCTGSPLGSQVYSRSDW  99

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+ KWA++Y WY P       + + GHRH+W +VV+W DS    +S+I   SMS      
Sbjct  100  YKNKWAIMYAWYFPKGR----YGLTGHRHYWEYVVVWADSSTSTNSSIQGVSMSAGVGHA  155

Query  181  KKYAPL  186
            K   P+
Sbjct  156  KATPPM  161

>PHYCA_119748
Length=261

 Score = 153 bits (387),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 126/220 (57%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V+PF Q +P TIS+++ +K+KP++ +  GC PYP V E G    G++     R +C G
Sbjct  50   DQVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETGGGLKTTGKSRGNCGG  109

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS WYQG WA++Y+WY P    S      GHRH W   +++ D+P+  +  
Sbjct  110  SGYGSQVYGRSTWYQGVWAIMYSWYFPKDSPSPKM---GHRHDWEHAIVFIDNPEVSEPK  166

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S+S       KY P    ++I   +LKV+   +     H L+ T   G+FQDLI W
Sbjct  167  ILACSVSSHSG-YTKYNPC-PPWVIDGTSLKVRYKHA-WPYNHDLDATGDGGKFQDLIMW  223

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             QL+++AR AL++      +AN P  D  F   +E ++PF
Sbjct  224  NQLTEDARRALNSVSF--GKANTPFSDDKFMPKIENAWPF  261

>PYU1_G011235
Length=238

 Score = 152 bits (385),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 126/221 (57%), Gaps = 8/221 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            ++ D+V PF +  P++ S++ A+K+KP++++  GCHPYP V   G+ S G++        
Sbjct  24   INHDQVVPFAEPTPSSASEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  G+Q+Y R   Y+ KWA++Y+WY P     T     GHRH W  VV+W D+P   
Sbjct  84   CKGSGWGTQVYGRVASYKDKWAIMYSWYFPKDSPITGL---GHRHDWEHVVVWIDNPKAA  140

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA S S      +KYAP K+   +   + KV  T S+I   H L+ T   GE Q L
Sbjct  141  NPKILAISPSAH-SGYQKYAPPKAG-TVDGTSAKVDYT-SKIVINHALDSTTAAGEKQPL  197

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            I WEQ++D AR+AL N      +AN P++D  F   L K+Y
Sbjct  198  IMWEQMTDAARSALENTDF--GKANVPMKDGNFMNKLAKAY  236

>PHYRA_71588
Length=242

 Score = 153 bits (386),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 122/223 (55%), Gaps = 9/223 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS--C  105
            D+VQPF Q  P TIS+++A+++KP L +D GCH YP V   G  + G+  K   RPS  C
Sbjct  26   DKVQPFAQPDPVTISEKTAVRFKPILRIDNGCHSYPAVNAAGETNAGL--KGTGRPSGDC  83

Query  106  EGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDD  165
            +GS  GSQ+Y RS W+   WA++Y WY P  +        G RH W  VV+W D+P  + 
Sbjct  84   KGSSLGSQVYGRSVWHGDLWAIMYAWYFPKDMPILG---KGKRHDWANVVVWLDNPAHER  140

Query  166  STILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT-KRVGEFQDL  224
             TI+  S S +     KY P  +  L    ++     +      H L++  +  GEFQDL
Sbjct  141  PTIIGVSPSAYVTTYAKYTPPPANRLTGLTSMISYLADDLNYGYHTLDMNWEAGGEFQDL  200

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            + WEQL+DEARAAL N     + A  P  D  F   LEK++P+
Sbjct  201  VMWEQLTDEARAAL-NDTDFGENALVPFIDANFKANLEKAWPY  242

>PHYRA_46230
Length=212

 Score = 152 bits (383),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 123/216 (57%), Gaps = 8/216 (4%)

Query  49   EVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGS  108
            EV+PF Q  P TIS+++ +K+KP++ +  GC PYP V   G  S G++     +  C GS
Sbjct  5    EVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGGCRGS  64

Query  109  PRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTI  168
              GSQ+Y RS W    WA++Y+WY P    S+     GHRH W  VV++ D+PD  +  I
Sbjct  65   GHGSQVYGRSAWLNDVWAIMYSWYFPKDSPSSGM---GHRHDWEHVVVFIDNPDVAEPKI  121

Query  169  LAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWE  228
            +  S S   +  KKYAP    ++I   ++KV+   S     H L++T   G FQDLI W+
Sbjct  122  MGCSASSH-NGYKKYAPCP-PWVIDGTSVKVRYKHS-WPINHDLDVTGDAGTFQDLIMWD  178

Query  229  QLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKS  264
            Q++++AR AL+  H  +  AN P+ D  F   LEK+
Sbjct  179  QMTEDARRALNGVHFGD--ANTPMNDGNFIPKLEKA  212

>PPTG_13769
Length=349

 Score = 154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 125/219 (57%), Gaps = 8/219 (4%)

Query  49   EVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGS  108
            +V+PF Q +P TIS+++ +K+KP++ +  GC PYP V E G  S G+      R  C GS
Sbjct  138  DVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEFGETSGGLHTSGKSRGKCGGS  197

Query  109  PRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTI  168
              GSQ+Y RS W +G W ++Y+WY P    S      GHRH W   +++ D+PD  +  I
Sbjct  198  GHGSQVYGRSAWLKGVWVIMYSWYFPKDSPSHGL---GHRHDWEEAIVFIDNPDVSEPKI  254

Query  169  LAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWE  228
            L  S+S  G    ++AP    ++I   +LKV+   S   K H L +T   G+FQDLI W 
Sbjct  255  LGCSVSSHGG-YARHAPC-PPWVIDGTSLKVRYKHS-WPKNHDLAITGDGGKFQDLIMWG  311

Query  229  QLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            Q++++AR AL+        AN P +D  F + +EK++PF
Sbjct  312  QMTNDARRALNAVSF--GSANTPFKDGTFQDKIEKAWPF  348

>PPTG_08005
Length=759

 Score = 160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 127/224 (57%), Gaps = 8/224 (4%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D V PF Q +P TIS+++AIK+KP+L++  GCH YP V   G  S G++       
Sbjct  543  IIDHDAVVPFKQPEPVTISEKAAIKFKPQLHITNGCHAYPAVNAIGETSGGLKTSGAPSA  602

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C+GS  GSQ+Y RS WY G WA++Y+WY P    ST     GHRH W  V++W D+P+ 
Sbjct  603  GCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTGL---GHRHDWEHVIVWIDNPEI  659

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
             +  ILA + S       +  P  +K  +   ++KVK   S+    H LE T   G++QD
Sbjct  660  AEPKILAVTPSAHSGYSAQVPPDANK--VDGTSVKVKYL-SKWPINHALESTGEGGDYQD  716

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            LI W Q++D AR ALS     +  AN P+ D  F   L K++PF
Sbjct  717  LIMWGQMTDAAREALSRTSFGD--ANVPMNDGNFEPKLGKAWPF  758

>PPTG_17295
Length=238

 Score = 150 bits (380),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 128/237 (54%), Gaps = 13/237 (5%)

Query  38   VLISPTL-------MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGS  90
            ++I+ TL       +D D++ P  Q  P TIS+++AIK+KP+L + +GC  +P V + G 
Sbjct  8    IIIAATLAAVTARRVDHDKLGPIPQPDPVTISEKAAIKFKPQLNIADGCVSFPAVNDGGD  67

Query  91   LSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHF  150
             S G++  N    +C+ +P GSQ+Y R+ WY  KWA++Y W+ P         V   R+ 
Sbjct  68   FSGGLKGSNG-NSACDDAPMGSQVYGRAAWYNDKWAIMYAWFFPKGF---FMGVASRRYD  123

Query  151  WLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKH  210
            W   V+W D+PD     +L  S S   DE ++ +P     +++  T  +  + S +  + 
Sbjct  124  WSSAVVWIDNPDFATPAVLGLSTSTSDDEYQRKSPAPDFGILNGVTPLLYRSISEVAGQP  183

Query  211  GLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             L+ + R G+FQ LI WEQL+D AR  L+ F      A  P  D  F E L+K+YPF
Sbjct  184  MLDYSSRTGDFQPLIMWEQLTDAARETLNTFDF--GNAQVPFNDANFEEKLKKAYPF  238

>PHYRA_74630
Length=343

 Score = 153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 124/222 (56%), Gaps = 12/222 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV+PF Q +P TIS ++ +K+KP++ +  GC+PYP V E G +  G++     R  C G
Sbjct  132  DEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKPTGKSRGKCAG  191

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W+   W ++Y+WY P    S      GHRH W   V++ D+PD  +  
Sbjct  192  SGHGSQVYGRSTWHNSVWVIMYSWYFPKDSPSPGL---GHRHDWEHAVVFIDNPDVPEPK  248

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S+S   D  KKY P    ++I   +LKV+   S     H L+ T   G FQDLI W
Sbjct  249  ILACSVSSH-DGYKKYNPC-PPWVIDGTSLKVRYKHS-WPINHDLDTTGDGGTFQDLIMW  305

Query  228  EQLSDEARAAL--SNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             Q++D AR AL  +NF      AN P+ D  F   ++ ++PF
Sbjct  306  GQMTDNARRALNEANF----GSANTPMNDGNFPNKVQAAWPF  343

>PHYCA_132529
Length=232

 Score = 150 bits (378),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 121/232 (52%), Gaps = 18/232 (8%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            I+  ++D  E++PF Q +P T+S + A+++KP+L + +GCHPYP V E G +S G     
Sbjct  7    INAAIVDYQEIKPFAQPEPITVSDKVAVRFKPQLRIKDGCHPYPAVNEAGDISSGAD-SG  65

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTD  159
            +   SC GS  GSQ+Y RS W  G W M+Y WY P          D   H W  VV+W D
Sbjct  66   WGDSSCSGSDVGSQVYGRSAWCGGVWGMMYAWYFPK---------DETTHRWENVVVWID  116

Query  160  SPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKT-----LKVKSTESRIRKKHGLEL  214
             P  ++ TIL  S S  G  I +YAPL       D        ++    +  R  H L+ 
Sbjct  117  DPAVENPTILGVSTSSDGGYI-RYAPLDDNDWARDGDNVQIQYRLDDVMATTRVFHHLDT  175

Query  215  TKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYP  266
            + R G+ Q L+TWEQL++EAR  L N    E +   P+++  F   L+ + P
Sbjct  176  SWRGGDIQGLVTWEQLTEEARNTLENGDFGESKV--PLKNSTFTANLDFAIP  225

>PPTG_15234
Length=235

 Score = 150 bits (378),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 126/228 (55%), Gaps = 13/228 (6%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            I   ++D D+V PF Q  P T  Q  A+++KP++Y++ GCHPYP V E+G+ S G++   
Sbjct  17   IDAAVIDHDQVVPFAQPTPNTTVQSVAVQFKPQIYINNGCHPYPAVDEDGNTSGGLKPTG  76

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPM--ALDSTAWFVDGHRHFWLWVVIW  157
                 C+GS  GSQIY R+  Y G +A +Y+WY+P    LD       GHRH W   V+W
Sbjct  77   SESAGCKGSGYGSQIYGRAVEYDGVYAFMYSWYMPKDETLDGL-----GHRHDWENCVVW  131

Query  158  TDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKR  217
             DS   D+ +I+A S S +      Y P  S YL  D + K++ + S +   H L  T  
Sbjct  132  LDS--LDNPSIVALSAS-YHSTYLYYYPPDSDYLDGD-SAKIEYSTSWVILDHSLSATST  187

Query  218  VGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            VGE QDLI W+QL+D AR AL +    +  AN P ++  F   +  +Y
Sbjct  188  VGETQDLIMWDQLTDAARTALEDTDFGD--ANVPFKETNFATKVANAY  233

>PHYRA_43347
Length=220

 Score = 149 bits (377),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 114/200 (57%), Gaps = 7/200 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q  P T+S+++A+++KP L +D GCHPYP V   G  S G++        
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  105  CEGSPRGSQI---YSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
            C+GS  GSQ+   Y+R+ WY   WA++Y WY P    +   F  G RH W  VV+W D+P
Sbjct  84   CKGSGLGSQVVLRYARAVWYSDLWAIMYAWYFPKDKPT---FRKGERHDWANVVVWLDNP  140

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELT-KRVGE  220
              +  T++  S S +     KY P  +  L    ++     ++     H ++ T K  GE
Sbjct  141  ALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNHGFHSVDTTWKTGGE  200

Query  221  FQDLITWEQLSDEARAALSN  240
            FQDLI WEQL+DEARAAL++
Sbjct  201  FQDLIMWEQLTDEARAALND  220

>PHYCA_576423
Length=234

 Score = 149 bits (377),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 120/224 (54%), Gaps = 13/224 (6%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D+V PF Q  P T  Q  AI++KP++Y++ GCHPYP V  +G+ S G++       
Sbjct  20   VIDHDQVIPFAQPMPNTTLQSVAIQFKPQIYINNGCHPYPAVDADGNTSGGLKPTGSQSA  79

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPM--ALDSTAWFVDGHRHFWLWVVIWTDSP  161
             C+GS  GSQIY R+  Y+G +A +Y+WY+P    LD       GHRH W   V+W DS 
Sbjct  80   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDETLDG-----QGHRHDWENCVVWLDSL  134

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            D      L+AS   +      Y P  S YL    + K++ + S I   H L  T   GE 
Sbjct  135  DRPSIVALSAS---YHSTYNYYYPPSSSYL-DGNSAKIQYSTSWIVLDHSLSATSTAGEI  190

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            QDLI W+QL+D AR AL +       AN P ++  F   L K+Y
Sbjct  191  QDLIMWDQLTDAARTALEDTDF--GSANVPFKEDNFIAKLAKAY  232

>HYAP_09243
Length=266

 Score = 150 bits (379),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 120/226 (53%), Gaps = 8/226 (4%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            PT    D + PF + KP TIS+++ +K+KP L V+ GC PY  V   G  S G+Q     
Sbjct  42   PTTTGHDAIVPFSEPKPVTISEKAGVKFKPLLDVNTGCAPYAAVNAEGETSGGLQTSGDP  101

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C GS  GSQ+Y RS WY   WA++Y WY P     +   + GHRH W  VV++ + P
Sbjct  102  ESGCRGSKYGSQVYGRSTWYNDVWAIMYAWYFP---KDSPMLLMGHRHDWENVVVFINDP  158

Query  162  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  221
            D  + TIL  S S     I KYAP  +   I+  ++ +K  E      H L +TK  G +
Sbjct  159  DEVEPTILGCSTSWHSGYI-KYAPCPTDS-INGSSVMIK-YEHSFPLNHALNITKDAGAY  215

Query  222  QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            QDLI W Q+ D AR AL++      +A  P+ D  F E +E ++PF
Sbjct  216  QDLIMWHQMPDLARRALNDTDF--GKAITPMNDLNFMEKIEAAWPF  259

>PHALS_02474
Length=242

 Score = 149 bits (377),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 130/223 (58%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +  D+V+PF   +      E A+ ++P L ++ GCHPYP V +NG +S+G+   ++F   
Sbjct  28   LQYDKVKPFPATERDCPINEIALDFQPMLRIESGCHPYPAVDKNGYISDGLGVSHWFT-D  86

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C GSP GSQ+Y R+  Y+G  A++Y WY P    +T ++V GHRH W   ++W +    +
Sbjct  87   CSGSPEGSQVYGRAHVYKGYLAIMYAWYFPRDFMTTPFYV-GHRHGWEHAILWIEG-SSE  144

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            D+ +LAAS+         YAP+ SKY+  D  +K++ T   +   H L  TK  GEFQDL
Sbjct  145  DAVLLAASVES-TLSYDTYAPVPSKYMKSDH-IKLEYTWLGV-THHYLTATKESGEFQDL  201

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            + W+ L++ A  +L+   ++    + P+ DK F++ L KSYPF
Sbjct  202  VMWDNLTENAHKSLNE--KVSLNFDSPLSDKRFFKALRKSYPF  242

>PHYSO_329114
Length=236

 Score = 149 bits (375),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 118/215 (55%), Gaps = 10/215 (5%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            ++ D+V+PF Q KP T+S+++A+K+ P++++  GCHPYP V   G  S G+Q        
Sbjct  23   INHDQVRPFAQPKPATVSEKAAVKFNPQIHITNGCHPYPAVNAAGETSGGLQTNGAPSAG  82

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y RS WY+G+WA++Y+WY P    ST     GHRH W  VV+W D+P   
Sbjct  83   CKGSGWGSQVYGRSTWYKGRWAIMYSWYFPKDSPSTTL---GHRHDWEHVVVWIDNPAVA  139

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S       KYAP K+   +   T KV + ES     H L+ T   G+ QDL
Sbjct  140  NPKILAVTPSAH-SGYSKYAPPKAG-TVTGNTAKV-NYESHWPVNHALDSTDVGGDAQDL  196

Query  225  ITWEQLSDEARAALSNFHRL----EKRANPPIQDK  255
            I WEQ   + R       R     E R   P+ D+
Sbjct  197  IMWEQQHGKLRRRQCTHERWKLHDESRKGFPVVDE  231

>PHYSO_504553
Length=257

 Score = 149 bits (376),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/248 (38%), Positives = 129/248 (52%), Gaps = 27/248 (11%)

Query  36   GAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGM  95
            GAV I     D D+VQPF Q +P T+S+++A+K+KP L++ +GCHPYP V   G  S G+
Sbjct  20   GAVTI-----DHDKVQPFAQPEPVTVSEKTAVKFKPSLHIVDGCHPYPAVNAAGETSAGL  74

Query  96   QWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVV  155
            +        C+GS  GSQ+Y R+ WY+  WA++Y WY P   D   +   G RH W+  V
Sbjct  75   KGSGRIDGKCKGSALGSQVYGRAIWYKDLWAIVYGWYFPK--DKVDFLNKGQRHKWVSAV  132

Query  156  IWTDSPDPDDSTILAAS---MSGFGDEIKKYAPLKSKYLIHDKTLK-----------VKS  201
            +W D+P  +   ILA S   + G  D +K   P   +Y    K ++           V+S
Sbjct  133  VWLDNPAVETPKILAISTWNVKGGYDILKNEPPECYRYGCDPKFVEYINMTTPMLSYVRS  192

Query  202  TESRIRKKHGLELT--KRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYE  259
             E  +   H L  T  +  GE QDL+ WEQLS+EAR AL      EK   P I   L   
Sbjct  193  LEEPV---HTLRPTTARGTGELQDLVMWEQLSEEARIALGEADFGEKSPVPFIDTNLNAN  249

Query  260  VLEKSYPF  267
             LE + PF
Sbjct  250  -LEAARPF  256

>PHYCA_6835
Length=210

 Score = 147 bits (372),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 120/216 (56%), Gaps = 13/216 (6%)

Query  52   PFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRG  111
            P  QR      + SA+K+KP+L++  GCH YP V E G    G++ K      C+GS  G
Sbjct  7    PLRQR-----GRRSAVKFKPQLHITNGCHSYPAVDEAGETGGGLKTKGAPSAGCKGSGWG  61

Query  112  SQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAA  171
            SQ+Y RS WYQ  WA++Y WY P    S+     GHRH W  V++W D+P  ++  ILA 
Sbjct  62   SQVYGRSGWYQDVWAIMYCWYFPKDEPSSG---IGHRHDWEHVIVWIDNPAVENPKILAV  118

Query  172  SMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLS  231
            + S       KYAP  +   I   T KV + +S+    H L+ T   G+FQDLI W+QLS
Sbjct  119  TPSAH-SGYHKYAPPNAD-TIDGVTTKV-AYDSKWPMDHALDSTSEAGDFQDLIMWDQLS  175

Query  232  DEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            + AR AL++ +    +AN P+ D  F   L K++PF
Sbjct  176  ENARRALNSVNF--GKANTPMNDGNFQPKLAKAWPF  209

>PHYKE_7566
Length=260

 Score = 149 bits (375),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 90/244 (37%), Positives = 126/244 (52%), Gaps = 10/244 (4%)

Query  25   NLNVSVYPEKPGAVLISPTLMDV---DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHP  81
            N +  +YP       ++    DV   D+V PF Q   TT  Q + IK+KP++++  GCHP
Sbjct  22   NKHPQIYPSCTPVASLACAQADVISHDQVVPFAQPTATTTLQAAGIKFKPQIHISNGCHP  81

Query  82   YPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTA  141
            YP V ++G+ S G++        C+GS  GSQIY R   YQG +A++Y+WY P     T 
Sbjct  82   YPAVNKDGNTSGGLKPTGSASAGCKGSGYGSQIYGRITTYQGVYAIMYSWYFPKDSPITG  141

Query  142  WFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKS  201
                GHRH W  V++W D     + +I+A S S        Y P KS   I   + KV  
Sbjct  142  L---GHRHDWEHVIVWVDDITLTNPSIVAVSPSAH-SGYNIYYPPKSG-TIDGYSAKVDY  196

Query  202  TESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVL  261
            + S +   H L+ T   GE QDLI W+QL+D AR AL N    +  AN P++D  F   L
Sbjct  197  SSSYLVVNHALDSTSDAGETQDLIMWDQLTDAARTALENTDFGD--ANVPMKDANFQAKL  254

Query  262  EKSY  265
              +Y
Sbjct  255  GNAY  258

>PPTG_15231
Length=258

 Score = 149 bits (375),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 118/227 (52%), Gaps = 7/227 (3%)

Query  39   LISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWK  98
            ++   ++  D V PF Q   TT  Q++ +K+KP++++  GCHPYP V  NG+ S G++  
Sbjct  37   VVQADVISHDAVVPFAQPTATTTEQKAGVKFKPQIHISNGCHPYPAVDANGNTSGGLKPT  96

Query  99   NYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWT  158
                  C+GS  GSQ+Y R   Y G +A++Y+WY P     T     GHRH W  VV+W 
Sbjct  97   GSSSAGCKGSGYGSQVYGRVATYNGVYAIMYSWYFPKDSPVTGL---GHRHDWEHVVVWV  153

Query  159  DSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV  218
            D    D  +I+A S S        Y P  +   I   + KV  + S +   H L+ T   
Sbjct  154  DDIKLDSPSIIAVSPSAHSGYNIYYPPESNT--IDGYSAKVDYSSSWVVINHALDSTTDA  211

Query  219  GEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            GE QDLI W+QL+D AR AL N    +  AN P++D  F   +  +Y
Sbjct  212  GETQDLIMWDQLTDAARTALENTDFGD--ANVPMKDGNFLTKVGNAY  256

>HYAP_08306
Length=286

 Score = 149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 124/238 (52%), Gaps = 12/238 (5%)

Query  33   EKPGAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLS  92
            +K   VL  P  +  D +QPF Q KP T     AIK KP L++  GCHPYP V   G  S
Sbjct  46   QKSSLVLWVPKWVGHDTLQPFPQPKPVTRLDVVAIKLKPELFIVHGCHPYPAVNATGHTS  105

Query  93   EGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPM-ALDSTAWFVDGHRHFW  151
             G++        C+GS  GSQ+Y R+ W++GKWA++Y WY P  A D  +    G RH W
Sbjct  106  NGLKTSGDADGHCKGSGHGSQVYGRATWFRGKWAIMYAWYFPKDAPDEES----GQRHDW  161

Query  152  LWVVIWTDSPDPDDSTILAASMSG--FGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKK  209
               ++W ++P      ILA S+S   F   +KK AP  +   + D T    S  +  + +
Sbjct  162  EHAIVWINNPKVKQPKILAVSVSCGKFFGYLKKVAPGPA---VFDGTRLKLSYGADHKHE  218

Query  210  HGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            H L+LT   GE QDLI WEQL+DEAR A      L      P+ D  +   L +++PF
Sbjct  219  HRLDLTAEKGEDQDLIMWEQLTDEARCAFDTI--LWTNDMMPLNDAWYKHELTRAWPF  274

>PHYSO_249751
Length=238

 Score = 147 bits (372),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 130/243 (53%), Gaps = 9/243 (4%)

Query  26   LNVSVYPEKPGAVLIS--PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYP  83
            +N+        A LIS    ++  D+V PF Q   T+ +  +A+K+K +++++ GCHPYP
Sbjct  1    MNLRAIAAVTAASLISVEAGVIGHDQVVPFPQSAATSAANIAALKFKLQIFINNGCHPYP  60

Query  84   VVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWF  143
             V   G  S G++        C+GS  GSQ+Y RS  Y  K A++Y+WY P     T   
Sbjct  61   AVNAAGDTSGGLKPSGSVNAGCKGSGYGSQVYGRSTLYNNKHAIMYSWYFPKDNPVTGL-  119

Query  144  VDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTE  203
              GHRH W  V++W D+P   ++TILA + S        YAP  +  ++   ++KV+ T 
Sbjct  120  --GHRHDWEHVIVWIDNPASSNATILAMTPSAH-SGYSTYAPPPAT-MVDGTSVKVEYTS  175

Query  204  SRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEK  263
            S++   H LE T   GE Q+LI WE ++D AR AL+        AN P++D  F   L K
Sbjct  176  SKVVINHHLEGTSTAGETQNLIMWEDMTDAARYALNTTDF--GSANVPMKDGNFISKLGK  233

Query  264  SYP  266
            +YP
Sbjct  234  AYP  236

>PHALS_06162
Length=488

 Score = 154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/247 (35%), Positives = 132/247 (53%), Gaps = 29/247 (12%)

Query  34   KPGAVLISPT-----LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQEN  88
             P  +  SPT      M  D+V PF Q KP T+++ +A+K+KP++ +  GCHPYP V   
Sbjct  251  NPTTLASSPTPWIQKTMRHDKVVPFKQPKPVTVAEHAAVKFKPQINIVNGCHPYPAVNAT  310

Query  89   GSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHR  148
            G +S G++        C+GS  GSQ+Y RS W++G WA++Y+WY P     TA+ + GHR
Sbjct  311  GEISGGLKASGSSDAGCKGSEYGSQVYGRSTWHRGLWAIMYSWYFP---KDTAFPLLGHR  367

Query  149  HFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIR-  207
            H W  +++W D+P      ILA + S       +  P          T +V  T  +++ 
Sbjct  368  HDWEHIIVWIDNPSLYKPRILAVASSAHSWYTVQSPP---------HTDRVNGTSVKVKY  418

Query  208  -----KKHGLELTKRVGEFQDLITWEQLSDEARAAL--SNFHRLEKRANPPIQDKLFYEV  260
                   H L  T + GE+QDLI WEQL++ AR +L  +NF      AN P++D  F + 
Sbjct  419  AGIWPLNHALTSTTKSGEYQDLIMWEQLTEAARQSLQQANF----GMANVPMRDGNFLDK  474

Query  261  LEKSYPF  267
            L+ ++ F
Sbjct  475  LDTAWSF  481

>PYIW_25259
Length=246

 Score = 147 bits (371),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 121/227 (53%), Gaps = 17/227 (7%)

Query  48   DEVQPFYQRKP---------TTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWK  98
            D V PF Q  P         T++S  +A+K+KP++++  GCHPYP V   G+   G++  
Sbjct  26   DAVVPFAQPAPVTLEQTPAPTSLSHTAALKFKPQIHISNGCHPYPAVDAAGNTGGGLKPS  85

Query  99   NYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWT  158
                  C+GS  G+Q+Y RS W+ GKWA++Y+WY P     T     GHRH W  VV+W 
Sbjct  86   GSQSAGCKGSGWGTQVYGRSTWFNGKWAIMYSWYFPKDSPFTGL---GHRHDWEHVVVWI  142

Query  159  DSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV  218
            D+P   +  ILA + S      KKYAP KS   +   + KV+  ++ I   H L+ T   
Sbjct  143  DNPANANPAILAVTPSAH-SGYKKYAPPKSG-TVDGNSAKVE-YKAIIVINHALDSTTTG  199

Query  219  GEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            GE Q LI W+QL+D AR+ L N       AN P++D  F   +  +Y
Sbjct  200  GEQQPLIMWDQLTDAARSGLENTDF--GSANVPMKDGNFMTKVANAY  244

>PHYRA_83592
Length=237

 Score = 147 bits (370),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 128/228 (56%), Gaps = 17/228 (7%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P TIS+++ +K+KP+L++ EGC  YP V   G  S G++        
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTGD-DSG  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSPDP  163
            C+    GSQ+Y R++WY   WA++Y WY P    D   ++    RH W  VV+W D+PD 
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDKCPYW----RHDWSNVVVWIDNPDV  136

Query  164  DDSTILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
            + S +L  S+S   ++   KYAP +S   I + T  +           GL     +G+FQ
Sbjct  137  ETSKVLGLSLSTSENKYGHKYAPAES---IRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  193

Query  223  DLITWEQLSDEARAALS---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            DLI W+QL+D ARAAL+   NF R E     PI D  F E LEK++PF
Sbjct  194  DLIMWDQLTDAARAALNDQDNFGRTEV----PISDDHFPEHLEKAWPF  237

>PHYRA_44405
Length=232

 Score = 147 bits (370),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 120/222 (54%), Gaps = 7/222 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P TIS+++A+++KPRL +  GCHPYP V   G  S G++        
Sbjct  16   IDHDKVQPFAQPEPVTISEKAAVQFKPRLQIFGGCHPYPAVNAAGETSAGLKGTGTHDGD  75

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  S  GSQ+Y RS WY   W ++Y WY P        +  GHRH W  VV+W D+P  +
Sbjct  76   CMRSRLGSQVYGRSVWYGDLWGIMYAWYFPK---DKPKYRKGHRHEWANVVVWLDNPAHE  132

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKK-HGLELTKRV-GEFQ  222
              T++  S S F     KY  + +      KT  +   +  +    H +++   + GEFQ
Sbjct  133  RPTMIGMSTSWFVTTYAKYKFVPTNGF-DGKTYTINYKDDVLNDGFHSVDVIWEIGGEFQ  191

Query  223  DLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKS  264
            DLI WEQL+DEARAALS+    E  A  P  D  F   LEK+
Sbjct  192  DLIMWEQLTDEARAALSDTDFGED-APVPFIDANFKANLEKA  232

>PHALS_08947
Length=242

 Score = 147 bits (370),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 128/223 (57%), Gaps = 8/223 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +  D+++PF   +      E A+ ++P L ++ GCHPYP V ENG +S+G+   ++F   
Sbjct  28   LQYDKIKPFPATERDCPINEIALDFQPMLRIESGCHPYPAVDENGYISDGLGVSHWFT-D  86

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C GSP GSQ+Y R+  Y+G  A++Y WY P    +T ++V GHRH W   ++W      +
Sbjct  87   CLGSPEGSQVYGRAHVYKGYLAIMYAWYFPRDFMTTPFYV-GHRHGWEHAILWIGG-SSE  144

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            D+ +LAAS+         Y P+ SKY+  D  +K++ T   +   H L  TK  GEFQDL
Sbjct  145  DAVLLAASVES-TLSYDTYNPVPSKYMKGDH-VKLEYTWLGV-THHYLTATKESGEFQDL  201

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            + W+ +++ A  +L+   ++    N P+ DK F++ L KSYPF
Sbjct  202  VMWDNMTENAHISLNE--KVSLNFNSPLSDKRFFKALLKSYPF  242

>PHYCA_123205
Length=177

 Score = 145 bits (365),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 114/204 (56%), Gaps = 28/204 (14%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA F   I  LA        +N +V               +++ D+VQPF Q +PTT
Sbjct  1    MNLRAFFLAAIASLAA-------VNADVE--------------MINHDKVQPFTQPEPTT  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S+ SA+KYKP+L +         VQ +GS+S G++W  +    C+GS  GSQ+YSRSDW
Sbjct  40   NSENSAVKYKPQLRISTA------VQADGSVSAGLKWAGWSDGDCKGSELGSQVYSRSDW  93

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+ KWA++Y WY P      + +  GHRH+W + ++W DS  PD+STIL  SMS      
Sbjct  94   YKDKWAIMYAWYFPKGRQYISKYRFGHRHYWSYAIVWMDSDVPDNSTILGVSMSAGVGYS  153

Query  181  KKYAPLKSKYLIHDKTLKVKSTES  204
            K+  P KSKY++   T+K +S  S
Sbjct  154  KETLP-KSKYVVDGTTVKFESYNS  176

>PYU1_G011236
Length=237

 Score = 146 bits (369),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 114/218 (52%), Gaps = 8/218 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V PF +  PTT +Q+  IK+KP+L++  GCHPYP V   G+ S G++        C+G
Sbjct  26   DAVVPFVEPTPTTTAQKLGIKFKPQLHISNGCHPYPAVDAAGNTSGGLKPTGSSDAGCKG  85

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  G+Q+Y R+  Y G +A++Y+WY P    ST   + GHRH W  VV+W D+PD     
Sbjct  86   SGYGTQVYGRAAAYNGVYALMYSWYFPKDSPST---LLGHRHDWEHVVVWIDNPDAASPK  142

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S S      K + P  +    +   +  KS    +   H  ++T   GE Q LI W
Sbjct  143  ILAVSASAHSGYNKYHPPATTTLAGNSAKIDYKSI---VVLNHAFDMTTAAGETQPLIMW  199

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +Q++  AR AL      +  AN P++D  F   L  +Y
Sbjct  200  DQMTVAARTALETTDFGD--ANVPMKDGNFMTKLANAY  235

>PHYCA_12462
Length=177

 Score = 144 bits (363),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 115/204 (56%), Gaps = 28/204 (14%)

Query  1    MGLRAIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTT  60
            M LRA F   I  LA        +N +V               +++ D+VQPF Q +PTT
Sbjct  1    MNLRAYFLAAIASLAA-------VNADVE--------------MINHDKVQPFTQPEPTT  39

Query  61   ISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDW  120
             S++SA+KYKP+L +         VQ +GS+S G++W  +    C+GS  GSQ+YSRSDW
Sbjct  40   NSEKSAVKYKPQLRISTA------VQADGSVSAGLKWTGWSDGDCKGSELGSQVYSRSDW  93

Query  121  YQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI  180
            Y+ KWA++Y WY P      + +  GHRH+W + ++W DS  PD+STIL  SMS      
Sbjct  94   YKDKWAIMYAWYFPKGRQYISKYRFGHRHYWSYAIVWMDSDVPDNSTILGVSMSAGVGYS  153

Query  181  KKYAPLKSKYLIHDKTLKVKSTES  204
            K+  P KSKY++   T+K +S  S
Sbjct  154  KETLP-KSKYVVDGTTVKFESYNS  176

>PYIR_13251
Length=236

 Score = 146 bits (368),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 122/218 (56%), Gaps = 8/218 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V PF Q  P T+ Q+ A+K+KP++++  GCHPYP V   G+ S G++        C+G
Sbjct  25   DAVVPFAQPTPVTLEQKVALKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAGCKG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  G+Q+Y R+  Y+  +A++Y+WY P     T     GHRH W  VV+W D+P   + T
Sbjct  85   SGWGTQVYGRAAAYKDVYALMYSWYFPKDSPFTGL---GHRHDWEHVVVWIDNPAVANPT  141

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA + S      +KYAP K+   +   + KV  T S++   H L+ T   GE Q LI W
Sbjct  142  ILAVTPSAH-SGYEKYAPPKAG-TVDGTSAKVDYT-SKVVINHALDSTTDAGEKQPLIMW  198

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +QL+  AR+AL N +  +  AN P++D  F   L  +Y
Sbjct  199  DQLTAAARSALENTNFGD--ANVPMKDGNFMTKLGNAY  234

>PHYCA_69479
Length=213

 Score = 145 bits (365),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 121/217 (56%), Gaps = 8/217 (4%)

Query  49   EVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGS  108
            +++PF Q  P TIS+++ +K+KP++ +  GC PYP V E G  S G++     R  C GS
Sbjct  5    DIKPFPQPVPVTISEKAGVKFKPQIQIRTGCVPYPAVNEFGETSGGLKPTGNPRGGCRGS  64

Query  109  PRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTI  168
              GSQ+Y RS W +G WA++Y+WY P    S      GHRH W   +++ D+PD  +  I
Sbjct  65   GYGSQVYGRSTWIRGVWAIMYSWYFPKDSPSPGL---GHRHDWEHAIVFIDNPDVPEPKI  121

Query  169  LAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWE  228
            LA S+S      KKY P    ++I   +LKV+   +     H L+ T   G FQDLI W 
Sbjct  122  LACSVSSH-SGYKKYNPCP-PWVIDGTSLKVRYKHA-WPMNHDLDTTGDGGSFQDLIMWN  178

Query  229  QLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            Q++++AR AL++ +     AN P  D  F   LE ++
Sbjct  179  QMTEDARRALNSVNF--GSANTPFNDGRFMPKLENAW  213

>PHYSO_560790
Length=237

 Score = 145 bits (367),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/236 (37%), Positives = 128/236 (54%), Gaps = 11/236 (5%)

Query  24   INLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYP  83
            +NL  ++         +S ++++ D+V PF Q  PTT  Q++A+KYKP++++  GCHPYP
Sbjct  1    MNLRPALLATLASFAYVSASVINHDQVVPFTQPTPTTALQQAAVKYKPQIHISNGCHPYP  60

Query  84   VVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWF  143
             V  NG+ S G+         C+GS  G+QIY R+  YQG +A +Y+WY+P     T   
Sbjct  61   AVDNNGNTSGGLNPTGSESAGCKGSGYGTQIYGRAVKYQGVYAFMYSWYMPKDETLTGL-  119

Query  144  VDGHRHFW--LWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKS  201
              GHRH W     V+W DS   D+ +I+A S S +      Y P  S YL    + K++ 
Sbjct  120  --GHRHDWEACNCVVWLDS--LDNPSIVALSAS-YHSTYLYYYPPDSDYL-DGNSAKIEY  173

Query  202  TESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLF  257
            + S +   H L  T   GE QDLI W+QL+D AR AL +    +  AN P ++  F
Sbjct  174  STSWVILDHSLSATSTAGETQDLIMWDQLTDAARTALEDTDFGD--ANVPFKEANF  227

>PHYKE_5655
Length=243

 Score = 145 bits (367),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 118/221 (53%), Gaps = 3/221 (1%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q  P T+S+++A+K+KP L +D GCH YP V     +S G++        C G
Sbjct  25   DKVQPFPQPDPVTVSEKTAVKFKPSLRIDSGCHSYPAVNAACEISGGLKGTGSDDGDCTG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y R+ WY   WA++Y+WY P  +   A F  G RH W+ VV+W + P  +   
Sbjct  85   SSLGSQVYGRAVWYNDLWAIMYSWYFPKDM-PVAIFKKGRRHDWVNVVVWLNDPAAEKPI  143

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTK-RVGEFQDLIT  226
            +L  S S +     KY P     L     +    +       H ++ T+ R GEFQDL+ 
Sbjct  144  MLGVSPSSYVSSYSKYTPPPVDGLNGMSCMINYLSNPYDHGYHTVDTTRNRGGEFQDLVM  203

Query  227  WEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            WEQL+D AR +L N     + A  P  D+ F   LEK++P+
Sbjct  204  WEQLTDAARISL-NETAFGETAQVPFIDENFVANLEKAWPY  243

>PYU1_G011230
Length=238

 Score = 145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 120/218 (55%), Gaps = 8/218 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V PF +  P++  ++ A+K+KP++++  GCHPYP V   G+ S G++        C+G
Sbjct  27   DQVVPFAEPTPSSAYEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAGCKG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  G+Q+Y R   Y G + ++Y+WY P     T     GHRH W  VV+W D+P   +  
Sbjct  87   SGWGTQVYGRGAAYNGVYGLMYSWYFPKDSPITGL---GHRHDWEHVVVWIDNPKAANPK  143

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S S      +KYAP K+   +   + KV  T S+I   H L+ T   GE Q LI W
Sbjct  144  ILAISPSAH-SGYQKYAPPKAG-TVDGTSAKVDYT-SKIVINHALDSTTAAGEKQPLIMW  200

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            EQ++  AR AL N    +  AN P++D  F + L K+Y
Sbjct  201  EQMTQAARTALENTGFGD--ANVPMKDGNFMDKLAKAY  236

>PHYRA_71307
Length=237

 Score = 145 bits (365),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 120/222 (54%), Gaps = 7/222 (3%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D+V PF Q  P T  Q  A+ +KP++Y++ GCHPYP V E+G+ S G++       
Sbjct  21   VIDHDQVVPFAQPTPNTTVQSVAVNFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSQSA  80

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C+GS  GSQIY R+  Y+G +A +Y+WY+P   D T   + GHRH W   V+W D    
Sbjct  81   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPK--DETLPGL-GHRHDWENCVVWLDDITL  137

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
            D+  I+A S S +      Y P  S YL    + K++ + S +   H L  T   GE QD
Sbjct  138  DEPNIVALSAS-YHSTYLYYYPPDSDYL-DGNSAKIEYSTSWVILDHSLSATSTSGETQD  195

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            LI W QL+D AR AL +       AN P ++  F   +  +Y
Sbjct  196  LIMWGQLTDAARTALEDTDF--GSANVPFKEGNFATKVANAY  235

>PHYRA_72390
Length=237

 Score = 144 bits (364),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 127/228 (56%), Gaps = 17/228 (7%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P TIS+++ +K+KP+L++ EGC  YP V   G  S G++        
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTGD-DSG  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSPDP  163
            C+    GSQ+Y R++WY   WA++Y WY P    D   ++    RH W  VV+W D+PD 
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDKCPYW----RHDWSNVVVWIDNPDV  136

Query  164  DDSTILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
            + S +L  S+S   ++   KYAP +S   I + T  +           GL     +G+FQ
Sbjct  137  ETSKVLGLSLSTSENKYGHKYAPAES---IRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  193

Query  223  DLITWEQLSDEARAALS---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             LI W+QL+D ARAAL+   NF R E     PI D  F E LEK++PF
Sbjct  194  GLIMWDQLADAARAALNDQDNFGRTEV----PISDDHFPEHLEKAWPF  237

>PHYSO_334498
Length=229

 Score = 144 bits (363),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 107/193 (55%), Gaps = 6/193 (3%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V PF Q +P TIS+++A+K+KP+L++  GCHPYP V E G    G+         C+G
Sbjct  28   DQVAPFAQPEPVTISEKAAVKFKPQLHISNGCHPYPAVNEAGDTDGGLSNTGAPSGKCKG  87

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS W++  W ++Y WY P  + S   F  GHRH W   VIW D+PD  +  
Sbjct  88   SGLGSQVYGRSGWHKDVWTIMYAWYFPKDMAS---FDLGHRHDWEHAVIWIDNPDVAEPK  144

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            IL  S S      +K   + +  L  + T  + + ES     H L  T + GE+Q LI W
Sbjct  145  ILGVSASSHAG-YEKVTTIPAGSL--NGTSVLLNYESTWPVDHELRFTTKGGEYQPLIMW  201

Query  228  EQLSDEARAALSN  240
             QL+D AR +LS 
Sbjct  202  TQLTDAARVSLST  214

>PPTG_15262
Length=233

 Score = 143 bits (360),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 130/219 (59%), Gaps = 12/219 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D++ PF Q  P TI+++ A+++KP+++ + GC+PYPVV  +G+  + +        SC G
Sbjct  23   DDIVPFAQPVPVTITEKRAVEFKPQVHTNGGCYPYPVVDTDGNTGDCLASSGPDSKSCNG  82

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
               GSQ+Y R+  +  KWA++Y WYLP    S  W ++  RH WL  ++W DS   +  T
Sbjct  83   PSVGSQVYGRAKRFTDKWAIMYAWYLPKI--SNGWGIE-SRHLWLETIVWLDSFVLESPT  139

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA +    G + +KY P  +  L +  ++K+  T + +   + L++T R+GE QDLI W
Sbjct  140  ILAVTTWHQG-KYQKYLPSLADTL-NGTSVKLDCTNT-LEYGYMLDVTNRIGETQDLIMW  196

Query  228  EQLSDEARAAL--SNFHRLEKRANPPIQDKLFYEVLEKS  264
             QL+D AR+AL  ++F+ L    + PI D  F E+LEK+
Sbjct  197  NQLTDAARSALQWTDFNGL----SAPISDGRFEELLEKA  231

>PITG_23094
Length=237

 Score = 142 bits (359),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 119/221 (54%), Gaps = 10/221 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEV PF +  PTT   + A+K+KP+L++  GCHPYP V  +G+ + G+     F  SCEG
Sbjct  25   DEVVPFPEVLPTTTENKVALKFKPQLHISSGCHPYPAVDADGNTNAGLGITKVFT-SCEG  83

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMA-LDSTAWFVDGHRHFWLWVVIWTDSPDPDDS  166
            SP+GSQ+Y R   Y+G  A++Y WY P   + S  W   GHRH W   ++W D       
Sbjct  84   SPQGSQVYGRMTEYEGVVAIMYAWYFPREFMVSPVWV--GHRHDWEHAIVWLDGLGTRAE  141

Query  167  TILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLIT  226
             +        G   K Y P K+K++    + K+K T   I+ +H L  T   GEFQDLI 
Sbjct  142  VLAVTVQQLLG--YKTYKPPKAKHM-DGSSAKIKYT-WLIQTQHYLSATTEAGEFQDLIM  197

Query  227  WEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            WE ++  A+ AL +       A  PI +  F + +EK+YPF
Sbjct  198  WENMTAAAQEALEDTKFFWSWA--PINEGQFQDNIEKAYPF  236

>PHYSO_365942
Length=233

 Score = 142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 119/227 (52%), Gaps = 16/227 (7%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P T+S+++A+K+KP L +  GCHPYP V   G  S G++ +      
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIVGGCHPYPAVNAAGETSAGLKGRGPKDGE  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y R+ WY+  WA++Y WY P      +    G RH W+  V+W D+P  +
Sbjct  61   CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDKGYGSILAKGQRHKWVSAVVWLDNPALE  120

Query  165  DSTILAAS---MSGFGDEIKKYAPLKSKYLIHDK-------TLKVKSTESRIRKK---HG  211
               ILA S   + G  D +K   P   +Y    K       T  + S E R R +   H 
Sbjct  121  TPKILAISTWNVEGGYDILKNEPPQCYRYSCDAKFAEYINMTTPMLSYE-RCRPEPSYHT  179

Query  212  LELT--KRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKL  256
            L  T  +  GE QDL+ WEQLS+EAR AL      EK   P I   L
Sbjct  180  LRPTTARGTGELQDLVMWEQLSEEARIALGEADFGEKSPVPFIDTNL  226

>PHYSO_490000
Length=241

 Score = 142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/237 (41%), Positives = 134/237 (57%), Gaps = 16/237 (7%)

Query  38   VLISPT---LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEG  94
            VL+ P    ++D D+V PF Q +PTTI+ ++A+K KPRL+++ GCH +P V  NG  S G
Sbjct  13   VLLKPIEAGIIDHDQVVPFPQSQPTTITNKAALKLKPRLFINNGCHLHPAVNANGDTSGG  72

Query  95   MQWKNYFRPSCEGSPRGSQI--YSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWL  152
            ++ K      C GS  GSQ+  Y RS WY G WA++Y WY P   D    F DGHRH W 
Sbjct  73   LKPKGSPEGGCRGSGSGSQVYRYGRSTWYNGVWAIMYAWYFPK--DEPTDF-DGHRHDWE  129

Query  153  WVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGL  212
             V++  ++P  ++ TILA + S        YAP  +  ++   + KV+ T S I   H L
Sbjct  130  HVIVRINNPVLENPTILAMTPSAHSG-YSTYAPPPAD-MVSGTSCKVEYTSSWIFIDHHL  187

Query  213  ELTKRVGEFQDLITWEQLSDEARAALS--NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            E T   GE QDLI W  L+D AR ALS  NF     +A+ P+ +  F   L K++P+
Sbjct  188  EGTSTAGETQDLIMWSDLTDAARYALSTTNF----GKADTPMNNGTFNWKLSKAWPW  240

>PHYSO_423056
Length=233

 Score = 142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 117/226 (52%), Gaps = 14/226 (6%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +P T+S+++A+K+KP L +D GCHPYP V   G  S G++        
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIDGGCHPYPAVNAAGETSAGLKGSGPDDGK  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+Y R+ WY+  WA++Y WY P           G RH W+  V+W D+P  +
Sbjct  61   CKGSGLGSQVYGRAIWYKDLWAIVYGWYFPKDKGFGGILAKGQRHKWVSAVVWLDNPAVE  120

Query  165  DSTILAAS---MSGFGDEIKKYAPLKSKYLIHDK-------TLKVKSTESRIRKK--HGL  212
               ILA S   + G    +K   P  S++    K       T  + S E   ++   H L
Sbjct  121  TPKILAISTWNLEGGYVILKNEPPECSRHGCDPKFAEYINMTTPMLSYEPYFQRDSFHTL  180

Query  213  ELT--KRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKL  256
              T  +  GE QDL+ WEQLS+EAR AL      EK   P I   L
Sbjct  181  RPTTARGTGELQDLVMWEQLSEEARIALGEADFGEKSPVPFIDTNL  226

>PPTG_11469
Length=253

 Score = 142 bits (359),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/246 (35%), Positives = 133/246 (54%), Gaps = 22/246 (9%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEG-CHPYPVVQENGSLSEGMQ  96
            V  +   +D D++QPF Q +P TIS+++AIK+KP+LY+ EG C  YP V + G  + G++
Sbjct  14   VTCAIATVDHDKIQPFPQPEPVTISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTGGLK  73

Query  97   WKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWF-VDGHRHFWLWVV  155
              N    +C+ +P GSQ+Y R+ WY+  WA++Y WY P       W      RH W  VV
Sbjct  74   GSN-GNDACKSAPLGSQVYGRAGWYKDVWAIMYAWYFPKGF----WVGFPTRRHDWKSVV  128

Query  156  IWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLK-------VKSTESRIRK  208
            +W D+PD +   I+  SMS    +  K   L +      + +           + + +R 
Sbjct  129  VWIDNPDLEVPKIVGVSMSKSDTKYDKRLELFASDFAGFQMMGQGRFRTYTYGSNTSLRF  188

Query  209  KHGLELTK-------RVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVL  261
             + +EL         R GE+QDLI WEQL+D ARAAL++ +  EK A  P  D+ + + L
Sbjct  189  GYQMELGSPYLNFGVRDGEYQDLIMWEQLTDAARAALNDDNNFEK-AEVPFSDEHYEDHL  247

Query  262  EKSYPF  267
            +K++P 
Sbjct  248  DKAWPL  253

>PPTG_15220
Length=236

 Score = 142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 123/224 (55%), Gaps = 10/224 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            ++ DEV PF +  PTT   + A+K+KP+L++  GCHPYP V  +G+ + G+        S
Sbjct  22   LEYDEVAPFPEVLPTTTESKVALKFKPQLHISNGCHPYPAVDADGNTNAGLGITEVLT-S  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMA-LDSTAWFVDGHRHFWLWVVIWTDSPDP  163
            C+GSP GSQ+Y R   Y+G  A++Y WY P   + S  W   GHRH W   ++W DS D 
Sbjct  81   CKGSPLGSQVYGRVTEYEGVVAIMYAWYFPRDYMVSPMWV--GHRHDWEHAIVWLDSLDT  138

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
                +   +    G   K Y P ++K++    ++K+K T   I+ +H L  T + G+FQD
Sbjct  139  SAELLAVTAQHLLG--YKTYKPPRAKHM-DGSSVKLKYTW-LIQTQHYLSATTKAGKFQD  194

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            L  W  ++D A+ AL +      +A  P+ D  F   +EK+YPF
Sbjct  195  LAMWSNMTDAAQDALGSTKFFWSQA--PMNDAKFQSNIEKAYPF  236

>PHYSO_365377
Length=220

 Score = 141 bits (355),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 122/225 (54%), Gaps = 9/225 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF +  P TIS+++AIK+KP L++ +GCHPY  V   G  S G+  K      
Sbjct  1    IDYDQVEPFPELGPKTISEKAAIKFKPTLFIKDGCHPYAAVNAAGDTSGGLDPKAS-DDE  59

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+GS  GSQ+YSRS WY+  WA +Y WY P     T  ++ G RH W+  ++W D+P   
Sbjct  60   CKGSTLGSQVYSRSTWYRNTWATMYAWYFPK---DTNLYLRGVRHDWVSAIVWLDNPALA  116

Query  165  DSTILAASMSGFGDEIKKYAPLKSKY---LIHDKTLKVKSTESRIRKK-HGLELTKRVGE  220
            + T++  S S  G     +   +S+     +     K++ + +  R   H ++ ++ VG+
Sbjct  117  NQTLIGVSFSSGGASYGGFHLDRSRMWDGYVDGTHPKMEYSAADTRSGYHTIDASEDVGD  176

Query  221  FQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            FQDLI W QL++EAR AL            P  +  F + LE+ +
Sbjct  177  FQDLIHWSQLTEEARNALET-GDFGSDTPVPFNNANFKKNLERGF  220

>PYIR_13275
Length=237

 Score = 142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 113/218 (52%), Gaps = 8/218 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V PF Q    T  Q+  +K+KP++++  GCHPYP V   G+ S G+         C+G
Sbjct  26   DAVVPFVQPTAVTTEQKLGVKFKPQIHISNGCHPYPAVDAAGNTSGGLNPTGSSDAGCKG  85

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  G+Q+Y R   Y G +A++Y+WY P     T     GHRH W  VV+W D+PD     
Sbjct  86   SGYGTQVYGRGVAYNGVYALMYSWYFPKDSPFTGL---GHRHDWEHVVVWIDNPDAASPV  142

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S S      +KYAP K+   +   + KV   +S +   H L+ T   GE Q LI W
Sbjct  143  ILAISPSAH-SGYEKYAPPKTD-TVDGNSAKVDY-KSIVVINHALDSTTTAGEQQPLIMW  199

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +QL+  AR AL N    +  AN P++D  F   +  +Y
Sbjct  200  DQLTAAARTALENTDFGD--ANVPMKDGNFMTKIANAY  235

>PYIR_13252
Length=236

 Score = 141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 118/218 (54%), Gaps = 8/218 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V+PF +  PTT +   A+K+KP++ +  GC PYP V   G+ S G++        C+G
Sbjct  25   DAVKPFAEPNPTTTTHRVALKFKPQINISNGCSPYPAVDSAGNTSGGLKPSGSQSAGCKG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  G+Q+Y R+  Y+  + ++Y+WY P     T     GHRH W  VV+W D+P+  +  
Sbjct  85   SGWGTQVYGRAAQYKDAYGIMYSWYFPKDSPLTGL---GHRHDWEHVVVWIDNPNAANPK  141

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            ILA S S       KYAP K+   +   + KV  T S++   H L+ T   GE Q LI W
Sbjct  142  ILAVSPSAH-SGYSKYAPPKAG-TVDGTSAKVDYT-SKVVINHALDSTTDAGEQQPLIMW  198

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +QL+  AR+AL N +  +  AN P++D  F   L  +Y
Sbjct  199  DQLTAAARSALENTNFGD--ANVPMKDGNFMNKLANAY  234

>PHYRA_86968
Length=239

 Score = 141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 122/224 (54%), Gaps = 7/224 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q  P TIS+++ +K+KP+L +  GC PYP V   G  S G++  N     
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPQLTIKAGCFPYPAVNAAGETSGGLK-GNGDELD  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  S  GSQ+Y R+ WY G WA++Y WY P     T   V   RH W   V+W D+P  +
Sbjct  81   CILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDT---VPYWRHDWSNAVVWIDNPALE  137

Query  165  DSTILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
            +  IL  S+S   ++    Y P+ ++ + +  T  +      +R    L L+   G  QD
Sbjct  138  NPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAE-LRLSTSRGPVQD  196

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            LI W QL+D ARAAL++      R + PI D  F ++LE+++PF
Sbjct  197  LIMWGQLTDAARAALNDQDNF-GRTDVPISDDHFPKLLEEAWPF  239

>PHALS_06084
Length=260

 Score = 142 bits (358),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 140/268 (52%), Gaps = 12/268 (4%)

Query  3    LRAIFFGGITILATSLVKA---HWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPT  59
            +  + F    +L  S+++A   +  NL V+   E+  A    P  +  D+V+ F Q KPT
Sbjct  1    MSIVSFFSFAVLMVSMIQAQTQNQENLKVTDQQEQLTADW-QPKTIPYDQVRGFRQPKPT  59

Query  60   TISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSD  119
            TISQ+ A+ +KP+L +  GC PYP V   G  S G+         C GS   SQ+Y RS 
Sbjct  60   TISQQVALTFKPQLDIVTGCLPYPAVNRLGETSGGLPKDADTETKCHGSQFNSQVYGRST  119

Query  120  WYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDE  179
            W+   W M+++WY P     + + + GHRH W  VVI+ DSP      IL  SMS +  E
Sbjct  120  WFNDVWVMMFSWYFP---KDSPFPLLGHRHDWENVVIFIDSPKVPLPKILGCSMS-YHSE  175

Query  180  IKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALS  239
              K+AP  + +  +  ++KVK  E      H L +T++ G FQDLI W QL    R +L+
Sbjct  176  YIKFAPCPT-FATNGTSVKVKY-EDSFPLNHALNVTEKEGTFQDLIMWNQLPPIVRKSLN  233

Query  240  NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            +       AN P+ D  F + +E+++PF
Sbjct  234  DTDF--GSANVPMNDWNFLKKVEEAWPF  259

>PPTG_13004
Length=255

 Score = 142 bits (357),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/242 (36%), Positives = 129/242 (53%), Gaps = 27/242 (11%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D V+PF Q +P T+ ++ A+K+KP L +D GC  +P V E G++S G++  N     
Sbjct  22   VDCDFVKPFAQPEPVTVLEKVALKFKPTLLIDGGCVSFPAVNEAGAISSGLRPLNG-NDG  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  +P+GSQ+Y RS  +Q KWA+++ WY P    S    +   RH W  +V+W D PD +
Sbjct  81   CIKAPQGSQVYGRSTQFQDKWAIMFAWYFPKGFWSG---MPSRRHDWASMVVWIDDPDFE  137

Query  165  DSTILAASMSGFGDE-IKKYAPLKSKYLI---------HDKTLKVKSTESRIRKKHG---  211
               +L  S+S       K  APL   Y           +   +   ST  RI    G   
Sbjct  138  TPKLLGVSLSKSKKRYTKATAPLSEVYFAGFQEYGRRGYKTYVNGSSTSIRISHSSGFFF  197

Query  212  ----LELTKRVGEFQDLITWEQLSDEARAAL--SNFHRLEKRANPPIQDKLFYEVLEKSY  265
                L+L+ R G++QDLI W+QL++EAR AL  +NF     ++  P  D  F ++LEK++
Sbjct  198  GPASLDLSTRDGDYQDLIMWKQLTEEARKALNSANFG----KSVVPFNDDNFEDMLEKAW  253

Query  266  PF  267
            PF
Sbjct  254  PF  255

>PHYRA_41766
Length=209

 Score = 140 bits (353),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 119/216 (55%), Gaps = 11/216 (5%)

Query  49   EVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGS  108
            EV+PF Q  P TIS+++ +K+KP++ +  GC PYP V   G  S G++     +  C GS
Sbjct  5    EVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGGCRGS  64

Query  109  PRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTI  168
              GSQ+Y RS W    W    +WY P    S+     GHRH W  VV++ D+PD  +  I
Sbjct  65   GHGSQVYGRSAWLNDVWX---SWYFPKDSPSSGM---GHRHDWEHVVVFIDNPDVAEPKI  118

Query  169  LAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWE  228
            +  S S   +  KKYAP    ++I   ++KV+   S     H L++T   G FQDLI W+
Sbjct  119  MGCSASSH-NGYKKYAPCP-PWVIDGTSVKVRYKHS-WPINHDLDVTGDAGTFQDLIMWD  175

Query  229  QLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKS  264
            Q++++AR AL+  H  +  AN P+ D  F   LEK+
Sbjct  176  QMTEDARRALNGVHFGD--ANTPMNDGNFIPKLEKA  209

>PHALS_05391
Length=242

 Score = 141 bits (355),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 121/220 (55%), Gaps = 8/220 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DE++P       ++    A+ + P L+V  GCHPYP V ++G +S G+   + F   C  
Sbjct  31   DEIEPLPVVARDSLINSIALNFHPMLFVSSGCHPYPAVDKHGYISNGLGVSHLFT-DCMD  89

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            SP+GSQ+Y R+  ++G  A++YTWY P    S  +++ GHRH W   + W  +   +   
Sbjct  90   SPKGSQVYGRAFEFKGHLAIMYTWYFPRDFMSAPFYI-GHRHGWEHAIFWFGAYRKNPRL  148

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            +     S FG   K YAP  S+ + H    K++ T + I   H L  ++R GEFQ+L+ W
Sbjct  149  LAVTVESTFG--YKTYAPPSSENM-HGDHFKLEYT-TLIVTHHYLTASERTGEFQNLVMW  204

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
              +++ AR +L+  H++    +PPI+D+ F+  L  S+PF
Sbjct  205  NSMNERARYSLN--HKVSHNFDPPIRDERFFHALRNSFPF  242

>PHYCA_108964
Length=277

 Score = 142 bits (358),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 137/265 (52%), Gaps = 49/265 (18%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D+VQPF Q +P TIS+++A+KYKP+L + + C  +P V   G ++ G++  +    
Sbjct  21   IIDHDKVQPFAQPEPVTISEKAAVKYKPQLVIFDSCVSFPAVNAVGDITGGLKGTSGTN-  79

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH-RHFWLWVVIWTDSPD  162
            +C  +P GSQ+Y RS WYQGKWAM++ WY P       W ++   RH W  +V+W D+P 
Sbjct  80   ACTEAPLGSQVYGRSTWYQGKWAMMFAWYFPKNF----WNLESRSRHLWANMVLWLDNPA  135

Query  163  PDDSTILAASMSGFGDEIKKY----------------APLKSKYLIHDKTLKV-------  199
             +  TIL AS+S    E+ K+                 P+     +  + ++        
Sbjct  136  LETPTILGASLSRQTLEVPKWLFIPSGVQQKDSYSKATPIPPMGFVGTQQIRTARIGRFQ  195

Query  200  --------KSTESRIRKKH-------GLELTKRVGEFQDLITWEQLSDEARAAL--SNFH  242
                     +  +R+ + +       GL+ T   G++QDLI W QL+D+ARAAL  ++F 
Sbjct  196  YTYNYTGGSTISTRVSQSYPDTSGWVGLDFTYLDGQYQDLIMWNQLTDQARAALESADFG  255

Query  243  RLEKRANPPIQDKLFYEVLEKSYPF  267
            R  K    P  DK F   L +++PF
Sbjct  256  RDTKV---PFNDKNFEAALAQAWPF  277

>PHYSO_255972
Length=215

 Score = 140 bits (352),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 115/231 (50%), Gaps = 32/231 (14%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQW  97
             ++    +D D+VQPF Q  P T+S+++A+K+KP L + +GCHPYP V   G  S G++ 
Sbjct  15   TIVGGVTIDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKH  74

Query  98   KNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIW  157
                   C+GS  GSQ+Y RS WY+  WA++Y+WY P   D    +  G RH W+  V+W
Sbjct  75   TGPVDGKCKGSGLGSQVYGRSGWYKDLWAIMYSWYFPK--DKHLGY-KGQRHKWVDAVVW  131

Query  158  TDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLEL--T  215
             D+P  +   +LA S   +G     +                          H LE+  T
Sbjct  132  LDNPAFETPKVLAVSTWSWGGGYTSF--------------------------HTLEMTST  165

Query  216  KRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYP  266
            +  GE QDLI WEQLS EAR ALS      + A  P  D  F   LE + P
Sbjct  166  RGTGELQDLIMWEQLSPEARTALSE-TDFGEAAKVPFIDANFETNLELARP  215

>PHYRA_72385
Length=237

 Score = 140 bits (354),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 116/218 (53%), Gaps = 7/218 (3%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V PF Q  PTT  Q + IK+KP++++  GCHPYP V E G+ S G++        C+G
Sbjct  25   DQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYPAVDEAGNTSGGLKPTGSSSAGCKG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQIY R   Y+G +A++Y+WY P     T     GHRH W  VV+W D    D  +
Sbjct  85   SGYGSQIYGRITTYEGVYALMYSWYFPKDSPVTGL---GHRHDWEHVVVWVDDITLDSPS  141

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            I+A S S        Y P  +   I   + KV  + S +   H L+ T   GE QDLI W
Sbjct  142  IIAVSPSAHSGYNIYYPPESNT--IDGYSAKVDYSSSWVVVNHALDSTSDSGESQDLIMW  199

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +QL+D AR AL N    +  AN P++D  F   L  +Y
Sbjct  200  DQLTDAARTALENTDFGD--ANVPMKDGNFLTKLGNAY  235

>PHYSO_526541
Length=239

 Score = 140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 119/240 (50%), Gaps = 26/240 (11%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQW  97
             ++    +D D+VQPF Q  P T+S+++A+K+KP L + +GCHPYP V   G  S G++ 
Sbjct  15   TIVGGVTIDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKH  74

Query  98   KNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIW  157
                   C+GS  GSQ+Y RS WY+  WA++Y+WY P           G RH W+  V+W
Sbjct  75   TGPVDGKCKGSGLGSQVYGRSGWYKDLWAIMYSWYFP---KDKHLGYKGQRHKWVDAVVW  131

Query  158  TDSPDPDDSTILA---------ASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRK  208
             D+P  +   +LA         +    F + +    P+ S    + +T            
Sbjct  132  LDNPAFETPKVLANVPQRCEHGSCGKAFAEFMNNTTPMISYRPFYMET-----------S  180

Query  209  KHGLEL--TKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYP  266
             H LE+  T+  GE QDLI WEQLS EAR ALS      + A  P  D  F   LE + P
Sbjct  181  FHTLEMTSTRGTGELQDLIMWEQLSPEARTALSE-TDFGEAAKVPFIDANFETNLELARP  239

>PHYRA_75425
Length=237

 Score = 140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 123/222 (55%), Gaps = 7/222 (3%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            ++D D V PF Q  PTT  Q  A+K+KP++Y++ GCHPYP V E+G+ S G++       
Sbjct  21   VIDHDAVVPFAQPTPTTTLQTLAVKFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSQSS  80

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C GS  GSQIY R+  Y+G +A +Y+WY+P   D T   V GHRH W   V+W D    
Sbjct  81   GCTGSSLGSQIYGRAVEYEGVYAFMYSWYMPK--DETLDGV-GHRHDWENCVVWLDDITL  137

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
            D+  I+A S S +      Y P  S YL  D + K++ + S +   H L  T   GE QD
Sbjct  138  DEPNIVALSAS-YHSTYLYYYPPDSDYLDGD-SAKIEYSTSWVLLDHSLSATSTSGETQD  195

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            LI W+QL+D AR AL +    +  AN P ++  F   L  +Y
Sbjct  196  LIMWDQLTDAARTALEDTDFGD--ANVPFKEANFETKLANAY  235

>PPTG_13026
Length=238

 Score = 140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 117/224 (52%), Gaps = 8/224 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D ++V P  Q  P+T +Q++AIK+KPRL +  GC  +P V   G  S G+Q        
Sbjct  22   VDFNKVVPIAQPSPSTSAQKAAIKFKPRLSITNGCVSFPAVNSAGETSSGLQEGYRGSSG  81

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  +P GSQ+Y R+ WY G +A+LYTWY P    +        RH W   V+W D+P+  
Sbjct  82   CTNAPLGSQVYGRTTWYNGTFAILYTWYFPKGFWNE---YATRRHDWASAVVWIDNPELA  138

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHG-LELTKRVGEFQD  223
              +IL  S+S    + K +AP  S   I D T    +    + K +  L  T  VG+FQ+
Sbjct  139  SPSILGLSVSTADWKFKTFAPASSG--ITDGTTPRLAHVLNVEKGYPYLTTTDTVGDFQE  196

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            LI W+QL+  AR AL+        A  P+ D  F   L+K++PF
Sbjct  197  LIMWDQLTTAARTALNTTDF--GVAKVPVSDAAFDTKLKKAWPF  238

>PHYSO_334500
Length=235

 Score = 139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/242 (38%), Positives = 129/242 (53%), Gaps = 9/242 (4%)

Query  24   INLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYP  83
            +NL   V        L+S  ++D D V PF Q  PTT  Q  A+K+KP++Y+  GCHPYP
Sbjct  1    MNLRAIVATTVGSLALVSGAVIDHDTVVPFAQPTPTTTLQTLAVKFKPQIYIANGCHPYP  60

Query  84   VVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWF  143
             V E+G+ S G++          GS  GSQIY R+  Y+G +A +Y+WY+P   D T   
Sbjct  61   AVDEDGNTSGGLKPTGSESSGYTGSSLGSQIYGRAVEYEGVYAFMYSWYMPK--DETLPG  118

Query  144  VDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTE  203
            + GHRH W   V+W DS   DD +I+A S S +      Y P  S YL    + K++ + 
Sbjct  119  L-GHRHDWEACVVWLDS--LDDPSIVALSAS-YHSTYLTYYPPDSDYL-DGNSAKIEYST  173

Query  204  SRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEK  263
            S +   H L  T   GE QDLI W+QL+D AR AL +       AN P ++  F   + K
Sbjct  174  SWVILDHSLSATSTAGETQDLIMWDQLTDAARTALEDTDF--GSANVPFKEANFATKVAK  231

Query  264  SY  265
            +Y
Sbjct  232  AY  233

>PHYRA_52960
Length=223

 Score = 139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 119/218 (55%), Gaps = 7/218 (3%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V PF Q  PTT  Q+ A+K KP++Y+  GCHPYP V E+G+ S G++        C G
Sbjct  12   DAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSGCIG  71

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQIY R   Y+G +A +Y+WY+P   D T   + G+RH W   V+W  +   ++  
Sbjct  72   SRLGSQIYGRVAKYRGVYAFMYSWYMPK--DQTLPGL-GYRHDWEACVVWISNITLEEPN  128

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            I+A S+S +    + Y PL   YL  D + K++ + S +   H L  T   GE QDLI W
Sbjct  129  IVALSVS-YHSTYQTYYPLDKDYLEGD-SAKIEYSTSWVVLDHSLSATSTPGETQDLIMW  186

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +QL+  AR AL +      R   P +D  F E L K+Y
Sbjct  187  DQLTAAARTALEDTDFGGARV--PFKDANFKEKLAKAY  222

>PHYRA_52955
Length=223

 Score = 139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 119/218 (55%), Gaps = 7/218 (3%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V PF Q  PTT  Q+ A+K KP++Y+  GCHPYP V E+G+ S G++        C G
Sbjct  12   DAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSGCIG  71

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQIY R   Y+G +A +Y+WY+P   D T   + G+RH W   V+W  +   ++  
Sbjct  72   SRLGSQIYGRVAKYRGVYAFMYSWYMPK--DQTLPGL-GYRHDWEACVVWISNITLEEPN  128

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            I+A S+S +    + Y PL   YL  D + K++ + S +   H L  T   GE QDLI W
Sbjct  129  IVALSVS-YHSTYQTYYPLDKDYLEGD-SAKIEYSTSWVVLDHSLSATSTPGETQDLIMW  186

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            +QL+  AR AL +      R   P +D  F E L K+Y
Sbjct  187  DQLTAAARTALEDTDFGGARV--PFKDANFKEKLAKAY  222

>PHYRA_45457
Length=199

 Score = 138 bits (347),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 103/192 (54%), Gaps = 8/192 (4%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V PF +  P TIS+++ +K+KP+L++  GCH YP V E G    G++        C+G
Sbjct  15   DQVIPFAEPAPVTISEKAGVKFKPQLHISNGCHSYPAVNEAGDTGGGLKTSGAPSSKCKG  74

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQIY RS W+   WA++Y WY P  + ST     GHRH W   VIW D+PD  +  
Sbjct  75   SGYGSQIYGRSGWHSDVWAIMYAWYFPKDMASTTL---GHRHDWEHAVIWIDNPDVAEPK  131

Query  168  ILAASMSGFGDEIKKYA-PLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLIT  226
            IL  S+S      K    P+ S       T  + + ES     H L LT + G+ Q LI 
Sbjct  132  ILGVSVSSHSGYAKTTTIPVGSLV----GTTVLINYESFWPLDHELSLTTKGGDLQPLIM  187

Query  227  WEQLSDEARAAL  238
            W QL+D AR +L
Sbjct  188  WSQLTDAARNSL  199

>PHALS_08445
Length=242

 Score = 139 bits (351),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 122/222 (55%), Gaps = 12/222 (5%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D + P    KP       A++++P L +  GCHPYP V +NG +S G+   ++F   C G
Sbjct  31   DSLVPVLPSKPNCRINSIALQFQPELNIKHGCHPYPAVDDNGYISSGLGVSHFFT-DCMG  89

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTD--SPDPDD  165
            SP+GSQ+Y R+  Y+G  A++Y WY P    +T +++ GHRH W   ++W    +  P+ 
Sbjct  90   SPKGSQVYGRAFVYRGYLAIMYAWYFPRDYVATPFWI-GHRHGWEHAILWFGGMTEKPEL  148

Query  166  STILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLI  225
              + A S+ G+    + YAP +SK++  D+  K+K T   +  +H L  T   GE Q L+
Sbjct  149  LAVTAKSLIGY----RTYAPPQSKHMDKDR-FKLKYTWMGV-TQHYLSATTSPGELQSLV  202

Query  226  TWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             W+ L D+ARA+L    R      PP+ D  F+  L K+YPF
Sbjct  203  MWDDLPDKARASLKP--RSWSHFKPPLADNRFFRALRKAYPF  242

>PHYCA_129892
Length=234

 Score = 139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 125/228 (55%), Gaps = 9/228 (4%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQW  97
              ++  ++D D+V PF Q  PTT  Q  A++YKP++Y+  GCHPYP V E+G+ S G++ 
Sbjct  14   ACVNAAVIDHDQVVPFAQPTPTTTLQTLAVQYKPQIYIANGCHPYPAVDEDGNTSGGLKP  73

Query  98   KNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIW  157
                   C+GS  GSQIY R+  Y+G +A +Y+WY+P   D T   + GHRH W   V+W
Sbjct  74   TGSQSAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPK--DETLPGL-GHRHDWEACVVW  130

Query  158  TDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKR  217
             DS +  +   L+AS   +      Y P  S YL    + K++ + S +   H L  T  
Sbjct  131  LDSLENPNVVALSAS---YHSTYLTYYPPDSGYL-DGNSAKIEYSTSWVILDHSLSATST  186

Query  218  VGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
             GE QDLI W+QL+D AR AL +    +  AN P +D  F   L  +Y
Sbjct  187  SGETQDLIMWDQLTDAARTALEDTDFGD--ANVPFKDANFETKLANAY  232

>PHYCA_69457
Length=213

 Score = 138 bits (347),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 125/221 (57%), Gaps = 8/221 (4%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            ++ D+V+PF Q +P TIS+++ +K+KP++ V  GC PYP V E G  S G++     R  
Sbjct  1    INHDQVKPFPQPEPVTISEKAGVKFKPQIQVRTGCEPYPAVNEFGETSGGLKPTGNPRGG  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C GS  GSQ+Y RS W +G WA++Y+WY P    S      GHRH W   +++ D+PD  
Sbjct  61   CGGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDSPSPGL---GHRHDWEHAIVFIDNPDVP  117

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA S+S      KKY P    ++I   +LKV+   S     H L+ T   G FQDL
Sbjct  118  EPKILACSVSSHSG-YKKYNPC-PPWVIDGTSLKVRYKHS-WPTNHDLDTTGDGGSFQDL  174

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            I W Q++++AR AL++ +     AN P  D  F   LE ++
Sbjct  175  IMWNQMTEDARRALNSVNF--GSANTPFNDGKFMPKLENAW  213

>PHYCA_109095
Length=277

 Score = 140 bits (352),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/261 (33%), Positives = 133/261 (51%), Gaps = 49/261 (19%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q  P TIS+++A+KYKP+L + + C  +P V   G ++ G++  +    +C  
Sbjct  25   DKVQPFAQPDPVTISEKAAVKYKPQLVIFDSCVSFPAVNAAGDITGGLKGTSG-TDACTK  83

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH-RHFWLWVVIWTDSPDPDDS  166
            +P GSQ+Y RS WYQGKWAM++ WY P       W ++   RH W  +V+W D+P  +  
Sbjct  84   APLGSQVYGRSTWYQGKWAMMFAWYFPKNF----WNLESRSRHLWANMVLWLDNPALETP  139

Query  167  TILAASMSGFGDEIKKY----------------APLKSKYLIHDKTLKV-----------  199
            TIL AS+S    E+ K+                 P+     +  + ++            
Sbjct  140  TILGASLSRQTLEVPKWLFIPSGVQQKNSYSKATPIPPMGFVGTQQIRTARIGRFQYTYN  199

Query  200  ----KSTESRIRKKH-------GLELTKRVGEFQDLITWEQLSDEARAAL--SNFHRLEK  246
                 +  +R+ + +       GL+ T   G++QDLI W QL+D+ARAAL  ++F R  K
Sbjct  200  YTGGSTISTRVSQSYPDTSGWVGLDFTYLDGQYQDLIMWNQLTDQARAALESADFGRDTK  259

Query  247  RANPPIQDKLFYEVLEKSYPF  267
                P  DK F   L +++PF
Sbjct  260  V---PFNDKNFEAALAQAWPF  277

>PHYRA_72531
Length=236

 Score = 138 bits (348),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/225 (37%), Positives = 119/225 (53%), Gaps = 18/225 (8%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q +  TI+++S +K+KP+L ++ GC PYP V   G  SEG++    F   C  
Sbjct  25   DKVQPFPQPEAVTITEKSGVKFKPQLDIEYGCSPYPAVNAAGETSEGLETNGVF--DCII  82

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSPDPDDS  166
                SQ+Y R++WY   WA++Y WY P    D T W+    RH W   V+W D+P  +  
Sbjct  83   PSLSSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTPWW----RHDWSNAVVWIDNPAHEKP  138

Query  167  TILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLI  225
             +L  S+S   ++    Y P +    I + T    S      +   L      GEFQDL+
Sbjct  139  KVLGLSLSTSENKYGNTYVPAEG---IENGTTPTLSRNVLPMRSAALGPAVNPGEFQDLV  195

Query  226  TWEQLSDEARAALS---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             W+QL+D ARAAL+   NF R E     PI D  F + L+K++PF
Sbjct  196  MWDQLTDAARAALNDQDNFGRTEV----PISDDHFPKHLKKAWPF  236

>PYVX_22469
Length=474

 Score = 143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 113/195 (58%), Gaps = 6/195 (3%)

Query  44   LMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRP  103
            +++ D V  F Q  PTT S+E AI YKP+LY+  GCHPYP V  +G+ S G++       
Sbjct  21   VINHDAVAAFAQPSPTTTSEEIAITYKPQLYIANGCHPYPAVDADGNTSGGLKPTGAQDS  80

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C+GS  G+QIY R+  Y G +A++Y+WY+P   DS    + GHRH W  VV+W DS   
Sbjct  81   DCKGSALGTQIYGRATEYNGVYAIMYSWYMPK--DSPLSGL-GHRHEWENVVVWLDSATA  137

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
               +I+A S S  G+      P  S   ++  + KVK  ES++   H L++T   GE Q 
Sbjct  138  SSPSIVAVSPSAHGNYHIYNPPSSSN--VNGTSAKVK-YESQVVINHSLDITTVSGETQP  194

Query  224  LITWEQLSDEARAAL  238
            LI +EQLS+ AR AL
Sbjct  195  LILYEQLSEAARQAL  209

 Score = 138 bits (347),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 128/259 (49%), Gaps = 15/259 (6%)

Query  12   TILATSLVKAHWINLNVSVYPEKPGAVLIS--PTLMDVDEVQPFYQRKPTTISQESAIKY  69
            T    +L  A  I + +S       A L S    ++D D V PF Q  P T  Q +A+K+
Sbjct  224  TTFTANLALASPIQMKLSALFGLAAASLFSTDAAVIDHDAVVPFAQPTPNTTEQSAAVKF  283

Query  70   KPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLY  129
            KP LY+D GCHPYP V E+G+ S G++        C GS  GSQIY R   Y G WA++Y
Sbjct  284  KPTLYIDNGCHPYPAVDEDGNTSGGLKPTGSTTGGCTGSSLGSQIYGRVMEYDGVWAIMY  343

Query  130  TWYLPMALDSTAWFVDGHRHFWLWVVIWTD---SPDPDDSTILAASMSGFGDEIKKYAPL  186
            +WY+P   D  + ++ GHRH W   VIW D   S  P    I A+  SG+    K Y P 
Sbjct  344  SWYMPK--DEPSPYI-GHRHDWENAVIWVDDITSASPSIVAISASEHSGY----KVYYPP  396

Query  187  KSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEK  246
             + Y     T K+K         H L  T   GE QDLI W+QL+  A+ AL +      
Sbjct  397  SADYY-SGYTAKIKYESVFFLVDHCLYATSTAGETQDLIMWDQLTAAAQTALEDTDF--G  453

Query  247  RANPPIQDKLFYEVLEKSY  265
             AN P ++  F   + K+Y
Sbjct  454  SANVPFKEANFATKVAKAY  472

>PITG_22709
Length=281

 Score = 139 bits (349),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 136/271 (50%), Gaps = 48/271 (18%)

Query  36   GAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGM  95
            G + +   L   D+VQPF Q KP TIS+++A+KY+P+L+V +GC  +P V   G ++ G+
Sbjct  20   GTINLKHLLQHHDQVQPFAQPKPATISEKAAVKYRPQLHVLDGCASFPAVNAAGDITGGL  79

Query  96   QWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH---RHFWL  152
            +        C  +P GSQ+Y RS WYQ +WAM++ WY P        F+ G    RH+W+
Sbjct  80   K-PTKGTDGCTEAPLGSQMYGRSKWYQDRWAMMFAWYFPKG------FITGQPRIRHYWM  132

Query  153  WVVIWTDSPDPDDSTILAASMS----------GF-----GDEIKKYAPLKSKYLIHDKTL  197
             +V+W D+P  +  TIL AS+S          G       D  +K+  +     +  K +
Sbjct  133  NMVLWLDNPALETPTILGASLSQRLLKPRRWMGLKLTEEKDPYRKFTTIPPIGFVGTKEI  192

Query  198  ---KVKSTESRIRKKHGLELTKRV------------------GEFQDLITWEQLSDEARA  236
               ++  T      + G  ++ RV                  G++ DLI W+QL+DEARA
Sbjct  193  RQNRLTRTRWNFTYEGGSNISTRVFTVIDSKDWLPLTFSYYDGQYHDLIMWDQLTDEARA  252

Query  237  ALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            AL++    E +   P  D+ F  +L  ++PF
Sbjct  253  ALNSADFGESKV--PFNDENFEALLSLAWPF  281

>PHYRA_71310
Length=237

 Score = 137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 115/218 (53%), Gaps = 7/218 (3%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V PF Q  PTT  Q + IK+KP++++  GCHPYP V E G+ S G++        C+G
Sbjct  25   DQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYPAVDEAGNTSGGLKPTGSSSAGCKG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQIY R   Y+G +A++Y+WY P     T     GHRH W  VV+W D    D  +
Sbjct  85   SGYGSQIYGRITTYEGVYALMYSWYFPKDSPVTGL---GHRHDWEHVVVWVDDITLDSPS  141

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITW  227
            I+A S S        Y P  +   I   + KV  + S +   H L+ T   GE QDLI W
Sbjct  142  IIAVSPSAHSGYNIYYPPESNT--IDGYSAKVDYSSSWVVVNHALDSTSDSGESQDLIMW  199

Query  228  EQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
             QL+D AR AL N    +  A+ P++D  F   L  +Y
Sbjct  200  GQLTDAARTALGNTDFGD--AHVPMKDGNFLTKLGNAY  235

>PHYSO_336498
Length=238

 Score = 137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 118/223 (53%), Gaps = 6/223 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q  P TIS+++A+K+KP+L +++GC  +P V   G  S G++  N    +
Sbjct  22   IDHDKVEPFPQPDPVTISEKAAVKFKPQLLIEDGCVSFPAVNAAGETSGGLK-GNSGNSA  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+ +P GSQ+Y R+ WY+  WA++Y WY P         V   R  W   V+W D+PD  
Sbjct  81   CDSAPLGSQVYGRAMWYKDVWAIMYAWYFPKGFFVG---VASRRFDWSSAVVWIDNPDFA  137

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
               IL  S S   D+ +   P     ++   T  +  + SR   +  L  + R G+ Q L
Sbjct  138  APKILGISTSTSDDDYETKTPAPDYAILDGTTTLLFRSTSREAGQPKLYYSSRTGDSQPL  197

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            I WEQL + AR AL+        A  PI D  F + L+K++PF
Sbjct  198  IMWEQLPEAARLALNTTDF--GLAYVPINDDTFEKKLKKAWPF  238

>PHYSO_480321
Length=254

 Score = 137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/235 (35%), Positives = 115/235 (49%), Gaps = 25/235 (11%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q  P TIS++ A+K+KP L + E CHPYP V   G  S G++ +      C G
Sbjct  27   DKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESKCRG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y R+ W++G WA++Y WY P   DS + F  G RH W   V+W D+P      
Sbjct  87   SELGSQVYGRATWHKGMWAIMYAWYFPK--DSVSKF--GQRHKWNAAVVWLDNPAIVKPE  142

Query  168  ILAASMSGFGD--EIKKYAPLKSKY--------------LIHDKTLKVKSTESRIRKKHG  211
            ILA S  G     +I+  +     Y               I+  T  ++    +I     
Sbjct  143  ILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPGKIASGLM  202

Query  212  LELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYP  266
                +  GEFQDLI WEQL++ AR+AL+           P  D+ F   L+ + P
Sbjct  203  TTTNRGRGEFQDLIMWEQLTEAARSALT-----AADFGAPFVDEAFKSNLDSARP  252

>PHYSO_482931
Length=254

 Score = 137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/235 (35%), Positives = 114/235 (49%), Gaps = 25/235 (11%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q  P TIS++ A+K+KP L + E CHPYP V   G  S G++ +      C G
Sbjct  27   DKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESKCRG  86

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y R+ W++G WA++Y WY P   DS + F  G RH W   V+W D+P      
Sbjct  87   SELGSQVYGRATWHKGMWAIMYAWYFPK--DSVSKF--GQRHKWNAAVVWLDNPAIVKPE  142

Query  168  ILAASMSGFGD--EIKKYAPLKSKY--------------LIHDKTLKVKSTESRIRKKHG  211
            ILA S  G     +I+  +     Y               I+  T  ++    +I     
Sbjct  143  ILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPGKIASGLM  202

Query  212  LELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYP  266
                +  GEFQDLI WEQL++ AR+AL+           P  D  F   L+ + P
Sbjct  203  TTTNRGRGEFQDLIMWEQLTEAARSALT-----AADFGAPFVDGAFKSNLDSARP  252

>PHYCA_109089
Length=277

 Score = 137 bits (346),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/263 (33%), Positives = 131/263 (50%), Gaps = 43/263 (16%)

Query  42   PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYF  101
            P  ++ D+VQPF Q +P TIS+++A+K+KP++++ +GC P+P V   G +S G+    Y 
Sbjct  21   PVTINHDQVQPFAQPEPVTISEKAAVKFKPQIHITDGCVPFPAVNAAGEVSGGLNPTKY-  79

Query  102  RPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSP  161
               C  SP GSQ+Y R+ WY+  WA++Y WY P      A+F  G RH W  +V+W D+P
Sbjct  80   TDGCTESPMGSQVYGRASWYRDHWAIMYAWYFPKNF--RAFFARG-RHGWANMVLWLDNP  136

Query  162  DPDDSTILAASMSGFGDEIKK--YAPLKSK------------------------------  189
              ++  +L AS+S    + +K  + PL  +                              
Sbjct  137  ALENQKLLGASLSQQTLKAEKILFIPLDEREKEPYQKFNGIPPMGFVGMQEIRHTQLSRW  196

Query  190  --YLIHDKTLKVKSTESRIRKKHG---LELTKRVGEFQDLITWEQLSDEARAALSNFHRL  244
                 ++    V +    +  K     L    R GE+QDLI WEQL+DEARA L++    
Sbjct  197  SWNYTYEGGSNVSTRVIHMMDKFDWIHLSFLGRDGEYQDLIMWEQLTDEARAGLNSADFG  256

Query  245  EKRANPPIQDKLFYEVLEKSYPF  267
            +  A  P  D  F   LEK++PF
Sbjct  257  DTFA--PFTDDNFKTALEKAWPF  277

>PHYCA_109192
Length=278

 Score = 137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 126/265 (48%), Gaps = 46/265 (17%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            T +D D+VQPF Q  P T+S+++A+KYKP+L +  GC  +P V   G ++ G++      
Sbjct  20   TTIDHDKVQPFKQPDPVTVSEKAAVKYKPQLVIGSGCVSFPAVNAAGDITGGLKGTKS-T  78

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH-RHFWLWVVIWTDSP  161
              C  +P GSQ+Y RS WYQ KWAM++ WY P       W  +G  RH W  +V+W D+P
Sbjct  79   DGCTEAPLGSQVYGRSTWYQDKWAMMFAWYFPKNF----WGGEGESRHLWSNMVVWIDNP  134

Query  162  DPDDSTILAASMS-------------GFGDE----IKKYAPLKSKYLIHDKTLKV-----  199
              +   IL AS+S                D      KK   +   + +  + ++      
Sbjct  135  ALETPKILGASLSRQTLDPPKALFLFSLADRQKVPYKKVTGIDPMHFVGMQAIQTGRIGR  194

Query  200  ----------KSTESRIRKKH-------GLELTKRVGEFQDLITWEQLSDEARAALSNFH  242
                       +T +R+           GLE     GE+QDLI W QL+D+ARA L +  
Sbjct  195  YRYTYNYTGGSNTSTRVYHGFPDSSAWIGLEFVNVNGEYQDLIMWNQLTDQARATLESAD  254

Query  243  RLEKRANPPIQDKLFYEVLEKSYPF  267
              EK    P  DK F   L +++PF
Sbjct  255  FGEK-TKVPFNDKNFEAALAQAWPF  278

>PHYRA_39489
Length=237

 Score = 136 bits (342),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 120/222 (54%), Gaps = 7/222 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q  P TIS+++ +K+KP+L +  GC PYP V   G  S G++  N     
Sbjct  22   VDHDKVQPFPQPAPVTISEKAXVKFKPQLTIKAGCFPYPAVNAAGETSGGLK-GNGDELD  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  S  GSQ+Y R+ WY G WA++Y WY P     T   V   RH W   V+W D+P  +
Sbjct  81   CILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDT---VPYWRHDWSNAVVWIDNPALE  137

Query  165  DSTILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223
            +  IL  S+S   ++    Y P+ ++ + +  T  +      +R    L L+   G  QD
Sbjct  138  NPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAE-LRLSTSRGPVQD  196

Query  224  LITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            LI W QL+D ARAAL++      R + PI D  F ++LE+++
Sbjct  197  LIMWGQLTDAARAALNDQDNF-GRTDVPISDDHFPKLLEEAW  237

>PPTG_10591
Length=254

 Score = 137 bits (344),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 126/247 (51%), Gaps = 24/247 (10%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEG-CHPYPVVQENGSLSEGMQ  96
            V+ +   +D D+VQ F Q +P T S+++AIK+KPRLY     C PYP V   G +S G++
Sbjct  15   VVCTAVTIDHDKVQAFPQPEPVTASEKTAIKFKPRLYTPRHVCVPYPAVNAAGEVSGGLK  74

Query  97   WKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVD--GHRHFWLWV  154
              N    +C+ S +GSQ+Y R+ WY+  WA++YTWY P       +F D    RH W  V
Sbjct  75   GTN-GNDACKYSIQGSQVYGRAGWYRDLWAIMYTWYFP-----KGFFADFASKRHDWQNV  128

Query  155  VIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYL--------------IHDKTLKVK  200
            V+W ++PD +   I+  SMS    E      + + Y               I+     ++
Sbjct  129  VVWINNPDLEWPKIVGVSMSNVDSEYTTKLEMMAYYFSGYRMEGTRGYRRSIYGSATSLR  188

Query  201  STESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEV  260
                 I     L+     GE+Q LI WEQL+D ARAAL++    E+R   P  D+ + + 
Sbjct  189  FAYEMILTSPYLDFADEDGEYQSLIMWEQLTDAARAALNDSSNFEER-EIPFSDEHYMDH  247

Query  261  LEKSYPF  267
            LE ++P 
Sbjct  248  LEMAWPL  254

>PITG_23076
Length=276

 Score = 137 bits (345),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 129/266 (48%), Gaps = 50/266 (19%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            + +D D+VQPF Q  P TIS+++A+K+KP+L++D GC  +PVV   G +S G++      
Sbjct  20   SAIDHDKVQPFAQPDPVTISEKAAVKFKPQLHIDRGCVSFPVVNAAGEISGGLK-GTKGT  78

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH---RHFWLWVVIWTD  159
              C  SP GSQ YSRS WYQ +WA+++ WY P        F  G    RH+W  +V+W D
Sbjct  79   DGCRESPLGSQTYSRSAWYQDRWAIVFAWYFPKG------FAAGQPRIRHYWSSMVLWID  132

Query  160  SPDPDDSTILAASMSG------------FGDEIK----KYAPLKSKYLIHDKTLKVK---  200
            +P  D  TIL  S+S             F  E++    K   +     +  +   V    
Sbjct  133  NPALDTPTILGVSLSQQLLKPAKFLIGLFTAELQEPYNKQTSIPPAGFVGAQATVVSQIN  192

Query  201  ----------STESRIRKKH---------GLELTKRVGEFQDLITWEQLSDEARAALSNF  241
                       +   IR  H          L    + GE+ DL+TW+QL++EARAAL++ 
Sbjct  193  GWSNPSNYSGGSNVSIRVSHTYTNKDDWLALTFATQDGEYHDLVTWDQLTEEARAALNSA  252

Query  242  HRLEKRANPPIQDKLFYEVLEKSYPF  267
               E +   P  D+ F   LE S+ F
Sbjct  253  DFGESKV--PFSDQNFQRTLELSWLF  276

>PPTG_18463
Length=254

 Score = 136 bits (343),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 124/239 (52%), Gaps = 22/239 (9%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            ++ D VQPF Q  P TIS+++AIK+KP+L++ +GC  +P V   G  + G+         
Sbjct  22   INRDLVQPFAQPGPVTISEKAAIKFKPQLFILDGCVSFPAVNAAGDTTGGLN-GTQGGEG  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  +P GSQ+Y RS WYQ KWAM++ WY+P +  +    +   RH W  +V+W ++P  +
Sbjct  81   CSKAPLGSQVYGRSTWYQDKWAMMFAWYIPKSYMAA---ITSRRHDWASMVVWIENPSLE  137

Query  165  DSTILAASMSGFGDEIKKYAPLK-----SKYLIHDK-----------TLKVKSTESRIRK  208
               IL  S+S   +   +Y         S Y+   +           +L+V+ T  +  +
Sbjct  138  IPEILGVSLSNSANGYLRYTGNIYDWNFSGYVARSRRRDRDIPGSSTSLRVEHTVRKDFR  197

Query  209  KHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
               L L +  G++QDLI W QL++EAR AL+       R+  P  D  F   L ++YPF
Sbjct  198  SAFLNLAQTDGDYQDLIMWGQLTEEARMALNTTDF--GRSKVPFNDGNFLIKLRQAYPF  254

>PHYSO_496064
Length=254

 Score = 136 bits (342),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/234 (36%), Positives = 123/234 (53%), Gaps = 13/234 (6%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q +PTT+S+++A+K+KP + +  GCHPYP V   G  S G++        
Sbjct  22   IDHDKVQPFAQPEPTTVSEKAAVKFKPSIRIRSGCHPYPAVNAAGETSGGLKPSGEPDGD  81

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C+ S  GSQ+Y R+ WY+  WA++YTWY P     T +F  G RH W   ++W D+P  +
Sbjct  82   CKNSSLGSQVYGRAVWYKDLWAIMYTWYFPKDSYGT-FFRSGQRHKWASFIVWLDNPSLE  140

Query  165  DSTILAASMSGFGDE---IKKYAPLKSKYLIH----DKTLKVKSTESRIRKKHG--LELT  215
               ILA S S    E   +K   P   +        D      +  + +   +G  LE+T
Sbjct  141  KPKILAVSTSFQTGEYQILKNGPPACGRRSCSPPFTDYINGTSAMLAYLDTFYGSILEMT  200

Query  216  --KRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
              +  GE QDLI WEQL++EA+ AL N     ++A  P  D      LE++  F
Sbjct  201  TARTGGELQDLIMWEQLTEEAQIAL-NETDFGEKARVPFIDANLNANLEQTRSF  253

>PHYSO_521124
Length=254

 Score = 136 bits (342),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 125/242 (52%), Gaps = 20/242 (8%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGM--  95
            V     ++D D+VQPF + +P TIS+++AIKYKP L + +GCH Y  V   G  S GM  
Sbjct  4    VAAQGAVIDYDKVQPFPELEPKTISEKAAIKYKPSLAIWDGCHSYAAVNAAGDTSGGMDP  63

Query  96   -------QWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH-  147
                   Q +N +   C GS  GSQ+YSRS WY+  WA++Y WY P  +   +W+ +   
Sbjct  64   KAPDGGTQVQNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDI---SWYEESSP  120

Query  148  --RHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESR  205
              RH W+  ++W D+P  ++ ++L  S S  G     Y P    Y+              
Sbjct  121  PVRHDWINTIVWLDNPALENPSLLGVSASREGAVYVTYPPTVKGYMNGTHPKMEYYLGFI  180

Query  206  IRKKHGLELTKRVGEFQDLITWEQLSDEARAAL--SNFHRLEKRANPPIQDKLFYEVLEK  263
            +   H ++++   G+FQDL+ W QL+D+AR AL  ++F  +      P  D  F + LE+
Sbjct  181  VGGYHTIDVSLEAGDFQDLVHWSQLTDQARKALETADFGVVTPV---PFNDVNFEKNLER  237

Query  264  SY  265
             +
Sbjct  238  GW  239

>PHYSO_328418
Length=219

 Score = 134 bits (338),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 113/206 (55%), Gaps = 12/206 (6%)

Query  62   SQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWY  121
             Q++A+K+KP+L +   CHPY  V  +G +S G+  + + R +C GS  G+QIY+RS W+
Sbjct  26   GQKAAVKFKPQLKLSNTCHPYAAVDAHGYISGGLNSELHIRNNCGGSDLGAQIYARSAWH  85

Query  122  QGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIK  181
               WA +Y WY P   ++      G R  W++ +IW   P      ++ A++    D+ +
Sbjct  86   SDVWATVYAWYFPKNSNNGG----GPRSLWMYAIIWVGGPGVGAPEVVGATLK-TDDDTE  140

Query  182  KYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNF  241
            K+AP+ + Y I   + + K T +    K  L  TK+ G +QDLITWEQL + AR  L+ +
Sbjct  141  KHAPVDADY-IDGTSFECKFTYNFWTTKAKLTATKKTGGYQDLITWEQLPEVARTGLAGY  199

Query  242  HRLEKRANPPIQDKLFYEVLEKSYPF  267
                  A+ P+ +  F E+L   +PF
Sbjct  200  ------ADMPLLNGTFEELLTNGWPF  219

>PHYSO_527850
Length=195

 Score = 133 bits (334),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 105/201 (52%), Gaps = 32/201 (16%)

Query  5    AIFFGGITILATSLVKAHWINLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTTISQE  64
            AI    +   AT+  + +WIN                      DEVQPF + +P   S++
Sbjct  1    AILLAAVACFATAQAEVNWINH---------------------DEVQPFPELEPVGASEK  39

Query  65   SAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGK  124
            +A+K+KP+L +  G H YP V+ +G++S G++W       C+GS  GSQ+Y+RSDWYQGK
Sbjct  40   AAVKFKPQLQISYGFHTYPAVRRDGAVSNGLKWGGKPDGECKGSAWGSQVYTRSDWYQGK  99

Query  125  WAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYA  184
            WA++Y WY P A       +  HRH WL++V+W D+P+  +  +L   +   G   ++  
Sbjct  100  WAIMYAWYFPKAWQEND--LISHRHLWLYIVVWIDNPEAVNPAVLGVYVRTAGGSERRAP  157

Query  185  P---------LKSKYLIHDKT  196
            P         LKS+Y    KT
Sbjct  158  PDAKFFEGSSLKSEYYKSGKT  178

>PHYRA_72403
Length=239

 Score = 134 bits (338),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 125/235 (53%), Gaps = 29/235 (12%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVD--EGCHPYPVVQENGSLSEGMQWKNYFR  102
            +D D+VQPF Q  P TI+++S +K+KP L++D   GC  YP V   G  S G++      
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLK-GTKGT  80

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSP  161
             +C G   GSQ+Y R++W+   WA++Y WY P    DS A++    RH W   V+W D P
Sbjct  81   SACTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGFWDSRAYW----RHDWSNAVVWIDDP  136

Query  162  DPDDSTILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV--  218
              ++  +L  S+S   ++   KY P ++        L+  +T S  R     E  + V  
Sbjct  137  ALENPKVLGLSLSTSENKYGHKYVPAEA--------LRNGTTPSLYRMMPTYECAELVPY  188

Query  219  ---GEFQDLITWEQLSDEARAALS---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
               GE QDLI W+QL+D ARAAL+   NF R E     PI D  F + LEK++P 
Sbjct  189  YASGEVQDLIMWDQLTDAARAALNDQDNFGRTEV----PINDDHFLKHLEKAWPL  239

>PPTG_17453
Length=254

 Score = 134 bits (338),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/250 (34%), Positives = 137/250 (55%), Gaps = 26/250 (10%)

Query  37   AVLIS--PTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYV-DEGCHPYPVVQENGSLSE  93
            A L+S     +D D+++PF Q +P TIS+++A+K+KP+LY  +  C PYP V   G ++ 
Sbjct  12   AALLSCASATVDHDKIEPFPQPEPATISEKAAVKFKPQLYTPNSVCVPYPAVNVAGEVAG  71

Query  94   GMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMA--LDSTAWFVDGHRHFW  151
            G++  N    +C+ +P+GSQIY R+ WY   WA++Y WY P    +DS +      RH W
Sbjct  72   GLKGTN-GNDACKYAPKGSQIYGRAGWYNDLWAIMYAWYFPKGFWMDSPS-----RRHDW  125

Query  152  LWVVIWTDSPDPDDSTILAASMSG----FGDEIKKYAPLKSKYLIHDKTLK---VKSTES  204
              VV+W D+P+     I+  SMS     +  E K +    + Y +  +      +  + +
Sbjct  126  KSVVVWIDNPESQTPKIVGVSMSKSDTRYNKETKTWPSNFAGYRMEGRRYHRTYIYGSNT  185

Query  205  RIRKKHGLELTKRV-------GEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLF  257
             +R ++  +L           GE+QDLI WEQL+D ARAAL++ +     A  P  D+ +
Sbjct  186  SLRFQYQSDLGSPYLNFGDWEGEYQDLIMWEQLTDAARAALNDGNNFGD-AEVPFSDEHY  244

Query  258  YEVLEKSYPF  267
             + L+K++PF
Sbjct  245  EKHLDKAWPF  254

>PHYRA_72430
Length=238

 Score = 134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 111/229 (48%), Gaps = 6/229 (3%)

Query  39   LISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWK  98
            L +   +D  +V P  Q  P+T +++  +K+KP+L + +GC  +P V   G  + G++  
Sbjct  16   LATAGSIDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEG  75

Query  99   NYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWT  158
            +     C  +P GSQ+Y RS WY GK+A+LY WY P    +    V   RH W   V+W 
Sbjct  76   DSGGIGCSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWAN---VATRRHDWASAVVWI  132

Query  159  DSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV  218
            D PD    +IL  S+S      K  AP  S  +    T ++       +    L  T   
Sbjct  133  DRPDAASPSILGLSISTADWVYKTQAPASSG-ITGGTTARLSHGLQAEKGPAYLTTTDST  191

Query  219  GEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            G  QDLI WEQLS  AR ALS        A  P+ D  F   L+K++PF
Sbjct  192  GSPQDLIMWEQLSSAARTALSTTDF--GNAKVPMSDANFQTKLKKAWPF  238

>PHYRA_72306
Length=238

 Score = 134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 111/229 (48%), Gaps = 6/229 (3%)

Query  39   LISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWK  98
            L +   +D  +V P  Q  P+T +++  +K+KP+L + +GC  +P V   G  + G++  
Sbjct  16   LATAGSIDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEG  75

Query  99   NYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWT  158
            +     C  +P GSQ+Y RS WY GK+A+LY WY P    +    V   RH W   V+W 
Sbjct  76   DSGGIGCSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWAN---VATRRHDWASAVVWI  132

Query  159  DSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV  218
            D PD    +IL  S+S      K  AP  S  +    T ++       +    L  T   
Sbjct  133  DRPDAASPSILGLSISTADWVYKTQAPASSG-ITGGTTARLSHGLQAEKGPAYLTTTDST  191

Query  219  GEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            G  QDLI WEQLS  AR ALS        A  P+ D  F   L+K++PF
Sbjct  192  GSPQDLIMWEQLSSAARTALSTTDF--GNAKVPMSDANFQTKLKKAWPF  238

>PPTG_04799
Length=245

 Score = 134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 133/252 (53%), Gaps = 15/252 (6%)

Query  24   INLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLY--VDEGCHP  81
            + L V V       V  + T +D D+++PF Q KP T+S+++AIK+KP+L+  +   C P
Sbjct  1    MKLGVFVTTLFAALVACAATTIDHDKIEPFPQPKPVTMSEKAAIKFKPQLFTSIKTVCAP  60

Query  82   YPVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTA  141
            +P V   G ++ G++  N    +C  + +GSQ+Y R+ W++  WA++Y WY P       
Sbjct  61   FPAVNAAGDVTGGLKGTNG-NDACRFARKGSQVYGRAGWHKDMWAIMYAWYFPKGF----  115

Query  142  WF-VDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEI---KKYAPLKSKYLIH--DK  195
            W      RH W  VV+W D+PD +   I+A SMS  G       +   L S+   +  D+
Sbjct  116  WMDFPTRRHDWKNVVVWIDNPDLESPKIVAVSMSKSGRSYHTEDQSGGLISRSFFNGFDR  175

Query  196  TLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDK  255
            T      ++ +   + L      GE+QDLI WEQL+D AR AL++ +     A  P  D 
Sbjct  176  TSLRFHYQTDLGSPY-LNFAWWGGEYQDLIMWEQLTDPARVALNDIYNFGD-AEVPFSDN  233

Query  256  LFYEVLEKSYPF  267
             F + L+K++PF
Sbjct  234  NFEDYLDKAWPF  245

>PHYRA_52426
Length=152

 Score = 131 bits (329),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 5/147 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D +++QPF + +PTT S+++A+K+KP+L V  GC+PYP VQ +GS+S G++        
Sbjct  1    IDNEKIQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C GS  GSQ+YSRSDWY+ KWA++YTWYLP    +        RHFW   V+W D P   
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGCPTKY----QRRHFWETAVVWIDDPALA  116

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYL  191
            +STIL  S++ +G   K+  P+  ++L
Sbjct  117  NSTILGVSLN-YGWRSKEETPVAPRFL  142

>PHYRA_72477
Length=238

 Score = 133 bits (335),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 119/231 (52%), Gaps = 22/231 (10%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q  P TIS+++ +K+KP L++  GC  YP V   G  S G++        
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTSG  81

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSPDP  163
            C   P GSQ+Y R+ WY   WA++Y WY P    D++ ++    RH W   V+W D+P  
Sbjct  82   CALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPFW----RHDWSNAVVWIDNPAL  137

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTE-SRI---RKKHGLELTKRVG  219
            ++   L  S+S       KY    S Y   D     K+   SR     +   L      G
Sbjct  138  ENPKALGLSIS---RSENKYG---STYTEEDGFENGKTPNLSRYVPPMEAATLSTGYDSG  191

Query  220  EFQDLITWEQLSDEARAALS---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            EFQDLI W+QL+D ARAAL+   NF R E     PI D  F + LE+++PF
Sbjct  192  EFQDLIMWDQLTDAARAALNDQDNFGRTEV----PISDDHFPKRLEEAWPF  238

>PHYSO_330015
Length=241

 Score = 133 bits (335),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 117/229 (51%), Gaps = 10/229 (4%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            +    +D D+VQPF Q  P T+S+++A+KYKP L + + CHPYP V   G  S G++   
Sbjct  19   VGGATIDHDKVQPFPQPGPVTVSEKAAVKYKPNLLILDACHPYPAVNAAGETSGGLKGTG  78

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVD-GHRHFWLWVVIWT  158
                +C+GS  GSQ+Y R+ W+   WA++Y WY P  +     F D G RH W+  V+W 
Sbjct  79   KRDGACKGSGLGSQVYGRAGWHDDMWAIMYAWYFPKDVYYRGTFSDKGFRHNWVNAVVWL  138

Query  159  DSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGL-ELTKR  217
            D+P  +        + G+    ++ +P  + Y      + V   E+   +   L + T  
Sbjct  139  DNPALETPRYSPCRLRGY----QECSPPFTGYFNGTSAMLVY--EANGEEPSALSQNTLG  192

Query  218  VGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYP  266
             GE QDLI WEQL+ EAR ALS     E +   P  D  F   L+ + P
Sbjct  193  GGELQDLIMWEQLTVEARDALSTTDFGETKV--PFIDANFNANLKAARP  239

>PPTG_11475
Length=270

 Score = 133 bits (335),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 128/229 (56%), Gaps = 23/229 (10%)

Query  37   AVLISPTL--MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEG-CHPYPVVQENGSLSE  93
            A L++  +  +D D+++PF Q +P TIS+++AIK+KP+LY+ EG C  YP V + G  + 
Sbjct  11   AALVTCVIATVDHDKIKPFPQPEPATISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTG  70

Query  94   GMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHR-HFWL  152
            G++  N    +C+ +P GSQ+Y R+ WY+  WA++Y WY P       W     R H W 
Sbjct  71   GLKGTN-GNDACKYAPLGSQVYGRAGWYKDVWAIMYAWYFPKGF----WMNFPSRCHDWK  125

Query  153  WVVIWTDSPDPDDSTILAASMS----GFGDEIKKYAPLKSKYLIHDKTLK---VKSTESR  205
             VV+W D+PD +   IL  SMS     +  E K +    + Y    +      +  + S 
Sbjct  126  SVVVWIDNPDLEMPKILGVSMSKGDTDYRKETKTWPSSFAGYRTEGRRFHRTYIYGSNSS  185

Query  206  IRKKHGLELTKRV-------GEFQDLITWEQLSDEARAALSNFHRLEKR  247
            +R ++ +E++          GE+QDLI WEQL+D ARAAL++ + L KR
Sbjct  186  LRFEYHVEMSSPYLNFAVWDGEYQDLIMWEQLTDPARAALNDGNNLRKR  234

>PPTG_05581
Length=275

 Score = 133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 131/260 (50%), Gaps = 43/260 (17%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            ++ D+VQPF Q  P TIS+++A+KY+P+L+V +GC  +P V   G ++ G++        
Sbjct  22   INHDQVQPFAQPDPVTISEKAAVKYRPQLHVKDGCASFPAVNAAGDITGGLK-PTKETDG  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  +P GSQ+Y RS WYQ +WAM++ WY P    ++   +   RH+W+ +V+W D+P  +
Sbjct  81   CAEAPLGSQMYGRSKWYQDRWAMMFAWYFPKGFITSQPRI---RHYWMSMVLWLDNPALE  137

Query  165  DSTILAAS---------------MSGFGDEIKKYAPLKSKYLIHDKTL---KVKSTESRI  206
               +L AS               M+G  D  +K+  +     +  + +   ++  T    
Sbjct  138  TPKVLGASLSQQLLKPRRWMGFNMAGDKDPYQKFTSVPPIGFVGTQEIRQNRITRTRWNF  197

Query  207  RKKHGLELTKRV-------------------GEFQDLITWEQLSDEARAALSNFHRLEKR  247
              + G  ++ RV                   G++ DLI WEQL+DEARAAL++    E +
Sbjct  198  TYEGGSNISTRVSTIMVDSFGWLPLTFSYRDGQYHDLIMWEQLTDEARAALNSADFGESK  257

Query  248  ANPPIQDKLFYEVLEKSYPF  267
               P  D+ F   L  ++PF
Sbjct  258  V--PFNDENFETSLGLAWPF  275

>PHYCA_124383
Length=280

 Score = 133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 127/265 (48%), Gaps = 44/265 (17%)

Query  41   SPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNY  100
            + + +D D+V+PF Q +P TIS+++A+KYKP L + +GC  +P V   G ++ G++    
Sbjct  22   TTSTIDHDQVKPFRQPEPVTISEKAAVKYKPLLSIGDGCVSFPAVNTAGEITGGLKGTKN  81

Query  101  FRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDS  160
             +  C  +P GSQ+Y RS WYQ KWAM+YTWY P    +   +    RH W  VV+W D+
Sbjct  82   TK-DCTEAPLGSQVYGRSAWYQDKWAMMYTWYFPKNFCA---YKAAGRHDWANVVVWIDN  137

Query  161  PDPDDSTILAASMS-------------------------------GFGDEIKKYAPLKSK  189
            P  +++T L AS+S                                F    +    +  +
Sbjct  138  PALENATFLGASLSQQTLEPIKLVFLALAQRKEEPYENQKEIPMMAFAGTEQIATAMVGR  197

Query  190  YLIHDKTLKVKSTESRIRKKH-------GLELTKRVGEFQDLITWEQLSDEARAALSNFH  242
            +    K +   +T  R   K+       G+      GE QDLI W QL+D+ARAAL +  
Sbjct  198  WSYIYKYVGGSNTTMRFIHKYPQKFAWIGMSFAYSDGESQDLIMWNQLTDKARAALESAD  257

Query  243  RLEKRANPPIQDKLFYEVLEKSYPF  267
                +   P  DK F   L+ ++PF
Sbjct  258  FGNTQV--PFTDKNFETNLQAAWPF  280

>PHYRA_47103
Length=226

 Score = 132 bits (331),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 110/215 (51%), Gaps = 18/215 (8%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q +  TI+++S +K+KP+L ++ GC PYP     G  SEG++    F   C  
Sbjct  25   DKVQPFPQPEAVTITEKSGVKFKPQLDIEXGCSPYPAANAAGETSEGLETNGAF--DCII  82

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSPDPDDS  166
               GSQ+Y R++WY   WA++Y WY P    D T W+    RH W   V+W D+P  +  
Sbjct  83   PSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTPWW----RHDWSNAVVWIDNPAHEKP  138

Query  167  TILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLI  225
             +L  S+S   ++    Y P +    I + T    S      +   L      GEFQDL+
Sbjct  139  KVLGLSLSTSENKYGNTYVPAEG---IENGTTPTLSRNVLPMRSAALGPAVNPGEFQDLV  195

Query  226  TWEQLSDEARAALS---NFHRLEKRANPPIQDKLF  257
             W QL+D ARAAL+   NF R E     PI D  F
Sbjct  196  MWTQLTDAARAALNDQDNFGRTEV----PISDDHF  226

>PHYRA_52427
Length=124

 Score = 129 bits (323),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 4/128 (3%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF + +PTT S+++A+K+KP+L V  GC+PYP VQ +GS+S G++        
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C GS  GSQ+YSRSDWY+ KWA++YTWYLP    +        RHFW   V+W D P   
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRSTR----HQRRHFWETAVVWIDDPALA  116

Query  165  DSTILAAS  172
            +STIL  S
Sbjct  117  NSTILGVS  124

>PHYCA_544885
Length=256

 Score = 132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 129/238 (54%), Gaps = 24/238 (10%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDE-GCHPYPVVQENGSLSEGMQWKNYFRPSCE  106
            D+++PF Q +P T+S+++AIK+KP+LY  +  C P+P V   G ++ G++  N     C+
Sbjct  25   DQIEPFPQPEPVTVSEKAAIKFKPQLYTPKIVCVPFPAVNAAGEVTGGLKGTN-GNDGCK  83

Query  107  GSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVD-GHRHFWLWVVIWTDSPDPDD  165
             +P+G+QIY R+ WY+  WA++Y+WY P       WF     RH W  VV+W D+PD + 
Sbjct  84   YAPKGAQIYGRAGWYKDLWAIMYSWYFPKGF---GWFDSPTRRHDWKNVVVWIDNPDLET  140

Query  166  STILAASMS----GFGDEIKKYAPL------------KSKYLIHDKTLKVKSTESRIRKK  209
              I+  +MS     +  E+K +               + +YL  + +L+ +   S I   
Sbjct  141  PKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYLGSNTSLRFEYDTSDIGNP  200

Query  210  HGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
              +      GE+QDLI WEQL+D AR AL++     K A  P  D+ + + L K++PF
Sbjct  201  L-MHFAAWDGEYQDLIMWEQLTDAARVALNDGKSFGK-AEVPFNDEHYEDHLGKAWPF  256

>PHYRA_83851
Length=239

 Score = 132 bits (332),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 121/228 (53%), Gaps = 21/228 (9%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            DEVQPF Q  P TIS+++ +K+KP+L+ + GC  YP V   G  S G++  N     CE 
Sbjct  25   DEVQPFPQPDPVTISEKAGVKFKPQLHFEGGCAAYPAVNAAGETSGGLK-GNGDISGCEI  83

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH-RHFWLWVVIWTDSPDPDDS  166
            S  GSQ+Y RS+WY   WA++Y WY P       W  D H RH W   V+W D+P  ++ 
Sbjct  84   SLLGSQVYGRSEWYNDVWAIMYAWYFPKGF----WDADPHWRHDWSNAVLWIDNPALENP  139

Query  167  TILAASMSGFGDEI---KKYAP-LKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQ  222
             IL  S+S   ++      Y+P + S      + L   ++ + +      ++  R  E Q
Sbjct  140  KILGLSLSTSENKYHTKNTYSPTINSTAPALCRDLPSVASAALVSS----DVCGRPLETQ  195

Query  223  DLITWEQLSDEARAALS---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            DLI W QL+D ARAAL+   NF R E     PI D  F + LE+++P 
Sbjct  196  DLIMWGQLTDAARAALNDQDNFGRTEV----PISDDHFPKHLEEAWPL  239

>PHYCA_10570
Length=278

 Score = 133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/262 (32%), Positives = 125/262 (48%), Gaps = 44/262 (17%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q  P T+S+++A+KYKP+L +  GC  +P V   G ++ G++        
Sbjct  22   IDHDKVQPFKQPDPVTVSEKAALKYKPQLVIGGGCVSFPAVNAAGDITGGLKGTKS-TDG  80

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  +P GSQ Y RS WYQ KWAM++ WY P             RH W  +V+W D+P  +
Sbjct  81   CTEAPLGSQAYGRSTWYQDKWAMMFAWYFPKNFWGGG---ADSRHLWSNMVVWIDNPSLE  137

Query  165  DSTILAASMSGFGDEIKK---YAPLKSKYLI-HDKTLKVK--------------------  200
               IL  S+S    ++ K     PL ++  + + K   +K                    
Sbjct  138  TPKILGVSLSQQTIDVPKLFYMFPLVNRQKVPYKKVTAIKPMDFAGMQAIKTGRIGRHRY  197

Query  201  --------STESRIRKK-------HGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLE  245
                    +T +R+          HGL+     GE+QDLI W QL+D+AR+AL +    E
Sbjct  198  TYNYTGGSTTSTRVYNGYTDQSGWHGLDFVNADGEYQDLIMWNQLTDQARSALESADFGE  257

Query  246  KRANPPIQDKLFYEVLEKSYPF  267
            K    P  DK F   L +++PF
Sbjct  258  K-TKVPFDDKNFEAALTQAWPF  278

>PHYRA_72541
Length=239

 Score = 131 bits (330),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/235 (37%), Positives = 124/235 (53%), Gaps = 29/235 (12%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVD--EGCHPYPVVQENGSLSEGMQWKNYFR  102
            +D D+VQPF Q  P TI+++S +K+KP L++D   GC  YP V   G  S G++      
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLK-GTKGT  80

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSP  161
             +C G   GSQ+Y R++W+   WA++Y WY P    DS A++    RH W   V+W D P
Sbjct  81   SACTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGFWDSRAYW----RHDWSNAVVWIDDP  136

Query  162  DPDDSTILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV--  218
              ++  +L  S+S   ++   KY P ++        L+  +T S  R     +  + V  
Sbjct  137  ALENPKVLGLSLSTSENKYGHKYVPAEA--------LRNGTTPSLYRMMPTYKCAELVPY  188

Query  219  ---GEFQDLITWEQLSDEARAALS---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
               GE QDLI W QL+D ARAAL+   NF R E     PI D  F + LEK++P 
Sbjct  189  YASGEVQDLIMWGQLTDAARAALNDQGNFGRTEV----PINDDHFLKHLEKAWPL  239

>PITG_16866
Length=238

 Score = 131 bits (330),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 114/219 (52%), Gaps = 8/219 (4%)

Query  48   DEVQPFYQ-RKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCE  106
            D V PF Q    TT  Q++ IK+KP++++  GCHPYP V  +G+ S G+         C+
Sbjct  25   DAVIPFAQPTTTTTTEQKAGIKFKPQIHISNGCHPYPAVDADGNTSGGLNPTGSSSAGCK  84

Query  107  GSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDS  166
            GS  GSQIY R   Y G +A++Y+WY P     T     GHRH W  VV+W D    +  
Sbjct  85   GSGYGSQIYGRVATYNGVFAIMYSWYFPKDSPLTGL---GHRHDWEHVVVWVDDIKLNSP  141

Query  167  TILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDLIT  226
            +++A S S        Y P +S   I   + KV  + S +   H L+ T   GE Q+LI 
Sbjct  142  SVIAVSPSAH-SGYNIYHPPESN-TIDGYSTKVDYSSSWLVINHALDSTTDAGETQNLIM  199

Query  227  WEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
            W+QL+D AR AL N    +  AN P++D  F   +  +Y
Sbjct  200  WDQLTDAARTALENTDFGD--ANVPMKDGNFLTKVGNAY  236

>PHYKE_208
Length=187

 Score = 130 bits (326),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 87/141 (62%), Gaps = 4/141 (3%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V PF Q + TTIS+++A+K+KP+++V  GCHPYP V   G  S G++       SC+G
Sbjct  25   DQVVPFAQPEATTISEKAAVKFKPQIHVTNGCHPYPAVNSAGDTSGGLKPTGAPSGSCKG  84

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
            S  GSQ+Y RS WY G+WA++Y+WY P    ST     GHRH W  VV+W D+PD ++ T
Sbjct  85   SGYGSQVYGRSTWYSGRWAIMYSWYFPKDSPSTGL---GHRHDWEHVVVWIDNPDVENPT  141

Query  168  ILAASMSGFGDEIKKYAPLKS  188
            IL  S S       KY P  S
Sbjct  142  ILGVSPSAH-SGYSKYVPPSS  161

>PHYCA_109162
Length=257

 Score = 132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/261 (29%), Positives = 139/261 (53%), Gaps = 21/261 (8%)

Query  24   INLNVSVYPEKPGAVLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEG-CHPY  82
            +NL++ V       V  +P ++D D+++PF Q +P T+S+++AIK+KP+LY  +  C P+
Sbjct  1    MNLHLLVVTVFVALVTGTPAIVDHDKIEPFPQPEPVTVSEKAAIKFKPQLYTHKQLCAPF  60

Query  83   PVVQENGSLSEGMQWKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAW  142
            P V   G ++ G+   N    +C+ + +G+Q+Y R+ WY+  WA++Y+WY P   +   W
Sbjct  61   PAVNAAGEVTGGLSGAN-GNDACKYALKGAQVYGRAGWYKDVWAIMYSWYFPKGFN---W  116

Query  143  F-VDGHRHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKT-----  196
                  RH W  VV+W D+P+ +   I+  +M+G   + ++   + +   +  +      
Sbjct  117  LGFPTRRHDWKNVVVWIDNPELETPKIIGVAMAGSDTKYRREREMYNSNFVGSQVQVTRR  176

Query  197  ------LKVKSTESRIRKKHG---LELTKRVGEFQDLITWEQLSDEARAALSNFHRLE-K  246
                       + + +R ++G   L+  ++ G++QDLI WEQL+D AR AL++       
Sbjct  177  DRRYYRSDSPGSSTNLRFENGATHLDFARQDGDYQDLIMWEQLTDAARIALNDNGSFGYS  236

Query  247  RANPPIQDKLFYEVLEKSYPF  267
             A  P  D+ F    +K++P 
Sbjct  237  YAEVPFSDEHFEANRDKAWPL  257

>PHYRA_76657
Length=239

 Score = 131 bits (330),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 123/235 (52%), Gaps = 29/235 (12%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVD--EGCHPYPVVQENGSLSEGMQWKNYFR  102
            +D D+VQPF Q  P TI+++S +K+KP L +D   GC  YP V   G  S G++      
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELKIDTEHGCVSYPAVNSAGETSGGLK-GTKGT  80

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSP  161
             +C G   GSQ+Y R++WY   WA++Y WY P    +  A++    RH W   V+W D P
Sbjct  81   SACTGPILGSQVYGRAEWYNDVWAIMYAWYFPKGFWNRRAYW----RHDWSNAVVWIDDP  136

Query  162  DPDDSTILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIR-----KKHGLELT  215
              ++  +L  S+S   ++   KY P ++        L+  +T S  R     K   L L 
Sbjct  137  ALENPKVLGLSLSTSENKYGHKYVPAEA--------LRNGTTPSLYRMMPTYKCAALALY  188

Query  216  KRVGEFQDLITWEQLSDEARAALS---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
               G+ QDLI W QL+D ARAAL+   NF R E     PI D  F + LEK++PF
Sbjct  189  YASGDVQDLIMWGQLTDAARAALNDQDNFGRTEV----PINDDHFLKHLEKAWPF  239

>PHYSO_514298
Length=264

 Score = 132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 112/213 (53%), Gaps = 15/213 (7%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQ-  96
            V     ++D D+VQPF + +P TIS+++AIKYKP L + +GC  Y  V   G  S GM  
Sbjct  15   VAAQAAVIDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDP  74

Query  97   --------WKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH-  147
                     KN +   C GS  GSQ+YSRS WY+  WA++Y WY P  +   +W+   + 
Sbjct  75   MAPDGGTVEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDI---SWYEASYP  131

Query  148  --RHFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESR  205
              RH W+  ++W ++P  ++ ++L  S S    E   Y P   +++              
Sbjct  132  PVRHDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFY  191

Query  206  IRKKHGLELTKRVGEFQDLITWEQLSDEARAAL  238
            +   H ++++   G+FQDL+ W QL+D+AR AL
Sbjct  192  VGGYHTIDVSLDAGDFQDLVHWSQLTDQARKAL  224

>PPTG_08703
Length=254

 Score = 131 bits (330),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 129/246 (52%), Gaps = 22/246 (9%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDE-GCHPYPVVQENGSLSEGMQ  96
            +  +   +D D+++P  Q +P TISQ++AIK+KP+LY  E  C  +P V   G ++ G++
Sbjct  15   IACASATVDHDKIEPIPQPEPVTISQKAAIKFKPQLYTSEIACVSFPAVNAAGEVTGGLK  74

Query  97   WKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWF-VDGHRHFWLWVV  155
              N    +C+ +P+GSQ+Y R+ WY+  WA++Y WY P       W      RH W  VV
Sbjct  75   GTN-GNDACKYAPKGSQVYGRAGWYKDLWAIMYAWYFPKGF----WMDFPTRRHDWKNVV  129

Query  156  IWTDSPDPDDSTILAASMS----GFGDEIKKYAPLKSKYLI-----HDKTLKVKSTESRI  206
            +W D+PD +   I+  SMS     +  E K +A   + Y +     H   +   +T  R 
Sbjct  130  VWIDNPDLETPKIVGVSMSKSDKKYFKETKIWASNFAGYRMEGRRYHRTYIYGSNTSLRF  189

Query  207  RKKHGL-----ELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVL  261
            + +  L        +  GE+QDLI WEQL+D  R AL++     K A  P  D+ F + L
Sbjct  190  QYQTTLGSPYMNFARWDGEYQDLIMWEQLTDVVRVALNDSKNFGK-AEVPFSDEHFEDHL  248

Query  262  EKSYPF  267
            +K++P 
Sbjct  249  DKAWPL  254

>PHYCA_124462
Length=280

 Score = 132 bits (332),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/262 (34%), Positives = 126/262 (48%), Gaps = 52/262 (20%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+V+PF Q +P TIS+++A+KYKP L +  GC  +P V   G ++ G++        C  
Sbjct  29   DQVKPFPQPEPVTISEKAAVKYKPLLSIGNGCVSFPAVNAAGEITGGLKGTKDTE-DCTE  87

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH----RHFWLWVVIWTDSPDP  163
            +P G+Q+Y RS W+Q KWAM+Y+WY P           GH    RH W  VVIW D+P  
Sbjct  88   APLGTQVYGRSTWFQDKWAMMYSWYFPKNF-------CGHKAADRHDWANVVIWIDNPAL  140

Query  164  DDSTILAASMSGFGDEIKKYA----------PLKSKYLI------------------HDK  195
            +++T L AS+S    E KK+           P + +  I                  H  
Sbjct  141  ENATFLGASLSQQTLEPKKFVFLTVAKRKEEPYQKQKAIPMMAFAGTEQIVTGRVSRHSY  200

Query  196  TLK-VKSTESRIRKKH---------GLELTKRVGEFQDLITWEQLSDEARAALSNFHRLE  245
            T K V  + + +R  H         G+      GE QDLI W QL+D+ARAAL +     
Sbjct  201  TYKYVGGSNTTMRFIHKYPEKSAWIGMSFANSDGESQDLIMWNQLTDKARAALESADFGN  260

Query  246  KRANPPIQDKLFYEVLEKSYPF  267
             +   P  DK F   L+ ++PF
Sbjct  261  TQV--PFTDKNFETNLQAAWPF  280

>PHYRA_76603
Length=239

 Score = 130 bits (328),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/235 (37%), Positives = 123/235 (52%), Gaps = 29/235 (12%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVD--EGCHPYPVVQENGSLSEGMQWKNYFR  102
            +D D+VQPF Q  P TI+++S +K+KP L++D   GC  YP V   G  S G++      
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCVSYPAVNSAGETSGGLK-GTKGT  80

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSP  161
             +C G   GSQ+Y R++WY   WA++Y WY P    D  A++    RH W   V+W D P
Sbjct  81   SACTGPILGSQVYGRAEWYNDVWAIMYAWYFPKGFWDRRAYW----RHDWSNAVVWIDDP  136

Query  162  DPDDSTILAASMSGFGDEI-KKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV--  218
              ++  +L  S+S   ++   KY P ++        L+  +T S  R     +  + V  
Sbjct  137  ALENPKVLGLSLSTSENKYGHKYVPAEA--------LRNGTTPSLYRMMPTYKCAELVPY  188

Query  219  ---GEFQDLITWEQLSDEARAALS---NFHRLEKRANPPIQDKLFYEVLEKSYPF  267
               GE QDLI W QL+D ARAAL+   NF R E     PI D  F + LEK++P 
Sbjct  189  YASGEVQDLIMWGQLTDAARAALNDQGNFGRTEV----PINDDHFLKHLEKAWPL  239

>PHYSO_516261
Length=227

 Score = 130 bits (327),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 115/229 (50%), Gaps = 19/229 (8%)

Query  40   ISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKN  99
            +    +D D VQPF Q  P T+S+++A+K++P L+V+ GC P+P V   G  S G++   
Sbjct  17   VGAGTIDHDAVQPFAQPNPVTVSEKAAVKFQPLLFVESGCVPFPAVNSAGETSGGLKGTG  76

Query  100  YFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHF-WLWVVIWT  158
                  E    GSQ+Y R+ WY+  WA++Y WY P       W     RH  W  +V+W 
Sbjct  77   GTSGCKEAGATGSQVYGRAVWYKDDWAIMYAWYFPKGF----WSRWASRHHDWASIVVWI  132

Query  159  DSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRV  218
            D+P  +   ++  S S   ++ +   P             V  T  R+R+    +L K +
Sbjct  133  DNPALETPKMIGISTSEGDNDYRTAGP-----------DDVYETTPRLRRVLA-QLFKIL  180

Query  219  GEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            G+ Q LI WEQL+DEAR  L+       +A  P+ D  F   LEK++PF
Sbjct  181  GDTQPLIMWEQLTDEARITLNTTDF--GKAKVPMSDANFQGKLEKAWPF  227

>PHYSO_246397
Length=264

 Score = 131 bits (330),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 108/210 (51%), Gaps = 9/210 (4%)

Query  38   VLISPTLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQ-  96
            V     ++D D+VQPF + +P TIS+++AIKYKP L + +GC  Y  V   G  S GM  
Sbjct  15   VAAQAAVIDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDP  74

Query  97   --------WKNYFRPSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHR  148
                     KN +   C GS  GSQ+YSRS WY+  WA++Y WY P  +          R
Sbjct  75   MAPDGGTVEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWDEASYPPVR  134

Query  149  HFWLWVVIWTDSPDPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRK  208
            H W+  ++W ++P  ++ ++L  S S    E   Y P   +++              +  
Sbjct  135  HDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFYVGG  194

Query  209  KHGLELTKRVGEFQDLITWEQLSDEARAAL  238
             H ++++   G+FQDL+ W QL+D+AR AL
Sbjct  195  YHTIDVSLEAGDFQDLVHWSQLTDQARKAL  224

>PPTG_06202
Length=275

 Score = 131 bits (330),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 130/261 (50%), Gaps = 45/261 (17%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQW-KNYFRP  103
            +D D+VQPF Q  P TI++++A+ +KP+L++ +GC  +P V   G +S G++  KN    
Sbjct  22   IDHDKVQPFAQPVPVTIAEKAAVMFKPQLHISQGCVSFPAVNAAGEISGGVKGTKN--TE  79

Query  104  SCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDP  163
             C  +P GSQ+Y R+ WYQ KWAM++ WY P +  S   F    RH+W  +V+W D+P  
Sbjct  80   GCTEAPLGSQVYGRAKWYQDKWAMVFAWYFPKSFWS---FEAVDRHYWASMVLWLDNPAL  136

Query  164  DDSTILAAS-------------------------------MSGFGDEIKKYAPLKSKYLI  192
                I+ AS                               MS  G +  +  P+  +   
Sbjct  137  SAPKIIGASLQQQLLKKRGFLGFMFTEPREPYFKQTSIDIMSYVGAQRIRLNPIGYRRWS  196

Query  193  HDKT------LKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEK  246
            ++ T       +V  T     +   L  ++  G+FQDLI WEQL+DEAR+AL++    E 
Sbjct  197  YNFTPGSNVSTRVTHTYWNSFEYLALHFSETDGQFQDLIMWEQLTDEARSALNSADFGES  256

Query  247  RANPPIQDKLFYEVLEKSYPF  267
            +   P  D+   E LE ++PF
Sbjct  257  KV--PFNDENIEETLELAWPF  275

>PITG_23075
Length=276

 Score = 131 bits (329),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 130/263 (49%), Gaps = 44/263 (17%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            T++D D+VQPF Q  P TIS+++A+K+KP+L+++ GC  +P V   G L+ G++      
Sbjct  20   TMIDHDKVQPFAQPNPVTISEKAAVKFKPQLHIERGCVSFPAVNAAGELTGGLK-GTGGT  78

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              C  +P GSQIY RS WYQ KWAML+ WY P    S+   +   RH+W  +V+W D+P 
Sbjct  79   GGCTKAPLGSQIYGRSAWYQDKWAMLFAWYFPKGFSSSDHSI---RHYWSSMVLWLDNPA  135

Query  163  PDDSTILAASMSG---------FG-DEIKKYAPLKSKYLI--------------------  192
             D  T L AS+S          FG    ++  P   +  I                    
Sbjct  136  LDAPTFLGASLSQQLHKPRKILFGLYTAERKEPYSKQTAIPPMGFVGTQATVVGRVSRWR  195

Query  193  --------HDKTLKVKSTESRIRKKHGLELTKRVGEFQDLITWEQLSDEARAALSNFHRL  244
                     + + ++  T +    +  L    + GEFQDLI W+Q++D ARAAL++    
Sbjct  196  YTYNYSGGSNVSTRISQTYTNKGDRLALTFAFQNGEFQDLIMWDQMTDAARAALNSADFG  255

Query  245  EKRANPPIQDKLFYEVLEKSYPF  267
            E +   P  D+ F   L  S+PF
Sbjct  256  ESKV--PFSDQNFQTTLGLSWPF  276

>PHYRA_84277
Length=240

 Score = 130 bits (326),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 120/231 (52%), Gaps = 20/231 (9%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+VQPF Q  P TIS+++ +K+KP L++  GC  YP V   G  S G++        
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTSG  81

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMAL-DSTAWFVDGHRHFWLWVVIWTDSPDP  163
            C   P GSQ+Y R+ WY   WA++Y WY P    D++ ++    RH W   V+W D+P  
Sbjct  82   CALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPFW----RHDWSNAVVWIDNPAL  137

Query  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIR-----KKHGLELTKRV  218
            ++   L  S+S       KY    S Y   D   +  +T S  R     +   L  +   
Sbjct  138  ENPKALGLSIS---RSENKYG---STY-TDDSVFEYGTTPSLSRYLPPMQTAALSTSSFP  190

Query  219  GEF--QDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
             +F  QDLI W+QL+D ARAAL++      R + PI D  F ++LE+++PF
Sbjct  191  NDFELQDLIMWDQLTDAARAALNDQDNF-GRTDVPISDDHFPKLLEEAWPF  240

>PPTG_15219
Length=233

 Score = 129 bits (325),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 115/227 (51%), Gaps = 24/227 (11%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D V P  + + +T     A+++KP+L VD GCHPYP V  +G+ + G+   +    SC+ 
Sbjct  24   DGVVPLPETEDSTNEYSLALQFKPQLLVDTGCHPYPAVDADGNTNAGLSLVSL--KSCQN  81

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPDDST  167
               GSQIY+R+  Y+G +A++Y WY P   D    F  GHRH W   ++W D    DD+T
Sbjct  82   PSLGSQIYARASVYEGSYAIMYAWYFPR--DRRGAF--GHRHAWEHAILWLDRTGGDDAT  137

Query  168  ILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKK-------HGLELTKRVGE  220
            I A S      E+         + I D T  +   E+ ++ K       H + +T   GE
Sbjct  138  IEAVSA-----EVDD----GEYFTIEDPTEDMVDDETSVKFKYEEDAFSHYVNVTTEAGE  188

Query  221  FQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            FQDL+ WE +   AR AL N +     A  P  ++ F + LE +YPF
Sbjct  189  FQDLVVWEDMPKAARTAL-NLNDF-GEATVPFNEENFLDNLEGAYPF  233

>PHYCA_123587
Length=278

 Score = 130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/264 (32%), Positives = 126/264 (48%), Gaps = 44/264 (17%)

Query  43   TLMDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFR  102
            T +D D+VQPF Q  P T+S+++A+KYKP+L V   C  +P V   G ++ G++      
Sbjct  20   TTIDHDKVQPFKQPDPVTVSEKAALKYKPQLAVYGTCVSFPAVNAAGEITGGLKGTKGTE  79

Query  103  PSCEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPD  162
              C  +P GSQ+Y RS WYQ KWAM++ WY P             RH W  +V+W D+P 
Sbjct  80   -GCTEAPLGSQVYGRSAWYQDKWAMMFAWYFPKNFWGGG---ADSRHLWSNMVLWLDNPA  135

Query  163  PDDSTILAASMSGFGDEIKK--------------------YAPLKSKYLIHDKTLKV---  199
             +   IL AS+S    ++ K                      P+    +   +T ++   
Sbjct  136  LETPKILGASLSRQTLDVPKILFVLPLVDRQKDPYTKVTAVPPMGFVGMQAIQTGRISRF  195

Query  200  ---------KSTESRIRKKH-------GLELTKRVGEFQDLITWEQLSDEARAALSNFHR  243
                      +T +R+ + +       GL    R GE+QDLI W QL+D+ARAAL +   
Sbjct  196  TYTYNYTGGSNTSTRVSQGYPDSSSWIGLTFATRDGEYQDLIMWNQLTDQARAALES-AD  254

Query  244  LEKRANPPIQDKLFYEVLEKSYPF  267
              K    P  D+ F   LE+++PF
Sbjct  255  FGKDMKVPFNDENFETALEQAWPF  278

>PHYCA_553546
Length=280

 Score = 130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 127/261 (49%), Gaps = 44/261 (17%)

Query  45   MDVDEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPS  104
            +D D+V+PF Q +P TIS+++A+KYKP+L + +GC  +P V   G ++ G++       +
Sbjct  26   IDHDQVKPFPQPEPVTISEKAAVKYKPQLEIGDGCVSFPAVNAAGEITGGLKGTKDTE-A  84

Query  105  CEGSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
            C  +P GSQ+Y RS W+Q KWAM+Y+WY P    +   +    RH W  VVIW D+P  +
Sbjct  85   CTEAPLGSQVYGRSTWFQDKWAMMYSWYFPKNFCA---YKAAGRHDWANVVIWIDNPAAE  141

Query  165  DSTILAASMSGFGDEIKKYA----------PLKSKYLIHDKTLK----------------  198
            + T L AS+S    E  K A          P +++  I                      
Sbjct  142  NVTFLGASLSQQTLEPIKLAILPMGTRNEEPYQNQKAIPMMAFAGAERITTGRVGRWSYT  201

Query  199  ---VKSTESRIRKKHG---------LELTKRVGEFQDLITWEQLSDEARAALSNFHRLEK  246
               V  + + +R  H          +      GE QDLI W QL+D+ARAAL +    + 
Sbjct  202  YKYVAGSNTTMRFSHSYPGTWGWIDMTFADSDGESQDLIMWNQLTDKARAALESADFGDT  261

Query  247  RANPPIQDKLFYEVLEKSYPF  267
            +   P  DK F   L+ ++PF
Sbjct  262  QV--PFTDKNFDTNLQAAWPF  280

>PHYCA_69122
Length=249

 Score = 129 bits (325),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 128/236 (54%), Gaps = 24/236 (10%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDE-GCHPYPVVQENGSLSEGMQWKNYFRPSCE  106
            D+++PF Q +P T+S+++AIK+KP+LY  +  C P+P V   G ++ G++  N     C+
Sbjct  20   DQIEPFPQPEPVTVSEKAAIKFKPQLYTPKLVCVPFPAVNTAGEITGGLKGTN-GNDGCK  78

Query  107  GSPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVD-GHRHFWLWVVIWTDSPDPDD  165
             +P+G+QIY R+ WY+  WA++Y+WY P       WF     RH W  +V+W D+PD + 
Sbjct  79   YAPKGAQIYGRAGWYKDLWAIMYSWYFPKGF---GWFDSPTRRHDWKNIVVWIDNPDLET  135

Query  166  STILAASMS----GFGDEIKKYAPL------------KSKYLIHDKTLKVKSTESRIRKK  209
              I+  +MS     +  E+K +               + +YL  + +L+ +   S I   
Sbjct  136  PKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYLGSNTSLRFEYDTSDIGNP  195

Query  210  HGLELTKRVGEFQDLITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSY  265
              +      GE+QDLI WEQL+D AR AL++    EK A  P  D+ + + L K++
Sbjct  196  L-MHFAAWDGEYQDLIMWEQLTDAARVALNDGKSFEK-AEVPFSDEHYEDHLGKAW  249

>PHYCA_109174
Length=277

 Score = 130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 122/259 (47%), Gaps = 45/259 (17%)

Query  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107
            D+VQPF Q  P T+S+++A+KYKP+L + + C  +P V   G ++ G++        C  
Sbjct  25   DKVQPFAQPDPVTVSEKAAVKYKPQLQISDSCVSFPAVNAAGEITGGLK-GTKGTDGCTE  83

Query  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTAWFVDGH-RHFWLWVVIWTDSPDPDDS  166
            +P GSQ+Y RS WYQ KWAM++ WY P       W      RH W  +V+W D+P  +  
Sbjct  84   APLGSQVYGRSTWYQDKWAMMFAWYFPKNF----WGGGAKSRHLWANMVLWIDNPALETP  139

Query  167  TILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKST------------ESRIRK------  208
             IL AS+S    E+ K   L       D   KV +              SRI +      
Sbjct  140  KILGASLSRQTLEVPKAVFLSMGEQQKDPYSKVTAIPPMGFVGMQAIQTSRISRFRYTYN  199

Query  209  -KHGLELTKRV-------------------GEFQDLITWEQLSDEARAALSNFHRLEKRA  248
               G +++ RV                   GE+QDLI W QL+D+ARAAL +    E   
Sbjct  200  YTGGSDISTRVSQGYPDNSAWISLTFAGTDGEYQDLIMWNQLTDQARAALESADFGED-T  258

Query  249  NPPIQDKLFYEVLEKSYPF  267
              P  DK F   L +++PF
Sbjct  259  KVPFNDKNFEAALAQAWPF  277

>PPTG_07991
Length=276

 Score = 130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 120/223 (54%), Gaps = 23/223 (10%)

Query  48   DEVQPFYQRKPT--TISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSC  105
            D+V+PF   +P+  T+++++AIK++P+L+V  GCHPYP V   G +S+G+Q  +     C
Sbjct  73   DQVEPFEMAQPSDATVTEKAAIKFRPKLHVVNGCHPYPAVNAAGQVSKGLQKADATDAEC  132

Query  106  EGSPRGSQIYSRSDWYQGKWAMLYTWYLP-MALDSTAWFVDGHRHFWLWVVIWTDSPDPD  164
             GS  G+Q+Y RS W+   WA++Y WY P ++ D            W  V++WT++P+  
Sbjct  133  SGSKLGTQVYGRSAWFGRVWAIMYAWYFPDVSPD------------WEHVIVWTNNPNVT  180

Query  165  DSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQDL  224
            +  ILA + S    +     P  +  +I  K++K+          + LE T + G  Q+L
Sbjct  181  NQVILAVTTSDSTGKYSSQVPPDAS-MISGKSVKIA------YNNNALESTTKEGGAQNL  233

Query  225  ITWEQLSDEARAALSNFHRLEKRANPPIQDKLFYEVLEKSYPF  267
            + W QL+ EA+ AL++          P+ D  F   L K++PF
Sbjct  234  VLWHQLTPEAQEALNDDQSF-GGVQVPVNDDYFLLNLGKAWPF  275

Lambda      K        H        a         alpha
   0.319    0.135    0.431    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 15168916791

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40