Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_10835926426410255e-141
PPTG_1667292862175161e-63
PHYCA_50470692532354889e-60
PITG_0001191601924442e-54
PHYSO_47825391691934052e-48
HYAP_0151392482082886e-30
PHYKE_57209221752587e-26
PYVX_158639181751664e-13
PYU1_G00322593697227661032e-04
PYAP_216171358854253722.8
PYIW_234919369721236694.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_10835

Length=264
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHALS_10835                                                           399        5e-141
PPTG_16672                                                            203        1e-63 
PHYCA_504706                                                          192        9e-60 
PITG_00011                                                            175        2e-54 
PHYSO_478253                                                          160        2e-48 
HYAP_01513                                                            115        6e-30 
PHYKE_5720                                                            103        7e-26 
PYVX_15863                                                            68.6       4e-13 
PYU1_G003225                                                          44.3       2e-04 
PYAP_21617                                                            32.3       2.8   
PYIW_23491                                                            31.2       4.7   

>PHALS_10835
Length=264

 Score = 399 bits (1025),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 264/264 (100%), Positives = 264/264 (100%), Gaps = 0/264 (0%)

Query  1    MPGTEAVPTIVPAPLQKRapppppptstsaseptsvpepISEPELKQHRDVESTHAEPVH  60
            MPGTEAVPTIVPAPLQKRAPPPPPPTSTSASEPTSVPEPISEPELKQHRDVESTHAEPVH
Sbjct  1    MPGTEAVPTIVPAPLQKRAPPPPPPTSTSASEPTSVPEPISEPELKQHRDVESTHAEPVH  60

Query  61   AATGRPPKKRKHRGLMRAIGGFFRRNCSDADSDTRPHDSESSQRRTSRWSHSHRQSMPEA  120
            AATGRPPKKRKHRGLMRAIGGFFRRNCSDADSDTRPHDSESSQRRTSRWSHSHRQSMPEA
Sbjct  61   AATGRPPKKRKHRGLMRAIGGFFRRNCSDADSDTRPHDSESSQRRTSRWSHSHRQSMPEA  120

Query  121  PSTVVVQEILETTRSQNAAENEPLTKSPHTEEppvkkvkkdkpkkakNtpspteqsptet  180
            PSTVVVQEILETTRSQNAAENEPLTKSPHTEEPPVKKVKKDKPKKAKNTPSPTEQSPTET
Sbjct  121  PSTVVVQEILETTRSQNAAENEPLTKSPHTEEPPVKKVKKDKPKKAKNTPSPTEQSPTET  180

Query  181  seMLSATLVDELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMpl  240
            SEMLSATLVDELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMPL
Sbjct  181  SEMLSATLVDELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMPL  240

Query  241  flppplpKNVRRSSILPDPEEYEF  264
            FLPPPLPKNVRRSSILPDPEEYEF
Sbjct  241  FLPPPLPKNVRRSSILPDPEEYEF  264

>PPTG_16672
Length=286

 Score = 203 bits (516),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 148/217 (68%), Gaps = 13/217 (6%)

Query  58   PVHAATGRPPKKRKHRGLMRAIGGFFRRNCSDADSDTRPHDSESSQRRTSRWS---HSHR  114
            PVHAA   PP KRK RG+MRAIGG F+R  SD D    P DSE+SQRRTSRWS   HSHR
Sbjct  73   PVHAAAAEPPTKRKTRGIMRAIGGLFKRKASDVDDAMEPSDSEASQRRTSRWSRWSHSHR  132

Query  115  QSMPEAPSTVVVQEILETTRSQNAAENEPLTKSPHTEEppvkkvkkdkpkkakNtpspt-  173
             S PEAP  V      ET   Q   ENE    SPH +EPP KKVKK   +        + 
Sbjct  133  GSFPEAPLEVAAVAAPETAPIQ---ENESAASSPHPDEPPAKKVKKATVEHPTTEKKASP  189

Query  174  ------eqsptetseMLSATLVDELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHE  227
                  +QSPT+ SE+L A   DE G E QRVSFLFFGGSDVD TFQPELRPSELDDLHE
Sbjct  190  LSFNKTKQSPTDPSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDLHE  249

Query  228  NDIRPSLQAKMplflppplpKNVRRSSILPDPEEYEF  264
            NDIRPSLQAKMPLF  PPL +++RRSSILPDP+EYEF
Sbjct  250  NDIRPSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF  286

>PHYCA_504706
Length=253

 Score = 192 bits (488),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 160/235 (68%), Gaps = 15/235 (6%)

Query  41   SEPELKQHRDVESTHAEPVHAATGRP--PKKRKHRGLMRAIGGFFRRNCSDADSDTRPHD  98
            S PEL  H  +E   A+P  A   +P  P KRKHRGLMRAIGG F+R  SDAD  T P D
Sbjct  23   SAPELPPHV-LEQPVADPSPAEVTQPELPTKRKHRGLMRAIGGLFKRKSSDADDATAPSD  81

Query  99   SESSQRRTSRWS---HSHRQSMPEAPSTVVVQEILETTRSQNAAENEPLTKSPHTEEppv  155
            SE+SQRRTSRWS   HS+R SMPEAP  V      ET   Q   ENE +  SPH EEPP 
Sbjct  82   SEASQRRTSRWSRWSHSNRGSMPEAPLEVAAVAEPETAPIQ---ENESVASSPHMEEPPA  138

Query  156  kkvkkdkpkkakNtps------pteqsptetseMLSATLVDELGVELQRVSFLFFGGSDV  209
            KKVKK K +K K           T+QSPT+ S ++++   D   VE QR+SFLFFGGSD 
Sbjct  139  KKVKKVKAEKPKKEAKIKPPSFNTKQSPTDPSALVASGSSDGSVVEPQRISFLFFGGSDT  198

Query  210  DCTFQPELRPSELDDLHENDIRPSLQAKMplflppplpKNVRRSSILPDPEEYEF  264
            D TFQPELRPSE D+LHENDIRPSLQAKMPLF  PP+ +N+RRSSILPDP+EYEF
Sbjct  199  DSTFQPELRPSEYDELHENDIRPSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253

>PITG_00011
Length=160

 Score = 175 bits (444),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 123/192 (64%), Gaps = 35/192 (18%)

Query  76   MRAIGGFFRRNCSDADSDTRPHDSESSQRRTSRWS---HSHRQSMPEAPSTVVVQEILET  132
            MRAIGG F+R CSDAD  T P DSE+SQRRTSRWS   HSHR S+PEAP  V      ET
Sbjct  1    MRAIGGLFKRKCSDADDATAPSDSEASQRRTSRWSRWSHSHRGSLPEAPLDVAAVAAPET  60

Query  133  TRSQNAAENEPLTKSPHTEEppvkkvkkdkpkkakNtpspteqsptetseMLSATLVDEL  192
               Q   EN+   +SP                             T+ S++L A   DE 
Sbjct  61   APIQ---ENDSTKQSP-----------------------------TDPSDLLLADSSDES  88

Query  193  GVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMplflppplpKNVRR  252
            G E QRVSFLFFGGSD D TFQPELRPSELDDLH+NDIRPSLQAKMPLF  PPL +N+RR
Sbjct  89   GAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFFSPPLVENMRR  148

Query  253  SSILPDPEEYEF  264
            SSILPDP+EYEF
Sbjct  149  SSILPDPKEYEF  160

>PHYSO_478253
Length=169

 Score = 160 bits (405),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 114/193 (59%), Gaps = 28/193 (15%)

Query  76   MRAIGGFFRRNCSDADSDTRPHDSESSQR----RTSRWSHSHRQSMPEAPSTVVVQEILE  131
            MRAIGG F+R   DAD    P DSE+SQR    R SRWS SHRQS+PEAP  V    + E
Sbjct  1    MRAIGGLFKRKSIDADDPMAPSDSEASQRPSTSRWSRWSQSHRQSLPEAPMEVTAVAVPE  60

Query  132  TTRSQNAAENEPLTKSPHTEEppvkkvkkdkpkkakNtpspteqsptetseMLSATLVDE  191
                Q   ENEP   S   ++ P             +                     DE
Sbjct  61   AAPIQ---ENEPPAPSSPVKQSPTDPSALLLAGVDSD---------------------DE  96

Query  192  LGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMplflppplpKNVR  251
            +  E  RVSFLFFGGSDVD TFQPELRPSELDDLHEN+IRPSLQ KMPLF  PPL +N+R
Sbjct  97   MPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFFSPPLVENMR  156

Query  252  RSSILPDPEEYEF  264
            RSSILPDP+EYEF
Sbjct  157  RSSILPDPKEYEF  169

>HYAP_01513
Length=248

 Score = 115 bits (288),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 121/208 (58%), Gaps = 11/208 (5%)

Query  68   KKRKHRGLMRAIGGFFRRNCSDADSDTRP-HDSESSQRRTSRWSH-SHRQSMPEAPSTVV  125
            KK+ HRGL+RA+G FF+R CSD D+  RP   S +S  R  +W H S RQSMP+ P   V
Sbjct  41   KKKPHRGLIRAVGVFFKRKCSDGDATVRPPVVSGASPNRMVQWIHGSQRQSMPDMPLEAV  100

Query  126  ----VQEILETTRSQNAAENEPLT---KSPHTEEppvkkvkkdkpkkakNtpspteqspt  178
                 QE    T      E  P+T   K    E    K  ++    KA  +    + SPT
Sbjct  101  DPSLYQERETLTSVCPLMEETPVTITNKRVKQETKADKGERRKAETKANVSFVKAKPSPT  160

Query  179  etseMLSA--TLVDELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQA  236
            ++SE+L A  +  +E  V+  RVSFL FGGS+VD TF+PEL PSE DD+H ++IRP LQ 
Sbjct  161  DSSELLRAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQN  220

Query  237  KMplflppplpKNVRRSSILPDPEEYEF  264
            KMPLF   PL + +RRSS   DP+EYE 
Sbjct  221  KMPLFFSLPLAERLRRSSAKSDPKEYEL  248

>PHYKE_5720
Length=221

 Score = 103 bits (258),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)

Query  190  DELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMplflppplpKN  249
            DE G E  R+SFLFFGGSD + TF P+LRPS+LDDLHEND+RPSLQAKMP F  PP+ ++
Sbjct  147  DEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSLQAKMPQFFSPPVVEH  206

Query  250  VRRSSILPDPEEYEF  264
            +RRSSILPDP EYEF
Sbjct  207  MRRSSILPDPREYEF  221

>PYVX_15863
Length=181

 Score = 68.6 bits (166),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 1/75 (1%)

Query  191  ELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMplflppplpKNV  250
            EL V      FLF+GGSDVD  F+P+LRPS LD +  + IRP ++  MP+F   P  +N+
Sbjct  107  ELDVADAAPEFLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENL  166

Query  251  RRSSIL-PDPEEYEF  264
            RRSSIL  DP EYEF
Sbjct  167  RRSSILGADPREYEF  181

>PYU1_G003225
Length=227

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 2/66 (3%)

Query  201  FLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMplflp--pplpKNVRRSSILPD  258
            FLF+ GS  D +F+PE   S + ++  N IRPSL  +MP+F           RRSSIL D
Sbjct  126  FLFYPGSAEDNSFKPEKVTSSIVEIDYNAIRPSLTLQMPVFFSPPTEPSNFPRRSSILTD  185

Query  259  PEEYEF  264
            P EYE 
Sbjct  186  PREYEL  191

>PYAP_21617
Length=542

 Score = 32.3 bits (72),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  72   HRGLMRAIGGFFRRNCSDADSDTRPHDSESSQRRTSRWSHSHRQSMPEAPSTV  124
            HR L+     F ++N SD+++ T   +   +   + +WS S    +PEA  +V
Sbjct  26   HRSLLSFSSIFGKKNSSDSEAGTVKANGAGADDMSCKWSFSKLSCVPEASCSV  78

>PYIW_23491
Length=212

 Score = 31.2 bits (69),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (53%), Gaps = 0/36 (0%)

Query  53  STHAEPVHAATGRPPKKRKHRGLMRAIGGFFRRNCS  88
           S+ AEP H  +       K RG MRAIGG F R  +
Sbjct  4   SSAAEPQHDHSDSDNGAVKTRGFMRAIGGMFHRKSA  39

 Score = 30.8 bits (68),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 22/40 (55%), Gaps = 0/40 (0%)

Query  198  RVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAK  237
            R  F F+ GS  D +F+PE   S + ++  N IRP   +K
Sbjct  141  RYQFHFYSGSAEDNSFKPERVHSTVAEIDYNTIRPRRGSK  180

Lambda      K        H        a         alpha
   0.313    0.128    0.372    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 15018932328

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40