Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_108361020420410055e-140
PPTG_16671102092064327e-53
PHYCA_104436101812014082e-49
PITG_00012101852063682e-43
PHYSO_554653102202083582e-41
PHYRA_78819102001993127e-35
PHYCA_97367203391912092543e-26
PPTG_07275203391841972438e-25
HYAP_01509102082092335e-23
PYVX_15869103311911173e-06
PYAP_203999980113573740.43
PYAR_194629980111651691.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_10836

Length=204
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHALS_10836                                                           391        5e-140
PPTG_16671                                                            171        7e-53 
PHYCA_104436                                                          161        2e-49 
PITG_00012                                                            146        2e-43 
PHYSO_554653                                                          142        2e-41 
PHYRA_78819                                                           124        7e-35 
PHYCA_97367                                                           102        3e-26 
PPTG_07275                                                            98.2       8e-25 
HYAP_01509                                                            94.4       5e-23 
PYVX_15869                                                            49.7       3e-06 
PYAP_20399                                                            33.1       0.43  
PYAR_19462                                                            31.2       1.6   

>PHALS_10836
Length=204

 Score = 391 bits (1005),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 204/204 (100%), Positives = 204/204 (100%), Gaps = 0/204 (0%)

Query  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60
            MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP
Sbjct  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60

Query  61   TSSFPTLSSSNLEYSCRANDNKFITLstsrsrsvsstpsesAHEEEGENQLHFLFYGGSD  120
            TSSFPTLSSSNLEYSCRANDNKFITLSTSRSRSVSSTPSESAHEEEGENQLHFLFYGGSD
Sbjct  61   TSSFPTLSSSNLEYSCRANDNKFITLSTSRSRSVSSTPSESAHEEEGENQLHFLFYGGSD  120

Query  121  SLSPKAVGKRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSDSIYSA  180
            SLSPKAVGKRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSDSIYSA
Sbjct  121  SLSPKAVGKRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSDSIYSA  180

Query  181  NLLGDIDQQGQRSGTGHCNMRLVM  204
            NLLGDIDQQGQRSGTGHCNMRLVM
Sbjct  181  NLLGDIDQQGQRSGTGHCNMRLVM  204

>PPTG_16671
Length=209

 Score = 171 bits (432),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 136/206 (66%), Gaps = 7/206 (3%)

Query  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDND-KNTLTPSY  59
            +S F   +WD VC+PFE C +CCDVLDP YYRK SPG RR+PQMFN W++D K  +TPS 
Sbjct  3    LSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITPSR  62

Query  60   PTSSFPTLSSSNLEYSCRANDNKFITLstsrsrsvsstpsesAHEEEGENQLHFLFYGGS  119
            P SS P  +SS +    R + +K ++ S SRS S S +PS  ++EEE E Q+ FLFYGGS
Sbjct  63   PPSSLPPFASSQV--GTREHQSKTLSSSGSRSGSNSDSPSNYSYEEEDERQVQFLFYGGS  120

Query  120  DSLSPKAVG----KRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSD  175
            D  +P + G      YR D+IS+  EP SP  SIESPRI+H+MPCFFS    PLQ PMS 
Sbjct  121  DPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMSA  180

Query  176  SIYSANLLGDIDQQGQRSGTGHCNMR  201
             IYS +L    +Q+  R  TG+ +MR
Sbjct  181  PIYSPHLFKISEQRTSRRSTGYYSMR  206

>PHYCA_104436
Length=181

 Score = 161 bits (408),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 114/201 (57%), Gaps = 31/201 (15%)

Query  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60
            +S F R +WDLV QPFE C +CCDVLDP YYRK SPG RR+PQMFN W+ D  + T S  
Sbjct  3    VSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQSKTLSSS  62

Query  61   TSSFPTLSSSNLEYSCRANDNKFITLstsrsrsvsstpsesAHEEEGENQLHFLFYGGSD  120
             S   + ++S L YS                           +EEE E Q+ FLFYGGSD
Sbjct  63   GSRSGSSANSPLNYS---------------------------YEEEDERQVQFLFYGGSD  95

Query  121  SLSPKAVG----KRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSDS  176
              +P +VG      YR D+IS+  EP SP  SIESPRI H+MPCFFS    P+Q PMS  
Sbjct  96   PPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAP  155

Query  177  IYSANLLGDIDQQGQRSGTGH  197
            IYS +L    +Q+  R   G+
Sbjct  156  IYSPHLFKIAEQRTTRRSAGY  176

>PITG_00012
Length=185

 Score = 146 bits (368),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 109/206 (53%), Gaps = 31/206 (15%)

Query  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60
            +S F   +WD VC+PFE C +CCDVLDP YYRK SPG  R+PQMFN W++       S  
Sbjct  3    LSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITSSR  62

Query  61   TSSFPTLSSSNLEYSCRANDNKFITLstsrsrsvsstpsesAHEEEGENQLHFLFYGGSD  120
              S  + S S   YS    + +                           Q+ FLFYGGSD
Sbjct  63   PPSSGSRSDSPSNYSYEEEEEE--------------------------RQVQFLFYGGSD  96

Query  121  SLSPKAVGK-----RYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSD  175
              +P +VG       YR D+IS+  EP SP  SIESPRI H+MPCFFS    PLQ PMS 
Sbjct  97   PPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSA  156

Query  176  SIYSANLLGDIDQQGQRSGTGHCNMR  201
             IYS +L    +Q+  R  TG+ NMR
Sbjct  157  PIYSPHLFKISEQRMSRRSTGYYNMR  182

>PHYSO_554653
Length=220

 Score = 142 bits (358),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 120/208 (58%), Gaps = 22/208 (11%)

Query  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDND---------  51
            +S F R LWDLV  PFE C +CCDVLDP YYRK SPG RR PQMFN WD+D         
Sbjct  3    LSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGSNP  62

Query  52   KNTLTPSYPTSSFPTLSSSNLEYSCRA-----NDNKFITLstsrsrsvsstpsesAHEEE  106
             + L PS+  S  P +SSS+   + R+     + +     S S S S S +PS  ++EEE
Sbjct  63   PSRLPPSFSFS--PVISSSHAGRTQRSFTSPASLSGSSPSSGSGSASRSQSPSSYSYEEE  120

Query  107  GENQLHFLFYGGSDSLSPKAVGKR---YRRDIISDCQEPTSPV--VSIESPRIDHKMPCF  161
             E Q+ FLFYGGSD  +P   G     YR D+IS   +PT P+   SI SPRI H+MPCF
Sbjct  121  DERQVQFLFYGGSDPPTPTGGGAYPSGYRSDMISKYIQPTEPISPASIASPRISHEMPCF  180

Query  162  FSSTIAPLQFPMSDSIYSANLLGDIDQQ  189
            FS    P   PMS  IYS +L    +Q+
Sbjct  181  FSPRTTPTS-PMSAPIYSPHLFKITEQR  207

>PHYRA_78819
Length=200

 Score = 124 bits (312),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 113/199 (57%), Gaps = 9/199 (5%)

Query  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60
            +S F   +WDL+ +PFE C +CCDVLDP YYRK SPG RR+PQMFN +++ K        
Sbjct  3    VSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFNDVKYDF-----  57

Query  61   TSSFPTLSSSNLEYSCRANDNKFITLstsrsrsvsstpsesAHEEEGENQLHFLFYGGSD  120
            + S P  S      +  A+  +   +S+      +S  + S  EEE E  + FLFYGGSD
Sbjct  58   SKSRPPSSLPPSSSNSHADITQRSNMSSGSGSRSASPMNYSYEEEEEERHVQFLFYGGSD  117

Query  121  SLSPKAVG--KRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSDSIY  178
              +P + G    YR D+IS+  EP SP  +  SPRI+H+MPCFFS    P Q PMS  IY
Sbjct  118  PPTPTSAGGPGGYRSDMISNYVEPISP-AAFASPRINHEMPCFFSPRNTPAQSPMSAPIY  176

Query  179  SANLLGDIDQQGQRSGTGH  197
            S +L   I +Q  R   GH
Sbjct  177  SPHLF-KIAEQRHRHSAGH  194

>PHYCA_97367
Length=191

 Score = 102 bits (254),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 103/209 (49%), Gaps = 31/209 (15%)

Query  1    MSRFIRILWDLVCQPFEYCRNCCDVLD----PAYYRKMSPGGRRNPQMFNC--WDND-KN  53
            +S F + +WD VC+PFE C++C +VLD    P YY K SPG RR P  F+   WDND K 
Sbjct  3    VSDFFQDVWDFVCRPFEDCKSCSEVLDNVLDPYYYGKTSPGVRRTPPTFDRTRWDNDLKY  62

Query  54   TLTPSYPTSSFPTLSSSNLEYSCRANDNKFITLstsrsrsvsstpsesAHEEEGENQLHF  113
              + S P    P+ S +N               S        S    ++   E + Q+ F
Sbjct  63   DFSLSRPP---PSQSPAN---------------SRVVFPLSRSRSLSASRSLEEDEQIQF  104

Query  114  LFYGGSD-SLSPKAVGKRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFP  172
            LFY GSD S S +     YR D IS    P  P+   E PR+ H++PCFFS   APL  P
Sbjct  105  LFYSGSDISTSDRLCSSGYRSDAIS---RPLQPIT--EPPRLSHEIPCFFSPRDAPLMAP  159

Query  173  MSDSIYSANLLGDIDQQGQRSGTGHCNMR  201
            MS  IYS +L    +Q+G+     + N R
Sbjct  160  MSAPIYSPHLFMISEQRGRSPSRHYSNRR  188

>PPTG_07275
Length=184

 Score = 98.2 bits (243),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 107/197 (54%), Gaps = 26/197 (13%)

Query  8    LWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFN--CWDND-KNTLTPSYPTSSF  64
            +WD + +PFE C++ CDVLDP YY K SPG RRNP  F+  CW+ND K   + S P  SF
Sbjct  1    MWDFLRRPFEDCKSYCDVLDPYYYSKTSPGVRRNPPKFDRACWENDLKYDFSLSRPPPSF  60

Query  65   PTLSSSNLEYSCRANDNKFITLstsrsrsvsstpsesAHEEEGENQLHFLFYGGSDSLSP  124
             + SS  ++++   + ++  +             +   HEEE E Q+ FLFYGGSD  +P
Sbjct  61   QSSSSGRMQFTLSRSRSQSRS-------------ASVLHEEEEEQQVQFLFYGGSDISTP  107

Query  125  KAVGKR----YRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSDSIYSA  180
             +VGK     YR D+I       S     + PRI H++PCFFS    P+  PMS  IYS 
Sbjct  108  VSVGKLCSSGYRSDVICTPMRLVS-----QPPRISHEIPCFFSPRDTPMMSPMSAPIYSP  162

Query  181  NLLGDIDQQGQRSGTGH  197
            +L   I++Q  R    H
Sbjct  163  HLF-QINEQRWRLRPRH  178

>HYAP_01509
Length=208

 Score = 94.4 bits (233),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 104/209 (50%), Gaps = 14/209 (7%)

Query  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKN---TLTP  57
            +S  +  +   VC+PF  C +C DVLD +YY K SPG   +PQMFN W+ND     T + 
Sbjct  3    VSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYTRSR  62

Query  58   SYPTSSFPTLSSSNLEYSCRANDNKFITLstsrsrsvsstpsesAHEEEGENQLHFLFYG  117
              P+   P       +           +   S S S + +      EEE + ++ FLFYG
Sbjct  63   PLPSRLPPPPPPRTRKKGLTKRSTSSSSRPRSESSSNNPSYYSFEDEEERDRRVQFLFYG  122

Query  118  GSDSLSPKAVG-----KRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFP  172
            GSD  +P + G       YR D+ISD       + SI SP+I+H++PCFFS    P +  
Sbjct  123  GSDPPTPTSRGGLAASTGYRSDMISDAVS----LTSIRSPQINHEIPCFFSPRDTP-RSS  177

Query  173  MSDSIYSANLLGDIDQQGQRSGTGHCNMR  201
            +S S+YS ++   I +Q QR      +MR
Sbjct  178  VSASMYSPHVF-KITEQKQRRNARLRSMR  205

>PYVX_15869
Length=331

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 76/191 (40%), Gaps = 24/191 (13%)

Query  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60
            +SR+       +  PF  C N CD+  P      SPG    PQ F   D D      + P
Sbjct  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAGP  200

Query  61   TSSFPTLSSSNLEYSCRANDNKFITLstsrsrsvsstpsesAHEEEGENQLHFLFYGGSD  120
             SS     SS+   S R+  +    L               ++++  +    FLFY GSD
Sbjct  201  ISSSAASKSSSPARSTRSKTSSDSFL---------------SYDDPYDQPTQFLFYCGSD  245

Query  121  SLSPKAVGKRYRRDIISDCQEPTSPVVSIE--------SPRIDHKMPCFFSSTIAPLQFP  172
             L+P +     R  + +D     +P    E        SPRI H++P FFS   AP   P
Sbjct  246  PLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNAPTS-P  304

Query  173  MSDSIYSANLL  183
             +  +YS +L 
Sbjct  305  AAAPLYSPHLF  315

>PYAP_20399
Length=135

 Score = 33.1 bits (74),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 38/73 (52%), Gaps = 13/73 (18%)

Query  112  HFLFYGGSDSLSPKAVGKR--YRRD-----IISDCQEPTSPVVSIESPRIDHKMPCFFSS  164
             FLF+ GSD+ S  A G+R  Y+ +       ++ Q   S    I++P+I HK+P FF  
Sbjct  68   QFLFFCGSDN-SGVAAGRRTGYQTNHDFSFANAEVQARASRASEIQAPQISHKIPVFF--  124

Query  165  TIAPLQFPMSDSI  177
              AP Q PM  S 
Sbjct  125  --AP-QHPMMGSF  134

>PYAR_19462
Length=116

 Score = 31.2 bits (69),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 16/51 (31%)

Query  112  HFLFYGGSDSLSPKAVGKRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFF  162
             FLF+ GSD+ + +A  K  +                IE+P I H+MP FF
Sbjct  71   QFLFFCGSDTSAARASLKSSK----------------IETPMISHRMPVFF  105

Lambda      K        H        a         alpha
   0.321    0.136    0.435    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9439740474

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40