Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_064811475364463333640.0
PHYCA_5561601475364962126200.0
PITG_184521475385662925770.0
PHYKE_83911475377863325120.0
HYAP_070951475361361323220.0
PYAP_177619907562260821830.0
PHYSO_3489011475352647921710.0
PHYRA_508551475348947921630.0
PYIR_134521475364561521340.0
PYIW_199721475360961419960.0
PYVX_181701475351054618800.0
PYAR_135699907549448518210.0
H310_085901475364062117850.0
H257_084361475364261717560.0
SPRG_141031475362861817120.0
SDRG_167201475362861817020.0
SPRG_0407412408750949610292e-132
SDRG_1440812408752849810261e-131
PHYSO_254571109044894886012e-69
SPRG_11769109044534785941e-68
PHALS_08068109044974885971e-68
PPTG_18033109045004935927e-68
SDRG_03823114284974775892e-67
SDRG_038221356704944765892e-67
SDRG_12187109044624795853e-67
PHYCA_504517114284934805874e-67
PPTG_09787114284934805822e-66
PHYRA_71927109044854885803e-66
CCA23647114284964675804e-66
H310_144471462305014785804e-66
SPRG_05609114284964825795e-66
PYIR_17506109045094865762e-65
PITG_14083114284934795752e-65
PITG_13427109044634755732e-65
PHYKE_103271090612004876022e-65
CCI11048114284964745743e-65
PYAP_234351008029514795963e-65
SDRG_111311368074944765733e-65
SDRG_150451241574944765701e-64
PHYSO_550665114284914805691e-64
PHYRA_72037114284934775673e-64
PHYCA_7619109044624745635e-64
PYAP_21882109045024875631e-63
H257_09722114285184835632e-63
PYAR_17512109045335095642e-63
H257_170371462304984805612e-63
PYIW_25301109045124865587e-63
H310_11259114285194825465e-61
HYAP_08763114284734655419e-61
PHALS_09136114284934825384e-60
PHYKE_6836114284934835359e-60
HYAP_04843109044304185256e-59
PYVX_21517109044824984612e-49
PYAR_177141008024444794479e-48
PYIR_23431114284684624356e-46
PYVX_16175114284464594074e-42
CCA22989124014944803415e-33
CCI10477124014944843416e-33
PYAP_226451707615654903416e-32
PYIR_20273124015054993328e-32
PYVX_21248124015025203161e-29
SPRG_09825124014924903151e-29
SPRG_199431356703432703072e-29
SDRG_06945124014924903097e-29
PYU1_G00173714753133982813e-28
PHYKE_9680124014984392982e-27
PHYRA_72215124014994832866e-26
HYAP_12621124015014812867e-26
PHYSO_556052124015004832868e-26
PYU1_G014259109042442482729e-26
H310_02523124014944892813e-25
PYAR_20075170764694832795e-25
H257_16541124014944462795e-25
PHALS_09942124014964922779e-25
PITG_15359124014964832733e-24
PHYCA_123621124014954982672e-23
PHYRA_7388315665515332512e-21
PYAP_19280151565125012485e-21
PYVX_20512151565285102476e-21
PYIW_251901648732061862319e-21
PYAR_16840151565365252432e-20
CCI50816151568074942453e-20
CCA16670151565204952405e-20
PHALS_1202815665795152344e-19
PYIR_1413215665135142334e-19
H257_01186151564964992308e-19
PPTG_0093815665505582301e-18
PYIW_19795151565195322281e-18
PYIW_24688114282592622182e-18
PHYCA_50444515665485142254e-18
PHYRA_47253151564814992235e-18
PITG_18935150674804852235e-18
PYU1_G011605151565245062236e-18
PPTG_09121151565205002228e-18
H310_00561151564975272201e-17
HYAP_0414915665645202201e-17
SDRG_14446151564955002182e-17
PYIW_2025715665035032164e-17
PYU1_G00569915665505092156e-17
SDRG_0506015665595122148e-17
SPRG_1205415665585122131e-16
PPTG_13000124013873422091e-16
PHYSO_48941815664714722102e-16
PHYCA_555180151565215152068e-16
PHALS_10055151565165062058e-16
H257_0745015665674072032e-15
PYAP_1914815665355232022e-15
CCI3999315665503662004e-15
H310_0764115665483701979e-15
PHYKE_980715665575171961e-14
CCA1403015665603661952e-14
PYVX_2349915665195321932e-14
PYAR_1666415665774401908e-14
PITG_0177815664704691881e-13
PHYKE_2864151564865121782e-12
PHYSO_562795151564153371663e-11
PITG_19065151564163441631e-10
HYAP_08069650262552201544e-10
PYIR_21896151565185081551e-09
SPRG_04114151563763581442e-08
PPTG_247122910367621212e-07
HYAP_13613151564232461319e-07
PITG_19802156311851581124e-05
PYIW_2756812401128120920.007
SPRG_042311241579052880.010
PYU1_G014369634703172960.018
HYAP_03065634701131920.045
PHYSO_507629634703100890.12
SPRG_17626132408148120830.14
PPTG_08060634725172880.16
PHYRA_7412512864483883860.28
PHALS_10960634702226840.43
HYAP_080686502510070770.45
PYVX_1422212864510786840.49
PHYKE_27447525911738760.91
CCI50227539470791811.1
PHYSO_30062112864483383792.0
PITG_0070363470359782.1
PYAP_17256634705172772.6
PHYRA_8732873619486181773.0
PHYRA_72196634691181773.2
PYU1_G000378105671070170773.3
PHYKE_6590105671054166763.9
PYIR_133361055103142764.5
H257_0402912864467378764.7
PYIW_16666105671078165755.5
PYAR_1582363470559739.8
PYU1_G0068776970920116739.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_06481

Length=644
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHALS_06481                                                           1300       0.0   
PHYCA_556160                                                          1013       0.0   
PITG_18452                                                            997        0.0   
PHYKE_8391                                                            972        0.0   
HYAP_07095                                                            899        0.0   
PYAP_17761                                                            845        0.0   
PHYSO_348901                                                          840        0.0   
PHYRA_50855                                                           837        0.0   
PYIR_13452                                                            826        0.0   
PYIW_19972                                                            773        0.0   
PYVX_18170                                                            728        0.0   
PYAR_13569                                                            706        0.0   
H310_08590                                                            692        0.0   
H257_08436                                                            681        0.0   
SPRG_14103                                                            664        0.0   
SDRG_16720                                                            660        0.0   
SPRG_04074                                                            400        2e-132
SDRG_14408                                                            399        1e-131
PHYSO_254571                                                          236        2e-69 
SPRG_11769                                                            233        1e-68 
PHALS_08068                                                           234        1e-68 
PPTG_18033                                                            232        7e-68 
SDRG_03823                                                            231        2e-67 
SDRG_03822                                                            231        2e-67 
SDRG_12187                                                            229        3e-67 
PHYCA_504517                                                          230        4e-67 
PPTG_09787                                                            228        2e-66 
PHYRA_71927                                                           228        3e-66 
CCA23647                                                              228        4e-66 
H310_14447                                                            228        4e-66 
SPRG_05609                                                            227        5e-66 
PYIR_17506                                                            226        2e-65 
PITG_14083                                                            226        2e-65 
PITG_13427                                                            225        2e-65 
PHYKE_10327                                                           236        2e-65 
CCI11048                                                              225        3e-65 
PYAP_23435                                                            234        3e-65 
SDRG_11131                                                            225        3e-65 
SDRG_15045                                                            224        1e-64 
PHYSO_550665                                                          223        1e-64 
PHYRA_72037                                                           223        3e-64 
PHYCA_7619                                                            221        5e-64 
PYAP_21882                                                            221        1e-63 
H257_09722                                                            221        2e-63 
PYAR_17512                                                            221        2e-63 
H257_17037                                                            220        2e-63 
PYIW_25301                                                            219        7e-63 
H310_11259                                                            214        5e-61 
HYAP_08763                                                            213        9e-61 
PHALS_09136                                                           211        4e-60 
PHYKE_6836                                                            210        9e-60 
HYAP_04843                                                            206        6e-59 
PYVX_21517                                                            182        2e-49 
PYAR_17714                                                            176        9e-48 
PYIR_23431                                                            172        6e-46 
PYVX_16175                                                            161        4e-42 
CCA22989                                                              135        5e-33 
CCI10477                                                              135        6e-33 
PYAP_22645                                                            135        6e-32 
PYIR_20273                                                            132        8e-32 
PYVX_21248                                                            126        1e-29 
SPRG_09825                                                            125        1e-29 
SPRG_19943                                                            122        2e-29 
SDRG_06945                                                            123        7e-29 
PYU1_G001737                                                          112        3e-28 
PHYKE_9680                                                            119        2e-27 
PHYRA_72215                                                           114        6e-26 
HYAP_12621                                                            114        7e-26 
PHYSO_556052                                                          114        8e-26 
PYU1_G014259                                                          109        9e-26 
H310_02523                                                            112        3e-25 
PYAR_20075                                                            112        5e-25 
H257_16541                                                            112        5e-25 
PHALS_09942                                                           111        9e-25 
PITG_15359                                                            109        3e-24 
PHYCA_123621                                                          107        2e-23 
PHYRA_73883                                                           101        2e-21 
PYAP_19280                                                            100        5e-21 
PYVX_20512                                                            99.8       6e-21 
PYIW_25190                                                            93.6       9e-21 
PYAR_16840                                                            98.2       2e-20 
CCI50816                                                              99.0       3e-20 
CCA16670                                                              97.1       5e-20 
PHALS_12028                                                           94.7       4e-19 
PYIR_14132                                                            94.4       4e-19 
H257_01186                                                            93.2       8e-19 
PPTG_00938                                                            93.2       1e-18 
PYIW_19795                                                            92.4       1e-18 
PYIW_24688                                                            88.6       2e-18 
PHYCA_504445                                                          91.3       4e-18 
PHYRA_47253                                                           90.5       5e-18 
PITG_18935                                                            90.5       5e-18 
PYU1_G011605                                                          90.5       6e-18 
PPTG_09121                                                            90.1       8e-18 
H310_00561                                                            89.4       1e-17 
HYAP_04149                                                            89.4       1e-17 
SDRG_14446                                                            88.6       2e-17 
PYIW_20257                                                            87.8       4e-17 
PYU1_G005699                                                          87.4       6e-17 
SDRG_05060                                                            87.0       8e-17 
SPRG_12054                                                            86.7       1e-16 
PPTG_13000                                                            85.1       1e-16 
PHYSO_489418                                                          85.5       2e-16 
PHYCA_555180                                                          84.0       8e-16 
PHALS_10055                                                           83.6       8e-16 
H257_07450                                                            82.8       2e-15 
PYAP_19148                                                            82.4       2e-15 
CCI39993                                                              81.6       4e-15 
H310_07641                                                            80.5       9e-15 
PHYKE_9807                                                            80.1       1e-14 
CCA14030                                                              79.7       2e-14 
PYVX_23499                                                            79.0       2e-14 
PYAR_16664                                                            77.8       8e-14 
PITG_01778                                                            77.0       1e-13 
PHYKE_2864                                                            73.2       2e-12 
PHYSO_562795                                                          68.6       3e-11 
PITG_19065                                                            67.4       1e-10 
HYAP_08069                                                            63.9       4e-10 
PYIR_21896                                                            64.3       1e-09 
SPRG_04114                                                            60.1       2e-08 
PPTG_24712                                                            51.2       2e-07 
HYAP_13613                                                            55.1       9e-07 
PITG_19802                                                            47.8       4e-05 
PYIW_27568                                                            40.0       0.007 
SPRG_04231                                                            38.5       0.010 
PYU1_G014369                                                          41.6       0.018 
HYAP_03065                                                            40.0       0.045 
PHYSO_507629                                                          38.9       0.12  
SPRG_17626                                                            36.6       0.14  
PPTG_08060                                                            38.5       0.16  
PHYRA_74125                                                           37.7       0.28  
PHALS_10960                                                           37.0       0.43  
HYAP_08068                                                            34.3       0.45  
PYVX_14222                                                            37.0       0.49  
PHYKE_2744                                                            33.9       0.91  
CCI50227                                                              35.8       1.1   
PHYSO_300621                                                          35.0       2.0   
PITG_00703                                                            34.7       2.1   
PYAP_17256                                                            34.3       2.6   
PHYRA_87328                                                           34.3       3.0   
PHYRA_72196                                                           34.3       3.2   
PYU1_G000378                                                          34.3       3.3   
PHYKE_6590                                                            33.9       3.9   
PYIR_13336                                                            33.9       4.5   
H257_04029                                                            33.9       4.7   
PYIW_16666                                                            33.5       5.5   
PYAR_15823                                                            32.7       9.8   
PYU1_G006877                                                          32.7       9.8   

>PHALS_06481
Length=644

 Score = 1300 bits (3364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/633 (100%), Positives = 633/633 (100%), Gaps = 0/633 (0%)

Query  1    MANNISNTTLSLTKISCLLEAQEVVSDTLATFYLAGWKTCPSFIKAREIVAAMQMLYPDR  60
            MANNISNTTLSLTKISCLLEAQEVVSDTLATFYLAGWKTCPSFIKAREIVAAMQMLYPDR
Sbjct  1    MANNISNTTLSLTKISCLLEAQEVVSDTLATFYLAGWKTCPSFIKAREIVAAMQMLYPDR  60

Query  61   LAFKILLFEDREKFRVWLKASQGDFAVSFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLL  120
            LAFKILLFEDREKFRVWLKASQGDFAVSFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLL
Sbjct  61   LAFKILLFEDREKFRVWLKASQGDFAVSFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLL  120

Query  121  LFFRSGIAVGRPQGMHTSDEVAEISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQ  180
            LFFRSGIAVGRPQGMHTSDEVAEISSTAVQEKPIFDYDLVVIGGGLGGLACSKEAASFGQ
Sbjct  121  LFFRSGIAVGRPQGMHTSDEVAEISSTAVQEKPIFDYDLVVIGGGLGGLACSKEAASFGQ  180

Query  181  KVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGK  240
            KVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGK
Sbjct  181  KVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGK  240

Query  241  TVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQ  300
            TVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQ
Sbjct  241  TVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQ  300

Query  301  ITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKG  360
            ITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKG
Sbjct  301  ITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKG  360

Query  361  MGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVD  420
            MGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVD
Sbjct  361  MGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVD  420

Query  421  EKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDV  480
            EKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDV
Sbjct  421  EKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDV  480

Query  481  VDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGE  540
            VDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGE
Sbjct  481  VDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGE  540

Query  541  DNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMG  600
            DNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMG
Sbjct  541  DNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMG  600

Query  601  LAMRLRFTYDQMVNTVGIHPMTAESLTILEVTK  633
            LAMRLRFTYDQMVNTVGIHPMTAESLTILEVTK
Sbjct  601  LAMRLRFTYDQMVNTVGIHPMTAESLTILEVTK  633

>PHYCA_556160
Length=649

 Score = 1013 bits (2620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/621 (77%), Positives = 543/621 (87%), Gaps = 15/621 (2%)

Query  28   TLATFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAV  87
            ++ATF++AGWKTCPSF+KA E+  AMQMLYPDR+ F++  FEDRE F+ WL  SQ +FA 
Sbjct  18   SVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKHWLSESQDEFAT  77

Query  88   SFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQG-------------  134
            SFG  SKA KHVTSPFVWSSNPT FVGGCDDLL +FRSG+ VG PQG             
Sbjct  78   SFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQGATPNGSPTEKTAE  137

Query  135  --MHTSDEVAEISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSP  192
              +  S+   E +STA  E+  +DYDLVVIGGG GGLACSKEAASFGQKVCVLDYVKPSP
Sbjct  138  ADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSP  197

Query  193  QGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVA  252
            QGT+WGLGGTCVNVGCIPKKL+HQSSLIGE+I HD A FGW   +     P F+WKQLV+
Sbjct  198  QGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVS  257

Query  253  NVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGS  312
            NVDGYIK+INFKYKV+LRSK VKYENFLGSFV+PHT++L HPRKGTKQITTR+VVIAVG 
Sbjct  258  NVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGG  317

Query  313  RPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI  372
            RP+ELTCPGGE+A+SSDDIFWMK+KEPGKTLV+GASYVALECAGFLKGMGY+VKVMVRSI
Sbjct  318  RPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  377

Query  373  LLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNT  432
            LLR FDQ+MADKIGEYMEVQSGI+FIRKTVPQSI++LEN QLLVKW  E G++CEEAF+T
Sbjct  378  LLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDT  437

Query  433  VLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQ  492
            VLNATGRDP+VA L LDKAGVKLNEK+GRI VKNEQTST NIYAIGDV+DAPELTPVAIQ
Sbjct  438  VLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQ  497

Query  493  SGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVP  552
            +GRLLS+RLYNNS+VQMDY+KVCT VFTPIEYGCCG+SEE SK R+GEDNIE+YHTNFVP
Sbjct  498  AGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVP  557

Query  553  LEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQM  612
            LEWSLS++TRTA+ SCY+KV+CDK+RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQM
Sbjct  558  LEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617

Query  613  VNTVGIHPMTAESLTILEVTK  633
            V+TVGIHP TAES T LEVTK
Sbjct  618  VDTVGIHPTTAESFTTLEVTK  638

>PITG_18452
Length=856

 Score = 997 bits (2577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/629 (76%), Positives = 541/629 (86%), Gaps = 21/629 (3%)

Query  24   VVSDTLATFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQG  83
             +S ++ATFY+AGWK+C SF+KARE+ AAMQMLYPDR+AF+   FEDR  F+ WL ASQ 
Sbjct  14   ALSSSVATFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQD  73

Query  84   DFAVSFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTS-----  138
            D    FGA S+A KHVTSPFVWSS  T FVGGCD+LL FFRSGIAVG+PQG+  S     
Sbjct  74   DITAHFGADSRATKHVTSPFVWSS--TIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPT  131

Query  139  --------------DEVAEISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCV  184
                          D  AE SSTA +E+  +DYDLVVIGGG GGLACSKEAASFGQKVCV
Sbjct  132  PSSALAPETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSKEAASFGQKVCV  191

Query  185  LDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPV  244
            LDYVKPSPQGT+WGLGGTCVNVGCIPKKL+HQSSLIGE++ HDSA FGW   +   + P+
Sbjct  192  LDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPI  251

Query  245  FDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTR  304
            FDWKQLV NVDGYI+ INFKYKV+LRSK VKYENFLGSF+DPHT++L HPRKG+KQITTR
Sbjct  252  FDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTR  311

Query  305  NVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYE  364
            +VVIAVG RPRELT PGGE+A+SSDDIFWMK KEPGKTLV+GASYVALECAGFLKGMGY+
Sbjct  312  DVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYD  371

Query  365  VKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGK  424
            VKVMVRSILLR FDQ+MA+KIGEYMEVQSGI+FIRKTVPQSI++LEN QLLVKW  E G+
Sbjct  372  VKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGE  431

Query  425  TCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAP  484
            +CEEAF++VLNATGRDP++A L LDKAGVKLNEKTGRI VK+EQTST NIYAIGDV+DAP
Sbjct  432  SCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAP  491

Query  485  ELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIE  544
            ELTPVAIQ+GRLLS+RLYNN++VQMDYDKVCT VFTPIEYGCCGLSEE S  R+G+D IE
Sbjct  492  ELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIE  551

Query  545  IYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMR  604
            +YHTNFVPLEWSLS+ETR A+ SCY+KV+CD+ RDKFV+GFHYLGPNAGEV QAMGLAM+
Sbjct  552  VYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMK  611

Query  605  LRFTYDQMVNTVGIHPMTAESLTILEVTK  633
            L FTYDQMV+TVGIHP TAES T LEVTK
Sbjct  612  LGFTYDQMVDTVGIHPTTAESFTTLEVTK  640

>PHYKE_8391
Length=778

 Score = 972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/633 (75%), Positives = 542/633 (86%), Gaps = 18/633 (3%)

Query  28   TLATFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAV  87
            ++ TF+++GW+TCPSF KA E+ AAMQMLYPD+++F+   FEDR+ F+ WL  S+  F +
Sbjct  148  SVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQWLSTSKDHFVM  207

Query  88   SFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSD--------  139
             FGA SKA+ HVTSPFVWSSNP  FVGGCDDLL FFRSG+AVG PQG   ++        
Sbjct  208  HFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQGADPAEKAEAAASI  267

Query  140  EVAEISSTA-------VQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSP  192
            EVAE S T        ++E+  +DYDLVVIGGG GGLACSKEAASFGQKVCVLDYVKPSP
Sbjct  268  EVAESSMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSP  327

Query  193  QGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKF-DNEGKTVPVFDWKQLV  251
            QGT+WGLGGTCVNVGCIPKKL+HQSSLIGE + HDSA FGW     EGK    FDWKQLV
Sbjct  328  QGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGA-TFDWKQLV  386

Query  252  ANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVG  311
            +NVD YIK+INFKYKV+LRSK VKYENFLGSF+DPHT++L HPRKGTKQITTR+VV+AVG
Sbjct  387  SNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVG  446

Query  312  SRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRS  371
             RP++LTCPG EYA+SSDDIFWMK+  PGKTLV+GASYVALECAGFLKGMGY+VKVMVRS
Sbjct  447  GRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  506

Query  372  ILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFN  431
            ILLR FDQ+MA+KIGEYMEVQ+GI+FIRKTVP+SI++LEN QLLVKW  E  ++CEE F+
Sbjct  507  ILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFD  566

Query  432  TVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAI  491
            TVLNATGRDP+VA LGLDKAGVKLNEKTGRI  KNEQTST NI+AIGDV+DAPELTPVAI
Sbjct  567  TVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAI  626

Query  492  QSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFV  551
            Q+GR LS+RLYNNS+VQMDYDKVCT VFTPIEYGCCGLSEE S  R+GEDN+E+YH NFV
Sbjct  627  QAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFV  686

Query  552  PLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQ  611
            PLEWSL SE+RT+S SCY+KV+CD +RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQ
Sbjct  687  PLEWSL-SESRTSSESCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  745

Query  612  MVNTVGIHPMTAESLTILEVTKssggattgggC  644
            MV+TVGIHP TAE+ T LEVTKSSG  TTGGGC
Sbjct  746  MVDTVGIHPTTAEAFTTLEVTKSSGATTTGGGC  778

>HYAP_07095
Length=613

 Score = 899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/613 (72%), Positives = 504/613 (82%), Gaps = 21/613 (3%)

Query  53   MQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGAKSKAMKHVTSPFVWSSNPTTF  112
            M ++YP R+AF+   FEDR+ F+ WL  S  DF   FG  SKA  HVTSPFVW SNPTTF
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60

Query  113  VGGCDDLLLFFRSGIAVGRPQGM-------HTSDEVAEISSTA--------------VQE  151
            VGGCDDLL  FRSGIAVG  Q +        T D  A +  TA              V++
Sbjct  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120

Query  152  KPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPK  211
               +DYDLVVIGGG GGLACSKEAASFG+KVCVLDYVKPSP GT+WGLGGTCVNVGCIPK
Sbjct  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180

Query  212  KLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRS  271
            KL+HQSSLIGEI+ HD A FGW   +    VP FDWKQLV+NV  YIK+I+FKYKV+LRS
Sbjct  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRS  240

Query  272  KNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDI  331
            K VKYEN LGSFVDPHT+KL HP+KGTK+ITTR+VVIAVG RPR+L C GGE AVSSDDI
Sbjct  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300

Query  332  FWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEV  391
            FWMK+KEPGKTLV+GASYVALECAGFLKGMGY VKVMVRSILLR FDQ+MA KIGEYME+
Sbjct  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360

Query  392  QSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKA  451
            QSGI+FIRKTVPQSI++L++ QLLVKW+ E G   EE F+TVLNATGRDP+VA LGLD+A
Sbjct  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420

Query  452  GVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDY  511
            GVKLNEKTGRI V NEQT+T N+YAIGDV+DAPELTPVAIQ+GRLLS+RLYN  +VQMDY
Sbjct  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480

Query  512  DKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIK  571
            DK+CT VFTPIEYGCCGLSEE SK  YG+D++E+YH NFVPLEWSL+ +TR A+ SCY+K
Sbjct  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540

Query  572  VVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTILEV  631
            VVCDK+R+ FVLGFHYLGPNAGEV QAMGLAM+L FTYDQ+V+TVGIHP TAE+ T LE 
Sbjct  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFTTLET  600

Query  632  TKssggattgggC  644
            TKSSG +TTGGGC
Sbjct  601  TKSSGDSTTGGGC  613

>PYAP_17761
Length=622

 Score = 845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/608 (67%), Positives = 488/608 (80%), Gaps = 11/608 (2%)

Query  26   SDTLATFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDF  85
            S   AT+Y+AGW TCP + KAR++  AMQ+LY D +A + + FE R+ F+ WL  S   F
Sbjct  15   SGAPATYYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESRDAFKAWLAESNAAF  74

Query  86   AVSFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEIS  145
            A +FG  S A+ H +SPFVWS N   F+GGCD  L  FRSG+A  RP    ++     ++
Sbjct  75   AQAFGTDSPALTHTSSPFVWS-NARGFIGGCDATLAHFRSGVAA-RPLAGPSASPT--MT  130

Query  146  STAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVN  205
              AV E   +DYDLVVIGGG GGLACSKEAA +G+KVCVLDYVKPSP GT WGLGGTCVN
Sbjct  131  PVAVDESKTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTCVN  190

Query  206  VGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKY  265
            VGCIPKKL+HQS+LIGE++  D+  FGW    +      F W QLV +V+ YIK INFKY
Sbjct  191  VGCIPKKLMHQSALIGELMHKDAGAFGWNMGEQK-----FTWTQLVESVNNYIKGINFKY  245

Query  266  KVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYA  325
            KV+LR K VKYENFLGSFVDPHT++L H +KGTK ITTR+VV+AVG RPR+L+CPGGE+A
Sbjct  246  KVELRDKKVKYENFLGSFVDPHTIELWHHKKGTKTITTRHVVVAVGGRPRQLSCPGGEHA  305

Query  326  VSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKI  385
            +SSDDIFW K  EPGKTLV+GASYVALECAGFLKGMGYEVKVMVRSILLR FD++MA++I
Sbjct  306  ISSDDIFWRK-TEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMANRI  364

Query  386  GEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAH  445
            G++M+ +S I+FIR  VP+SI +LEN QLLVKW    G+T EE F++VLNATGRDP+V+ 
Sbjct  365  GDFMQDESKIEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDVSK  424

Query  446  LGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNS  505
            L LDKAGV+LN KTGRI V NEQTST N++AIGDV+DAPELTPVAIQ+GRLL++RLYNN 
Sbjct  425  LNLDKAGVQLNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYNNE  484

Query  506  SVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTAS  565
            +  MDYDKVCT VFTPIEYGCCGLSEE +K +YGEDN+EIYH +F+PLEWSLS + R A+
Sbjct  485  TTLMDYDKVCTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLSQD-RVAA  543

Query  566  NSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAES  625
            N+CY+KV+CDK+RDK+V+GFHYLGPNAGEV QAMGLAM++ FTYDQMVN VGIHP TAE 
Sbjct  544  NTCYVKVICDKTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHPTTAEV  603

Query  626  LTILEVTK  633
             T LEVTK
Sbjct  604  FTTLEVTK  611

>PHYSO_348901
Length=526

 Score = 840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/479 (83%), Positives = 440/479 (92%), Gaps = 0/479 (0%)

Query  155  FDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            +DYDLVVIGGG GGLACSKEAASFGQKVCVLDYVKPSPQGT+WGLGGTCVNVGCIPKKL+
Sbjct  37   YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            HQSSLIGE++ HDSA FGW   +   +   F WKQLVANVDGYI+ INFKYKV+LRSK V
Sbjct  97   HQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
            KYENFLGSFVD HT++L HPRKGTKQITTR+VVIAVG RP+ELTCPGGE+A+SSDDIFWM
Sbjct  157  KYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWM  216

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSG  394
            K+KEPGKTLV+GASYVALECAGFLKGMGY+VKVMVRSILLR FDQ+MA+KIGEYMEVQSG
Sbjct  217  KKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  276

Query  395  IKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVK  454
            I+FIRKTVPQSI++LEN QLLVKW  E G++CEEAF+TVLNATGRDP+VA LGLDKA VK
Sbjct  277  IEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVK  336

Query  455  LNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKV  514
            LNEKTGRI VKNEQTST NIYAIGDV+DAPELTPVAIQ+GRLLS+RLYNNS+ QMDYDK+
Sbjct  337  LNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKI  396

Query  515  CTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVC  574
            CT VFTPIEYGCCGLSEE SK RYGEDNIE+YH NFVPLEWSLS ETRTA+ SCY+KV+C
Sbjct  397  CTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVIC  456

Query  575  DKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTILEVTK  633
            DK+RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQMV+TVGIHP TAE+ T LE+TK
Sbjct  457  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAETFTTLEITK  515

>PHYRA_50855
Length=489

 Score = 837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/479 (83%), Positives = 447/479 (93%), Gaps = 2/479 (0%)

Query  155  FDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            +DYDLVVIGGG GGLACSKEAASFG+KVCVLDYVKPSPQGT+WGLGGTCVNVGCIPKKL+
Sbjct  2    YDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            HQSSLIGE++ HDSA FGW   +EG + P F+WKQLV+NVD YIK+INFKYKV+LRSK V
Sbjct  62   HQSSLIGEVMHHDSANFGWNVASEG-SAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
            KYENFLGSFVDPHT++L H RKGTKQITTR+VVIAVG RP+EL+CPGGE+A+SSDDIFWM
Sbjct  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSG  394
            K+KEPGKTLV+GASYVALECAGFLKGMGYEVKVMVRSILLR FDQ+MA+KIGEYMEVQSG
Sbjct  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG  240

Query  395  IKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVK  454
            I+FIRKTVPQSI+ LEN QLLVKW +E G++CEEAF+TVLNATGRDP+VA LGLDKAGVK
Sbjct  241  IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK  300

Query  455  LNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKV  514
            LNEK+GRI VKNEQTSTSNIYA+GDV+DAPELTPVAIQ+GRLLS+RLYNNS+ QMDY+KV
Sbjct  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360

Query  515  CTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVC  574
            CT VFTPIEYGCCGLSEE SK R+GEDN+E+YHTNFVPLEWSL SETRT++ SCY+KV+C
Sbjct  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSL-SETRTSAESCYVKVIC  419

Query  575  DKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTILEVTK  633
            DK+RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQMV+TVGIHP TAES T LEVTK
Sbjct  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478

>PYIR_13452
Length=645

 Score = 826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/615 (66%), Positives = 488/615 (79%), Gaps = 13/615 (2%)

Query  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQG--DFAVSF  89
            +++AGW+ C  + KA ++V AM++LYPD + F++  F DRE FR WL AS    +    F
Sbjct  42   YHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECF  101

Query  90   GAKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEISSTAV  149
            GA SKA+ H +SPFVW+ N   F+GGCDD L  FRSG++   P  +  +  +   +    
Sbjct  102  GADSKALTHKSSPFVWA-NTRGFIGGCDDTLALFRSGVSA--PATLAATPTMVAAAPAPA  158

Query  150  QEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCI  209
             +   +DYDL+VIGGG GGLACSKEA+ +G+KVCVLDYVKPSP GT+WGLGGTCVNVGCI
Sbjct  159  DDAK-YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCI  217

Query  210  PKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKL  269
            PKKL+HQSSLIGE I  D+  FGW    +      FDW Q++ +V+ YIK+INFKYKV+L
Sbjct  218  PKKLMHQSSLIGETIHKDAKAFGWTVGEQ-----TFDWSQMLKSVNSYIKSINFKYKVEL  272

Query  270  RSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSD  329
            R K VKYEN LGSFVD HT++L HP+KGTK +TTR+VVIAVG RP+ L+C GG+ A+SSD
Sbjct  273  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSD  332

Query  330  DIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYM  389
            DIFW KE  PGKTLV+GASYVALECAGF+KGMGY+VK+MVRSILLR FDQ+MA+KIGE+M
Sbjct  333  DIFWRKEA-PGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFM  391

Query  390  EVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLD  449
            E +S I+FIR  VPQSI++LE+ QLLVKWV   G+TCEEAF+TVLNATGRDP+VA LGLD
Sbjct  392  ETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLD  451

Query  450  KAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQM  509
            K GVKLN KTGRI V NEQTST NIYAIGDV+DAPELTPVAIQ+GRLL++RLYNN +  M
Sbjct  452  KVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALM  511

Query  510  DYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCY  569
            DYDKVCT VFTPIEYGCCGLSEE S  +YGE+N+EIYH NF PLEWSLSS+ R A+ SCY
Sbjct  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCY  570

Query  570  IKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +KV+CD  R+K V+GFHYLGPNAGEV QA+GLAM+L FTYDQMVN VGIHP TAE  T L
Sbjct  571  VKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630

Query  630  EVTKssggattgggC  644
            EVTKSSG +   GGC
Sbjct  631  EVTKSSGESAASGGC  645

>PYIW_19972
Length=609

 Score = 773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/614 (64%), Positives = 467/614 (76%), Gaps = 36/614 (6%)

Query  31   TFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFG  90
            T+++AGW+ C  + KA +++ AM++LYPD +  +I  F DRE FR WL AS  DFA +FG
Sbjct  32   TYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREAFRAWLSASAADFAANFG  91

Query  91   AKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEISSTAVQ  150
            A SKA  H +SPF                              G   S     +++  V 
Sbjct  92   ADSKAATHTSSPFF-----------------------------GKDESPTPTMVAAPVVD  122

Query  151  EKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIP  210
            +   +DYDL+VIGGG GGLACSKEAA +G+KVCVLDYVKPSP GT WGLGGTCVNVGCIP
Sbjct  123  DNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIP  182

Query  211  KKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLR  270
            KKL+HQSSLIGE I  D+A FGW    +      FDW Q++ +V+ YIK+INFKYKV+LR
Sbjct  183  KKLMHQSSLIGETIHKDAAAFGWSVGEQK-----FDWAQMLKSVNSYIKSINFKYKVELR  237

Query  271  SKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDD  330
             K VKYEN LGSFVD HT++L HP+KGTK +TTR+VVIAVG RP+ L+C GGE A+SSDD
Sbjct  238  DKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDD  297

Query  331  IFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYME  390
            IFW KE  PGKTLVIGASYVALECAGF+KGMGY+VK+MVRSILLR FDQ+MA KIGE+ME
Sbjct  298  IFWRKEA-PGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFME  356

Query  391  VQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDK  450
            V+S I+FIR  VPQSI++LE+ QLLVKWV   G  CEEAF+TVLNATGRDP+VA L LD 
Sbjct  357  VESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDS  416

Query  451  AGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMD  510
             GV+LN KTGRI V NEQTS  NI+AIGDV+DAPELTPVAIQ+GR+L++RLYNN +  MD
Sbjct  417  VGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMD  476

Query  511  YDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYI  570
            YDKVCT VFTPIEYGCCGLSEE S  ++GED +EIYH NF PLEWSLSS+ R A+ SCY+
Sbjct  477  YDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD-RQAAGSCYV  535

Query  571  KVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTILE  630
            KV+CD +R+K V+GFHYLGPNAGEV QA+GLAM+L FTYD MVN VGIHP TAE  T LE
Sbjct  536  KVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLE  595

Query  631  VTKssggattgggC  644
            VTKSSG +   GGC
Sbjct  596  VTKSSGESAAAGGC  609

>PYVX_18170
Length=510

 Score = 728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/546 (66%), Positives = 428/546 (78%), Gaps = 36/546 (7%)

Query  99   VTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEISSTAVQEKPIFDYD  158
            ++SPFVW+SNPT FVGGCD LL  FRS   V RP          E+              
Sbjct  1    MSSPFVWTSNPTAFVGGCDALLDRFRS--QVPRPNAASKPQANGEV--------------  44

Query  159  LVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSS  218
                           EA+ FGQKV VLDYVKPSPQGT WGLGGTCVNVGCIPKKL+HQS+
Sbjct  45   ---------------EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSA  89

Query  219  LIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYEN  278
            LIGE++  D+A FGW+F+N     P FDW QL ++V  YIKT+NFKYKV LR K VKYEN
Sbjct  90   LIGEVMHKDAALFGWQFEN----APKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYEN  145

Query  279  FLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKE  338
            FLG+FVDPHT++LS+PRK +K +TTR VV+AVG RPR L CPGGE +++SDDIFW K   
Sbjct  146  FLGAFVDPHTIELSNPRKPSKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFWRK-TA  204

Query  339  PGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFI  398
            PGKTLV+GASYVALECAGFLKG GY+VKVMVRSILLR FDQ+MA++IGEYMEV++GI+FI
Sbjct  205  PGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFI  264

Query  399  RKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEK  458
            R+TVP SI++LE+ +LLVKW    G   EEAF+TVLNATGR+P+V  L LDKAGVKLN K
Sbjct  265  RETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPK  324

Query  459  TGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTV  518
            TGRI+V NEQTST NI+AIGDV+DAPELTPVAIQ+GRLL++RLYNN +  MDY+KVCT V
Sbjct  325  TGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAV  384

Query  519  FTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSR  578
            FTPIEYGCCGLSEE S  R+GEDNIE+YH NF PLEW+LS +TR +  +CY+KV+CDK+R
Sbjct  385  FTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTR  444

Query  579  DKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTILEVTKssgga  638
            D FV+GFHYLGPNAGEV QA+GLAM+L FTY+QMV+ VGIHP TAE+ T LEVTKSSG +
Sbjct  445  DLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPTTAETFTTLEVTKSSGAS  504

Query  639  ttgggC  644
              GG C
Sbjct  505  AAGGNC  510

>PYAR_13569
Length=494

 Score = 706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/485 (70%), Positives = 402/485 (83%), Gaps = 7/485 (1%)

Query  149  VQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGC  208
            V ++  +DYDLVVIGGG GGLACSKEAA  G+KV VLDYVKPSP GT WGLGGTCVNVGC
Sbjct  6    VDDEATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVGC  65

Query  209  IPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVK  268
            IPKKL+HQS+L+GE++  D+  FGW    +      F W QLVA+V+ YIK INFKYKV+
Sbjct  66   IPKKLMHQSALLGELMHKDAPAFGWTTGAQS-----FTWTQLVASVNNYIKGINFKYKVE  120

Query  269  LRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSS  328
            LR K VKYENFLGSFVD HT++L H +K  K +TTR+VVIAVG RPR LTCPGGE+A+SS
Sbjct  121  LRDKKVKYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISS  180

Query  329  DDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEY  388
            DDIFW K  EPGKTLV+GASYVALECAGFLKGMGY+VK+MVRSILLR FDQ+MA++IG++
Sbjct  181  DDIFWRK-TEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDF  239

Query  389  MEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGL  448
            M+ +S I+FIR  VP+SI + EN +LLVKW    G   EE F+TVLNATGRDP+V  L L
Sbjct  240  MQDESRIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNL  299

Query  449  DKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQ  508
            DKAGV+LN K+GRI   NEQTST NI+AIGDV+DAPELTPVAIQ+GRLL++RLYNN +  
Sbjct  300  DKAGVELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTL  359

Query  509  MDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSC  568
            MDYDK+CT VFTPIEYGCCGLSEE +K +YGE+N+EIYH +F+PLEWSLS E R A+ +C
Sbjct  360  MDYDKICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEE-RVAAATC  418

Query  569  YIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            Y+KV+CDK+RDK V+GFHYLGPNAGEV QAMGLAM++ FTYDQMVN VGIHP TAE  T 
Sbjct  419  YVKVICDKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTT  478

Query  629  LEVTK  633
            LE+TK
Sbjct  479  LEITK  483

>H310_08590
Length=640

 Score = 692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/621 (56%), Positives = 442/621 (71%), Gaps = 25/621 (4%)

Query  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGA  91
            +++ GWK CP ++KA  +V++MQ L+P ++   I    ++E F  WL  SQ +FA  F  
Sbjct  37   YHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQFDN  96

Query  92   KSKAMKHVTSPFVWSSNPTT--FVGGCDDLLLFFR----SGIAVGRPQGMHTSDEVAEIS  145
             ++ +KH +SPF +     T  FVGGCDD L FFR    S  + G P   +     A +S
Sbjct  97   DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAAN-----AHVS  151

Query  146  STAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVN  205
             T+  ++  +D+DLVVIGGG GGLACSKEA+  GQKV VLDYVKPSP G+ WGLGGTCVN
Sbjct  152  DTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVN  211

Query  206  VGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKY  265
            VGCIPKKL+HQSS+IGE++  D+ +FGW   N       FDW +LV++V  YI  +NFKY
Sbjct  212  VGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNAS-----FDWTKLVSSVQDYIHGLNFKY  266

Query  266  KVKLRSKNVKYENFLGSFVDPHTVKLSH--PRKGTKQITTRNVVIAVGSRPRELTCPGGE  323
            ++ LR K VKYEN LG+F D HT+ L++   +KG   +T R  VIAVG RP+ L+CPG E
Sbjct  267  RIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWE  326

Query  324  YAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMAD  383
            +A+SSDDIF  K + PGKTLV+GASYVALECAGFLKG G++V +MVRSILLR FDQ++A 
Sbjct  327  HAISSDDIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIAR  385

Query  384  KIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEV  443
            +IGEYME +SGI FI+++VP SI +L N QL V     +G      ++TVLNATGR P+V
Sbjct  386  RIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDV  440

Query  444  AHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYN  503
              L L  AGV LN K+GRI V NEQTST +IYAIGDV+DAPELTPVAIQ+G+LL++RL+ 
Sbjct  441  QMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFG  500

Query  504  NSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRT  563
            N +  MDY K+CT VFTP+EYGCCGLSEE +    G DNI++YH NF PLEWSLS E R 
Sbjct  501  NGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-RP  559

Query  564  ASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTA  623
             +  CY K++ D ++ K V+GFHYLGPNAGEV QA+G+AM+L  TYD  VNTVGIHP TA
Sbjct  560  LAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTA  619

Query  624  ESLTILEVTKssggattgggC  644
            E  T LE+TK SG   +  GC
Sbjct  620  EIFTTLEITKESGEDASASGC  640

>H257_08436
Length=642

 Score = 681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/617 (56%), Positives = 438/617 (71%), Gaps = 19/617 (3%)

Query  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGA  91
            +++ GWK CP ++KA  + ++MQ L+P ++   I    ++E F  WL  SQ +FA  F  
Sbjct  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100

Query  92   KSKAMKHVTSPFVWSSNPTT--FVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEISSTAV  149
             ++ +KH +SPF +     T  FVGGCDD L FFR+           ++   A  +S A 
Sbjct  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSAPASSASIHANDTSDAD  160

Query  150  QEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCI  209
             +   +D+DLVVIGGG GGLACSKEA+  GQKV VLDYVKPSP G+ WGLGGTCVNVGCI
Sbjct  161  VK---YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217

Query  210  PKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKL  269
            PKKL+HQSS+IGEI+  D+ +FGW   N       FDW +LV++V  YI  +NFKY+V L
Sbjct  218  PKKLMHQSSIIGEILHKDADQFGWSVSNA-----TFDWSKLVSSVQDYIHGLNFKYRVDL  272

Query  270  RSKNVKYENFLGSFVDPHTVKLSH--PRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVS  327
            R K VKYEN LG+F D HT+ L++   +KG   +T R  VIAVG RP+ L+CPG E+A+S
Sbjct  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  332

Query  328  SDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGE  387
            SDDIF  K   PGKTLV+GASYVALECAGFLKG G++V +MVRSILLR FDQ++A +IGE
Sbjct  333  SDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  391

Query  388  YMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLG  447
            YME +SGI FI+++VP SI +LEN Q  V        T ++ ++T+LNATGR P+V  L 
Sbjct  392  YMESESGIAFIKESVPTSIVKLENGQFQVTHT-----TGQDVYDTILNATGRSPDVQKLN  446

Query  448  LDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSV  507
            LD AGV LN K+GRI V NEQTST NIYA+GDV+DAPELTPVAIQ+G+LLS+RL+ N + 
Sbjct  447  LDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTT  506

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS  567
             MDY K+CT VFTP+EYGCCGLSEE +    G +N+E+YH NF PLEWSLS + R  +  
Sbjct  507  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD-RPLAKE  565

Query  568  CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLT  627
            CY K++ D ++ K VLGFHYLGPNAGEV QA+G+A++L  TYD  +NTVGIHP TAE  T
Sbjct  566  CYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFT  625

Query  628  ILEVTKssggattgggC  644
             LE+TK SG   +  GC
Sbjct  626  TLEITKESGVDASASGC  642

>SPRG_14103
Length=628

 Score = 664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/618 (55%), Positives = 431/618 (70%), Gaps = 22/618 (4%)

Query  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGA  91
            +++ GWK+CP + +A  + ++MQ L+P ++   I     ++ F  WL+ASQ  FA  F  
Sbjct  28   YHVVGWKSCPYYERAANVASSMQTLFPGQVKATIHEHATKQSFNDWLEASQATFATQFVG  87

Query  92   KSKAMKHVTSPFVWSSNP--TTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAE-ISSTA  148
             ++A  H TSPF +  +   T FVGGCDD L FFRS     R Q        A  + +  
Sbjct  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS-----RTQSAAAPSAPARNVHAND  142

Query  149  VQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGC  208
            V +   +D+DLVVIGGG GGLA SKEAA +GQKV VLDYVKPSPQG+ WGLGGTCVNVGC
Sbjct  143  VDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGC  202

Query  209  IPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVK  268
            IPKKL+HQS+++GE++  D+  FGW   N       FDW +LV +V  YI  +NFKY+V 
Sbjct  203  IPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLVTSVQDYIHGLNFKYRVD  257

Query  269  LRSKNVKYENFLGSFVDPHTVKLSHPRKGT--KQITTRNVVIAVGSRPRELTCPGGEYAV  326
            LR K VKYENFLG+F D HT+ L++P KG   K +T R  +IAVG RP+ L CPG + A+
Sbjct  258  LRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAI  317

Query  327  SSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIG  386
            SSDDIF  +   PGKTLV+GASYVALECAGFLK  G++V VMVRSILLR FD +MA +IG
Sbjct  318  SSDDIF-SRPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMVRSILLRGFDTDMAARIG  376

Query  387  EYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHL  446
             YME ++ I FI+  VP SI +L N QL V     +G      ++TVLNATGR+P+V+ L
Sbjct  377  TYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEG-----IYDTVLNATGRNPDVSGL  431

Query  447  GLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSS  506
             L  AGV LN KTGRI V +EQTS  +IYA+GDV+D PELTPVAIQ+GRLL++RL++NS+
Sbjct  432  NLPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTPVAIQAGRLLAKRLFDNSA  491

Query  507  VQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASN  566
              M YDKVCT VFTPIEYGCCGLSE+ +    G DN+ +YH +F PLEWSLS + R  + 
Sbjct  492  TLMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQSFTPLEWSLSHD-RALAK  550

Query  567  SCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
             CY K++ D++++  V+GFHYLGPNAGEV QA+G+AM+L  +YD  V+TVGIHP TAE  
Sbjct  551  ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNASYDDFVSTVGIHPTTAEIF  610

Query  627  TILEVTKssggattgggC  644
            T LE+TK SG   +  GC
Sbjct  611  TTLEITKESGLDASAAGC  628

>SDRG_16720
Length=628

 Score = 660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/618 (55%), Positives = 430/618 (70%), Gaps = 22/618 (4%)

Query  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGA  91
            +++ GWK+CP + +A  +  +MQ L+P ++   I     ++ F  WL+ SQ  FA  F  
Sbjct  28   YHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVG  87

Query  92   KSKAMKHVTSPFVWSSNP--TTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAE-ISSTA  148
             ++A  H TSPF +  +   T FVGGCDD L FFRS     R Q        A  + +  
Sbjct  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS-----RTQSAAAPSAPARNVHAND  142

Query  149  VQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGC  208
            V +   +D+DLVVIGGG GGLA SKEAA +GQKV VLDYVKPSPQG+ WGLGGTCVNVGC
Sbjct  143  VDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGC  202

Query  209  IPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVK  268
            IPKKL+HQS+++GE++  D+  FGW   N       FDW +L+ +V  YI  +NFKY+V 
Sbjct  203  IPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLITSVQDYIHGLNFKYRVD  257

Query  269  LRSKNVKYENFLGSFVDPHTVKLSHPRKGT--KQITTRNVVIAVGSRPRELTCPGGEYAV  326
            LR K VKYENFLG+F D HT+ L++P KG   K +T R  +IAVG RP+ L CPG + A+
Sbjct  258  LRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAI  317

Query  327  SSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIG  386
            SSDDIF  +   PGKTLV+GASYVALECAGFLKG G++V VMVRSILLR FD +MA +IG
Sbjct  318  SSDDIF-SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIG  376

Query  387  EYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHL  446
             YME ++ I FI+  VP SI +L N QL V     +G      ++TVLNATGR P+V+ L
Sbjct  377  TYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGL  431

Query  447  GLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSS  506
             L  AGV LN KTGRI V +EQTST +IYA+GDV+D PELTPVAIQ+GRLLS+RL++NS+
Sbjct  432  NLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSA  491

Query  507  VQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASN  566
              M YDKVCT VFTPIEYGCCGLSE+ +    G DN+ +YH +F PLEWSLS + R  + 
Sbjct  492  TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-RALAK  550

Query  567  SCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
             CY K++ D++++  V+GFHYLGPNAGEV QA+G+A++L  +Y+  V+TVGIHP TAE  
Sbjct  551  ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610

Query  627  TILEVTKssggattgggC  644
            T LE+TK SG   +  GC
Sbjct  611  TTLEITKESGLDASAAGC  628

>SPRG_04074
Length=509

 Score = 400 bits (1029),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 230/496 (46%), Positives = 310/496 (63%), Gaps = 25/496 (5%)

Query  155  FDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            FDYD VVIGGG GG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK++
Sbjct  4    FDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKIM  63

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            H S ++G  + HD+A  GW+   + +     +W+ LV  V  ++K +NF Y+V LRS  V
Sbjct  64   HYSGILGAGL-HDAAHLGWQVPEKVE----HNWETLVEAVQAHVKKLNFSYRVGLRSNKV  118

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPR-ELTCPG-GEYAVSSDDIF  332
            +Y N L  F DPHT+        T+ +T  +++IA G RP      PG  EYA++SDD+F
Sbjct  119  QYINALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDDLF  178

Query  333  WMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQ  392
             +    PGKTLV+G SY+ALECAGFL  + Y   V VRSILLR FD+++A KI + M V 
Sbjct  179  SLS-TAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-VA  236

Query  393  SGIKFIRKTVPQSISRLE-NRQLLVKWVD-EKGKTCEEAFNTVLNATGRDPEVAHLGLDK  450
             G+ F   T+P SI + E   QL V + + E  +T  EAF+TVL A GR  +  ++GL+K
Sbjct  237  QGMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGLEK  296

Query  451  AGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDA-PELTPVAIQSGRLLSQRLYN-NSSVQ  508
            AGVK     G+    NE T+  +I+A+GDV+   PELTPVAI++G  L +RL+  N +  
Sbjct  297  AGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKT  355

Query  509  MDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTAS---  565
            M+YD + TTVFTP+EYG  GLSEE +  RYG+D+I +Y   F  LEW      +  S   
Sbjct  356  MNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKAESAQE  415

Query  566  --------NSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVG  617
                     +C  K+VC KS ++ VLGFH++GPNAGEV Q   +A+ +  T +   N +G
Sbjct  416  GDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIG  475

Query  618  IHPMTAESLTILEVTK  633
            IHP  AES   L VTK
Sbjct  476  IHPTDAESFMALTVTK  491

>SDRG_14408
Length=528

 Score = 399 bits (1026),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 228/498 (46%), Positives = 312/498 (63%), Gaps = 29/498 (6%)

Query  155  FDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            FDYD VVIGGG GG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK++
Sbjct  23   FDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKIM  82

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            H S ++G  + HD+A  GW+   + +     +W+ LV  V  ++K +NF Y+V LRS  V
Sbjct  83   HYSGILGAGL-HDAAHLGWQLPEKVE----HNWETLVETVQAHVKKLNFSYRVGLRSNKV  137

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSR---PRELTCPG-GEYAVSSDD  330
            +Y N L  F DPHT+        T+ +T  +++IA G R   P+E+  PG GEYA++SDD
Sbjct  138  QYINALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEI--PGVGEYAITSDD  195

Query  331  IFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYME  390
            +F +    PGKTLV+G SY+ALECAGFL  + Y   V VRSILLR FD+++A KI + M 
Sbjct  196  LFSLT-TAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-  253

Query  391  VQSGIKFIRKTVPQSISRLE-NRQLLVKWVD-EKGKTCEEAFNTVLNATGRDPEVAHLGL  448
            V  G+ F   T+P SI + +   QL V + + E  +T  E F+TVL A GR  +  ++GL
Sbjct  254  VAQGMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFNIGL  313

Query  449  DKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDA-PELTPVAIQSGRLLSQRLYN-NSS  506
            +K GVK     G+    NE T+  +I+A+GDV+   PELTPVAI++G  L +RL+  N +
Sbjct  314  EKVGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYT  372

Query  507  VQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTAS-  565
              M+YD + TTVFTP+EYG  GLSEE +  RYG+D++ +Y   F  LEW      +  S 
Sbjct  373  KTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVHRQKAESA  432

Query  566  ----------NSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNT  615
                       +C  K+VC KS ++ VLGFH++GPNAGEV Q   +A+ +  T +   N 
Sbjct  433  QEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNV  492

Query  616  VGIHPMTAESLTILEVTK  633
            +GIHP  AES   L VTK
Sbjct  493  IGIHPTDAESFMALTVTK  510

>PHYSO_254571
Length=489

 Score = 236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 166/488 (34%), Positives = 256/488 (52%), Gaps = 36/488 (7%)

Query  156  DYDLVVIggglgglACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            +YD +VIG G GG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKL+
Sbjct  15   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKKLM  65

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPV---FDWKQLVANVDGYIKTINFKYKVKLRS  271
              ++ +   + HD   +G++ +  G  +     FDW +L A  D Y+  +N  Y+  L +
Sbjct  66   FIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  125

Query  272  KNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDI  331
              V        F D   V++       K+I  +NV+IAVG +P     PG E  + SD  
Sbjct  126  SKVALIRGSAKFNDKGNVEVD-----GKEILAKNVMIAVGGKPLIPDIPGKELCIDSDGF  180

Query  332  FWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYME  390
            F + E  P K  V+GA Y+A+E AG L  +G +  +  R   +LRSFD  +   + + M 
Sbjct  181  FEL-ETLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLEDAM-  238

Query  391  VQSGIKFIRKTVPQS-ISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLD  449
             + G+       P S I+R+E      K +     +    ++ V+ A GR P  ++L LD
Sbjct  239  AKDGVHL----RPHSNIARVEKADDGTKTLVLADGSEYSGYDVVIYAAGRVPLTSNLQLD  294

Query  450  KAGVKLNEKTGRIMVKN-EQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSV  507
            KAGV   +K G I V   ++TS S + A+GDV   P LTPVAI +GR LS RL+      
Sbjct  295  KAGVD-TDKNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDA  353

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS  567
            ++ Y+ + T VF+    G  GL+EE ++ +YG+D I++Y + FV + + L +E   A+  
Sbjct  354  KVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINEMDEATGE  413

Query  568  ------CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPM  621
                    +K+VC    +K V+G H +G  A E++Q  G+A+++  T     N V IHP 
Sbjct  414  PKDKPKTAMKLVCAGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCVAIHPT  472

Query  622  TAESLTIL  629
              E L  L
Sbjct  473  AGEELVTL  480

>SPRG_11769
Length=453

 Score = 233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 156/478 (33%), Positives = 251/478 (53%), Gaps = 39/478 (8%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YDLVV+GGG GG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+++ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVP--VFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            ++ +   +RHD+  +G+        VP    DW  L    D Y+  +N  Y   L+   V
Sbjct  56   AADLAHSMRHDAPAYGF------PAVPNTTVDWATLKQRRDAYVTRLNGIYARNLQGSGV  109

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
             + + L SF        S  R+G +++      +AVG +P     PG E+ +SSD  F +
Sbjct  110  DFAHGLCSFG-------SDGRRGDERL------VAVGGQPVMPDIPGIEHCISSDGFFEL  156

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI-LLRSFDQEMADKIGEYMEVQS  393
             E+ P +  V+GA Y+A+E AG L+G+G +  +  R   +LRSFD  +   + +  + + 
Sbjct  157  DER-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDDMLQSVLHDAFK-RD  214

Query  394  GIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGV  453
            GI     +    + +++     +      G      F+ VL ATGR P   HLGL+  G+
Sbjct  215  GITLQPHSTVARVDKVDPATGTLSLTTTAGDY-HTGFDCVLVATGRTPMTKHLGLEHRGI  273

Query  454  KLNEKTGRIMVKNEQ-TSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSVQMDY  511
            +L+   G I V   Q TS   ++A+GDVV+   LTPVAI +GR L+ RL+      + DY
Sbjct  274  ELSPN-GFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADY  332

Query  512  DKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIK  571
              + + VF+    G  GL+E+ ++  Y ED I++Y + FV + +SL         +  +K
Sbjct  333  TSIPSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAHEKPTTA-MK  391

Query  572  VVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            ++C    +K V G H +G  A E++Q  G+A+++      +   + IHP  AE L  L
Sbjct  392  LICVGPTEKIV-GLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>PHALS_08068
Length=497

 Score = 234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 158/488 (32%), Positives = 261/488 (53%), Gaps = 36/488 (7%)

Query  156  DYDLVVIggglgglACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            +YD +VIG G GG+A ++ AAS+ G +V +++  +         LGGTCVNVGC+PKKL+
Sbjct  23   EYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLM  73

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPV---FDWKQLVANVDGYIKTINFKYKVKLRS  271
            + ++ +   + HD   +G++    G  +     F+W +L A  D Y+  +N  Y+  L +
Sbjct  74   YIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYETNLAN  133

Query  272  KNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDI  331
              V        F +   V++       K++  + ++IAVG RP     PG E  + SD  
Sbjct  134  SKVDLIRGSAKFNERGNVEVDD-----KEVRAKKILIAVGGRPLIPDIPGKELCIDSDGF  188

Query  332  FWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI-LLRSFDQEMADKIGEYME  390
            F + E  P K  ++GA Y+A+E AG L  +G +  V  R   +LRSFD  +   + E M 
Sbjct  189  FEL-ETLPTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNILRTTLEEAM-  246

Query  391  VQSGIKFIRKTVPQS-ISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLD  449
               G+       P S ++R++      K +     +    F+ V+ ATGR P  + L L+
Sbjct  247  ANDGVHL----RPNSTVARVKEAADGTKTLVLTNGSEHRGFDVVICATGRVPLTSTLNLE  302

Query  450  KAGVKLNEKTGRIMVKN-EQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSV  507
            KAG+  ++  G I V   ++T+ +N+YA+GDV + P LTPVAI +GR LS RL+      
Sbjct  303  KAGITTDD-NGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGGMKDA  361

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASN-  566
            ++ Y+ + T +F+    G  GL+EE ++ +YG++NI++Y + FV + + L +ET  A+  
Sbjct  362  KLSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIEATGV  421

Query  567  -----SCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPM  621
                    +K+VC  +++K V+G H +G  A E++Q  G+A+++  T     N + IHP 
Sbjct  422  PKEKPKTAMKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPT  480

Query  622  TAESLTIL  629
              E L  L
Sbjct  481  AGEELVTL  488

>PPTG_18033
Length=500

 Score = 232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 166/493 (34%), Positives = 262/493 (53%), Gaps = 40/493 (8%)

Query  153  PIFDYDLVVIggglgglACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPK  211
            P  +YD +VIG G GG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PK
Sbjct  23   PQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPK  73

Query  212  KLIHQSSLIGEIIRHDSARFGWKFDNEGKTV---PVFDWKQLVANVDGYIKTINFKYKVK  268
            KL+  ++ +   + HD   +G++ +  G+ +     FDW +L A  D Y+  +N  Y+  
Sbjct  74   KLMFIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRLNGIYERN  133

Query  269  LRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSS  328
            L +  V+       F +   V++       K++  +NV+IAVG +P     PG E  + S
Sbjct  134  LANSKVELIRGSAKFNENGNVEVD-----GKELLAKNVLIAVGGKPLIPDIPGKELCIDS  188

Query  329  DDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI-LLRSFDQEMADKIGE  387
            D  F + E  P K  V+GA Y+A+E AG L  +G +  +  R   +LRSFD  +   + +
Sbjct  189  DGFFEL-EILPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLED  247

Query  388  YMEVQSGIKFIRKTVPQS-ISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHL  446
             M V+ G+       P S ++R+E      K V     +    ++ V+ A GR P  ++L
Sbjct  248  AM-VKDGVHL----RPHSNVARVEQAADGTKTVVLTDGSEYNGYDVVMYAAGRVPLTSNL  302

Query  447  GLDKAGVKLNEKTGRIMVKN-EQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLY---  502
             LDKAGV  +E  G I V   ++TS S + A+GDV   P LTPVAI +GR LS RL+   
Sbjct  303  QLDKAGVTTDEH-GFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGL  361

Query  503  NNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETR  562
            NNS V   Y+ + T VF+    G  GL+E+ ++ +YG+D +++Y + FV + + L +E  
Sbjct  362  NNSKVS--YENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYGLINEVD  419

Query  563  TASNS------CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTV  616
             ++          +K+VC    +K V+G H +G  A E++Q  G+A+++  T     N +
Sbjct  420  ESTGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCI  478

Query  617  GIHPMTAESLTIL  629
             IHP   E L  L
Sbjct  479  AIHPTAGEELVTL  491

>SDRG_03823
Length=497

 Score = 231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 152/477 (32%), Positives = 252/477 (53%), Gaps = 20/477 (4%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +VIGGG GG + ++ AA++G KV V++           G+GGTCVNVGC+PKK++  
Sbjct  7    YDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKKVMFN  63

Query  217  SSLIGEIIRHDSARFGWKFDN-EGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
            +++  E++    A   + F N +      FDW  L    D Y+  +N  Y+  L +  + 
Sbjct  64   AAMHAEMLHSAHA---YTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNKIP  120

Query  276  YENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMK  335
                   FVD HT++++  R      T ++++IAVG  P     PG E+A+SSD  F + 
Sbjct  121  LIYGAAKFVDNHTIEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-  174

Query  336  EKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSG  394
            E +P K  V+GA Y+A+E AG    +  +  V  R + +LR+FD  + D +   ME  +G
Sbjct  175  ETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAG  233

Query  395  IKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVK  454
            ++F+R++   SI + E+  L ++            F TVL A GR P    LGL+   + 
Sbjct  234  VRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIA  293

Query  455  LNEKTGRIMVKNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SVQMDYD  512
            L+      +   E T+  N++A+GDV     ELTPVAI +GR L+ RL+ N  +  ++Y 
Sbjct  294  LSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYH  353

Query  513  KVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKV  572
            ++ T VF+    G  GL+E  +  +YG  N+++Y + F  + +++S +      +  +K+
Sbjct  354  QIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDEKQKTA--MKL  411

Query  573  VCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +C    ++ V+G H  G  A E++Q  G+A+++        N V IHP  +E L  +
Sbjct  412  MC-IGEEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  467

>SDRG_03822
Length=494

 Score = 231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 154/476 (32%), Positives = 252/476 (53%), Gaps = 18/476 (4%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +V+G G GG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK++  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++L  E++ H +  + +K   + +    FDW  + A  D Y+K +N  Y   +    V  
Sbjct  61   AALHAEML-HSARAYAFKGVQDIQ-FGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  118

Query  277  ENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKE  336
                  FVD HTV+++  R   K I     +IAVG  P     PG E+A+SSD  F + E
Sbjct  119  VMGAAKFVDNHTVEVNGDRYAAKHI-----LIAVGGVPAMPPLPGIEHAISSDGFFAL-E  172

Query  337  KEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGI  395
             +P K  V+GA Y+A+E AG    +  +  V  R + +LR+FD  + D +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  396  KFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKL  455
            +F+R++   SI + E+  L ++            F TVL A GR P    LGL+   + L
Sbjct  232  RFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  456  NEKTGRIMVKNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SVQMDYDK  513
            +      +   E T+  N++A+GDV     ELTPVAI +GR L+ RL+ N  +  ++Y +
Sbjct  292  SPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQ  351

Query  514  VCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVV  573
            + T VF+    G  GL+E  +  +YG  N+  + ++F  + +++S+E      +  +K+V
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKVQTA--MKLV  409

Query  574  CDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            C    ++ V+G H  G  A E++Q  G+A+++        N V IHP  +E L  +
Sbjct  410  C-IGVEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_12187
Length=462

 Score = 229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 156/479 (33%), Positives = 249/479 (52%), Gaps = 32/479 (7%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YDLVV+GGG GG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+++ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVP--VFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            ++ +   +RHD+  +G+        VP    DW  L    D Y+  +N  Y   L+   V
Sbjct  56   AADLAHSMRHDAPAYGF------PAVPNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGV  109

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
             +   L SF     V++             NV++AVG +P     PG E+ +SSD  F +
Sbjct  110  DFAQGLCSFGSDGRVQID---ATPLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFEL  166

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI-LLRSFDQEMADKIGEYMEVQS  393
             E+ P +  V+GA Y+A+E AG L+G+G +  +  R   +LRSFD  +   + +  + + 
Sbjct  167  DER-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDDMLQAVLHDAFQ-RD  224

Query  394  GIKFIRKTVPQSISRLENRQLLVKW-VDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAG  452
            GI     +   +I+R++         V          F+ VL ATGR P    LGL+  G
Sbjct  225  GITLQPHS---TIARVDKDPTTGSLSVTTTAGEHHSGFDCVLVATGRTPMTKDLGLEHRG  281

Query  453  VKLNEKTGRIMVKNEQ-TSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSVQMD  510
            ++L+   G I V   Q TS   ++A+GDVVD   LTPVAI +GR L+ RL+      + D
Sbjct  282  IQLSPN-GFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKAD  340

Query  511  YDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYI  570
            Y  + + VF+    G  GL+E+ ++  Y +D +++Y + FV + +SL         +  +
Sbjct  341  YTNIPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAHEKPTTA-M  399

Query  571  KVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            K++C    +K V G H +G  A E++Q  G+A+++      +   + IHP  AE L  L
Sbjct  400  KLICVGPSEKIV-GLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>PHYCA_504517
Length=493

 Score = 230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 159/480 (33%), Positives = 252/480 (53%), Gaps = 25/480 (5%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +VIGGG GG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK++  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPV--FDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            ++     + H +    +  +   K      FDW  +    D YIK +N  Y+  L + NV
Sbjct  64   TAAH---VEHLNRNKDYSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNANV  120

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
             +   +   V    +++     G K  T ++V++A G  P     PG E  + SD  F +
Sbjct  121  DHVQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFFKL  175

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQS  393
             E++P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  + D + E ME ++
Sbjct  176  -EQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KA  233

Query  394  GIKFIRKTVPQSISRLENRQL--LVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKA  451
            G+KF+R      + + +N +L  +V    E+ K  +  F+T+L A GR+P    LGL++ 
Sbjct  234  GVKFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPD--FDTILYAVGREPRTKDLGLEEV  291

Query  452  GVKLNEKTGRIMVKNEQTSTSNIYAIGDV-VDAPELTPVAIQSGRLLSQRLYNNS-SVQM  509
            GVKL+E     +   E TS   +YAIGD  V   ELTPVAI +GR LS RL+       +
Sbjct  292  GVKLSEGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  510  DYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCY  569
            +Y ++ T +F+    G  G +E  +  +YGE+N+++Y + FV L  S++   R    +  
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTAMK  411

Query  570  IKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +  V +K     V+G H  G  A E++Q  G+A+++  T     N V IHP  AE L  +
Sbjct  412  LVTVGEKET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PPTG_09787
Length=493

 Score = 228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 158/480 (33%), Positives = 253/480 (53%), Gaps = 25/480 (5%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +VIGGG GG+A ++ AA+FG KV V++  +   +    GLGGTCVN GC+PKK++  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPV--FDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            ++     + H +    +  +   K      FDW  +    D YIK +N  Y+  L +  V
Sbjct  64   TAAH---VEHLNRNKDYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNAKV  120

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
             +   +   V    ++++      +  T ++V++A G  P     PG E+ + SD  F +
Sbjct  121  DHVQGIAKLVAKDKIEVA-----GQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFFKL  175

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQS  393
             E++P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  + D + E ME ++
Sbjct  176  -EQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-KA  233

Query  394  GIKFIRKTVPQSISRLENRQL--LVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKA  451
            G+KF+R +    + + EN +L  +V    E+ K  +  F+T++ A GR+P    LGL++ 
Sbjct  234  GVKFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFAD--FDTIVFAIGREPRTKDLGLEEI  291

Query  452  GVKLNEKTGRIMVKNEQTSTSNIYAIGDV-VDAPELTPVAIQSGRLLSQRLYNNS-SVQM  509
            GVKL+E     +   E TS   +YAIGD  V   ELTPVAI +GR LS RL+       +
Sbjct  292  GVKLSEGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  510  DYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCY  569
            +Y ++ T +F+    G  G +E  +  +YGE+NI++Y + FV L  S++   R    +  
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTAMK  411

Query  570  IKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +  V +K     V+G H  G  A E++Q  G+A+++  T     N V IHP  AE L  +
Sbjct  412  LVTVGEKET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PHYRA_71927
Length=485

 Score = 228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 158/488 (32%), Positives = 257/488 (53%), Gaps = 36/488 (7%)

Query  156  DYDLVVIggglgglACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            +YD +VIG G GG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKL+
Sbjct  11   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  61

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTV---PVFDWKQLVANVDGYIKTINFKYKVKLRS  271
              ++ +   +RHD   +G++ +  G  +     FDW +L A  D Y+  +N  Y+  L +
Sbjct  62   FIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  121

Query  272  KNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDI  331
              V+  +    F +   V++       K++  +NV++AVG +P     PG E  + SD  
Sbjct  122  SKVELIHGSAKFNEKGNVEVD-----GKELLAKNVLVAVGGKPLIPDIPGKELCIDSDGF  176

Query  332  FWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYME  390
            F + E  P K  V+GA Y+A+E AG L  +G +  +  R   +LR+FD  +   + + M 
Sbjct  177  FEL-EMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAM-  234

Query  391  VQSGIKFIRKTVPQS-ISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLD  449
             + G+       P S ++R+E      K +     +    ++ V+ A GR P  ++L LD
Sbjct  235  AKDGVHL----RPHSNVTRVEQVADGTKTLVLADGSEHSGYDVVIYAAGRVPLTSNLQLD  290

Query  450  KAGVKLNEKTGRIMVKN-EQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSV  507
             A +   +K G I V   ++TS S + A+GDV   P LTPVAI +GR LS RL+      
Sbjct  291  NADIA-TDKHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDA  349

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS  567
            ++ Y+ + T VF+    G  GL+EE ++ +YG+DN ++Y + FV + + L +E   A+  
Sbjct  350  KVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEVDEATGE  409

Query  568  ------CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPM  621
                    +K+VC    +K V+G H +G  A E++Q  G+A+++  T     N + IHP 
Sbjct  410  PKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPT  468

Query  622  TAESLTIL  629
              E L  L
Sbjct  469  AGEELVTL  476

>CCA23647
Length=496

 Score = 228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 150/467 (32%), Positives = 248/467 (53%), Gaps = 23/467 (5%)

Query  173  KEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFG  232
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+++ ++   E I        
Sbjct  22   RRAATYGAKVLLIERHR---EYEGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  233  WKFDNEGKTVPVF-----DWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPH  287
              F ++G T   F     DW ++    D YI+ +N  Y   L +  +     +   +   
Sbjct  79   RPFASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIAKD  138

Query  288  TVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGA  347
             V+++           ++++IAVG  P   + PG E+A+ SD  F + E +P K  V+GA
Sbjct  139  RVQVNQ----DSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKL-ETQPKKVAVVGA  193

Query  348  SYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSI  406
             Y+A+E AG    +  +  +  R   +LR FD  + D + E ME ++G+ F+RK+  + I
Sbjct  194  GYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLEKI  252

Query  407  SRLENRQL-LVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVK  465
             + E+ +L +   + ++ +T    F+ ++ A GR P    LGL+  GV+LNE TG I+V 
Sbjct  253  VKSEDDKLAITARIGDQSQTFSN-FDQIVMAVGRSPRTVDLGLEDVGVELNE-TGHIIVD  310

Query  466  -NEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SVQMDYDKVCTTVFTPI  522
              E TS   +YA+GDV     ELTPVAI +GR L+ RL+NN     + Y ++ T VF+  
Sbjct  311  AQENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHP  370

Query  523  EYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFV  582
              G  G +E  +  +YGE+N++ Y + FV L +S++ +      +C +K+VC  S++  V
Sbjct  371  PLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTC-MKLVCVGSKET-V  428

Query  583  LGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +G H  G  A E++Q  G+AM++  T     N V IHP  +E L  +
Sbjct  429  VGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>H310_14447
Length=501

 Score = 228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 157/478 (33%), Positives = 260/478 (54%), Gaps = 21/478 (4%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +V+GGG GG++ +  A  +G KV V++  +    G A G+GGTCVNVGC+PKK+++ 
Sbjct  9    YDYIVVGGGSGGVSSASRAVEYGAKVLVIE--RGRVNGGA-GMGGTCVNVGCVPKKIMYN  65

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            + +  EI+ H +  + +K D        FDW  + A  D Y+  ++  Y+  L  +N+ +
Sbjct  66   AGVHAEIL-HSAKDYSFK-DVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEENIDH  123

Query  277  ENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKE  336
                  FVD HTV+++  R      T  +++IAVG  P+    PG E+AVSSD  F +  
Sbjct  124  VIGAAVFVDDHTVEVNGQR-----YTAPHILIAVGGMPQMPNIPGIEHAVSSDGFFDLP-  177

Query  337  KEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGI  395
             +P K  V+GA Y+A+E AG    +  +  V  R + +LR FD  + D + + M  ++G+
Sbjct  178  TQPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEM-AKAGV  236

Query  396  KFIRKTVPQSISRLENRQLLVKWVDEKGKTCEE--AFNTVLNATGRDPEVAHLGLDKAGV  453
             F+     +SI +  +  L V  V + G+   E   F+ +++A GR P    +GLDK  V
Sbjct  237  AFVTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDKTHV  294

Query  454  KLNEKTGRIMVKNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYN-NSSVQMDY  511
            +L++    ++   E T+   +YAIGDV     ELTPVAI +GR L+ RL+   ++  + Y
Sbjct  295  ELSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNACIHY  354

Query  512  DKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIK  571
             ++ T VF+    G  GL+E  +  +YG DN+ +Y + F  + ++L++ +     +  +K
Sbjct  355  HQIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTA-MK  413

Query  572  VVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +VC    ++ V+G H  G  A E++Q  G+A++L        N V IHP  AE +  +
Sbjct  414  LVC-IGVEETVIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIHPTAAEEMVTM  470

>SPRG_05609
Length=496

 Score = 227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 154/482 (32%), Positives = 254/482 (53%), Gaps = 30/482 (6%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +VIGGG GG + ++ AA++G KV +++    +      G+GGTCVNVGC+PKK++  
Sbjct  6    YDYIVIGGGSGGNSSARRAAAYGAKVLLIERGHAN---DGAGMGGTCVNVGCVPKKIMFN  62

Query  217  SSLIGEIIRHDSARFGWKFDN-EGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
            ++L  E++    A   + F N +      FDW  L    D Y+  +N  Y+  L +  + 
Sbjct  63   AALHAEMLHSAHA---YTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNQIP  119

Query  276  YENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMK  335
                   FVD HTV+++  R      T ++++IAVG  P     PG E+A+SSD  F + 
Sbjct  120  LVYGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-  173

Query  336  EKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSG  394
            E +P K  V+GA Y+A+E AG    +  +  +  R + +LR+FD  + D +   ME  +G
Sbjct  174  ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-HAG  232

Query  395  IKFIRKTVPQSISRLENRQLLVKWVDEKGK-----TCEEAFNTVLNATGRDPEVAHLGLD  449
            + F+R++   SI +  +      + D+ G           F TVL A GR P    LGL+
Sbjct  233  VHFVRESGITSIEKAVD-----GYADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLE  287

Query  450  KAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SV  507
               + L+      +   E TS  N+YA+GDV     ELTPVAI +GR L+ RL+ N  + 
Sbjct  288  TTDIALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNA  347

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS  567
             ++Y ++ T VF+    G  GL+E  +  +YG +N+++Y ++F  + +++S +      +
Sbjct  348  CINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDDKQKTA  407

Query  568  CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLT  627
              +K++C    ++ V+G H  G  A E++Q  G+A+++        N V IHP  +E L 
Sbjct  408  --MKLIC-IGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELV  464

Query  628  IL  629
             +
Sbjct  465  TM  466

>PYIR_17506
Length=509

 Score = 226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 163/486 (34%), Positives = 260/486 (53%), Gaps = 36/486 (7%)

Query  157  YDLVVIggglgglACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            YD +VIG G GG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+++
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  216  QSSLIGEIIRHDSARFGWKFDNE---GKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSK  272
             ++ +   +  D+  +G++  +    G  V  F W +L    D YI  +N  Y+  L + 
Sbjct  90   LAANMNHTLHRDAFYYGFESKDGSHIGDNVE-FHWSKLKERRDAYILRLNGIYERNLGNS  148

Query  273  NVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIF  332
             V       +F     V++       K I+ RNV+IAVG +P     PG E+ + SD  F
Sbjct  149  KVDLIQGTAAFNAQGEVEVD-----GKVISARNVLIAVGGKPLIPDIPGKEHCIDSDGFF  203

Query  333  WMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI-LLRSFDQEMADKIGEYMEV  391
             ++E  P K  V+GA Y+A+E AG L G+G +  +  R   +LR+FD+ + D + + M  
Sbjct  204  ELEEL-PNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDAM-A  261

Query  392  QSGIKFIRKTVPQS-ISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDK  450
            + GI  +R   PQS ++R+E      K +     +    F+TV+ A GR P  ++L +  
Sbjct  262  KDGI-VVR---PQSNVARIEKTLDGKKTLVLADGSEHAGFDTVIYAAGRIPLTSNLNISA  317

Query  451  AGVKLNEKTGRIMVKNEQT-STSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSVQ  508
            AG++  +K G I V   QT S +N++A+GDV     LTPVAI +GR LS RL+      +
Sbjct  318  AGIE-TDKHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMEDAK  376

Query  509  MDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS-  567
            + Y+ + T VF+    G  GL+E+ ++ +YG+  I+ Y + FV + + L +E     N+ 
Sbjct  377  ISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNELDAEGNTK  436

Query  568  ----CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTA  623
                  +K+VC   +D+ V+G H +G  A E++Q  G+A+++  T     N V IHP   
Sbjct  437  PKPMTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCVAIHPTAG  495

Query  624  ESLTIL  629
            E L  L
Sbjct  496  EELVTL  501

>PITG_14083
Length=493

 Score = 226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 154/479 (32%), Positives = 251/479 (52%), Gaps = 23/479 (5%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +VIGGG GG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK++  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPV--FDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            ++     + H +    +  +   K      FDW  +    D YIK +N  Y+  L +  V
Sbjct  64   AAAH---VEHLNRNKDYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKV  120

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
             +   +   V    ++++      +  T ++V++A G  P     PG E+ + SD  F +
Sbjct  121  DHVQGIAKLVAKDKIEVA-----GQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFFKL  175

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQS  393
             E++P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  + D + E ME ++
Sbjct  176  -EQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KA  233

Query  394  GIKFIRKTVPQSISRLENRQL-LVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAG  452
            G+ F+R +    + + +N +L  V  VD + +   + F++++ A GR P    LGL++ G
Sbjct  234  GVNFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTD-FDSIVYAIGRSPRTKDLGLEEVG  292

Query  453  VKLNEKTGRIMVKNEQTSTSNIYAIGDV-VDAPELTPVAIQSGRLLSQRLYNNS-SVQMD  510
            VKL E     +   E TS + +YAIGD  V   ELTPVAI +GR LS RL+       ++
Sbjct  293  VKLAEGGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLN  352

Query  511  YDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYI  570
            Y ++ T +F+    G  G +E  +  +YGE+N+++Y + FV L  S++   R    +  +
Sbjct  353  YHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAMKL  412

Query  571  KVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
              V DK     V+G H  G  A E++Q  G+A+++  T     N V IHP  AE L  +
Sbjct  413  VTVGDKET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PITG_13427
Length=463

 Score = 225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 154/475 (32%), Positives = 252/475 (53%), Gaps = 37/475 (8%)

Query  170  ACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDS  228
            A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKL+  ++ +   +RHD 
Sbjct  2    ASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHDL  52

Query  229  ARFGWKFDNEGKTV---PVFDWKQLVANVDGYIKTINFKYKVK-LRSKNVKYENFLGSFV  284
              +G++ +  G  +     FDW +L A  D Y+  +N  Y+ + L +  V+    L +F 
Sbjct  53   LHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATFN  112

Query  285  DPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLV  344
            +   V++     G K++  +NV+IAVG +P     PG E  + SD  F + E  P K  V
Sbjct  113  EKGNVEV-----GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFEL-ETLPKKVAV  166

Query  345  IGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGIKFIRKTVP  403
            +GA Y+A+E AG L  +G +  +  R   +LR+FD  +   + + M  + G+       P
Sbjct  167  VGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFDDIVRTTLEDAM-AKEGVHL----RP  221

Query  404  QS-ISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRI  462
             S ++R+E      K +     +    ++ V+ A GR P  ++L LDKAG+  +E  G I
Sbjct  222  HSNVARVELGADGTKTLVLTDGSKYSGYDVVIYAAGRVPLTSNLQLDKAGITTDEH-GFI  280

Query  463  MVKN-EQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSVQMDYDKVCTTVFT  520
             V   ++TS S + A+GDV   P LTPVAI +GR LS RL+   +  ++ Y+ + T VF+
Sbjct  281  PVNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFS  340

Query  521  PIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS------CYIKVVC  574
                G  GL+EE ++ +YG+D I++Y + FV + + L +E   ++          +K+VC
Sbjct  341  HPPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLVC  400

Query  575  DKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
                +K V+G H +G  A E++Q  G+A+++  T     N + IHP   E L  L
Sbjct  401  AGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTL  454

>PHYKE_10327
Length=1200

 Score = 236 bits (602),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 161/487 (33%), Positives = 258/487 (53%), Gaps = 34/487 (7%)

Query  156  DYDLVVIggglgglACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            +YD +VIG G GG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKL+
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPV---FDWKQLVANVDGYIKTINFKYKVKLRS  271
              ++ +G  + HD   +G++    G  V     FDW +L    D Y+  +N  Y+  L +
Sbjct  77   FIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRLNGIYERNLAN  136

Query  272  KNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDI  331
              V+      +F D   V +       K++  +NV+IAVG +P     PG E  + SD  
Sbjct  137  SKVELIRGSAAFNDNGNVVVD-----GKEVRAKNVLIAVGGKPMIPDIPGKELCIDSDGF  191

Query  332  FWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI-LLRSFDQEMADKIGEYME  390
            F + E  P K  V+GA Y+A+E AG L  +G +  +  R   +LR+FD  +   + + M+
Sbjct  192  FEL-EMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAMK  250

Query  391  VQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDK  450
             + G+   R +   +I+R+       K +     +    ++ V+ A GR P  + L LDK
Sbjct  251  -KDGVHLQRHS---NIARVNQAADGTKTLVLADGSEHSGYDVVIYAAGRVPLTSTLKLDK  306

Query  451  AGVKLNEKTGRIMV-KNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSVQ  508
            AG+   +K G I V K ++TS S + A+GDV   P LTPVAI +GR LS RL+      +
Sbjct  307  AGIA-TDKNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMGGAK  365

Query  509  MDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS-  567
            + Y+ + T VF+    G  GL+EE ++ +YG+D+I++Y + FV + + L +E    +   
Sbjct  366  VSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLINEMDETTGEP  425

Query  568  -----CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMT  622
                   +K+VC   +D+ V+G H +G  A E++Q  G+A+++  T     N + IHP  
Sbjct  426  KDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCMAIHPTA  484

Query  623  AESLTIL  629
             E L  L
Sbjct  485  GEELVTL  491

>CCI11048
Length=496

 Score = 225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 150/474 (32%), Positives = 248/474 (52%), Gaps = 37/474 (8%)

Query  173  KEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDS----  228
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+++ ++   E I   S    
Sbjct  22   RRAATYGAKVLLIERHR---EYDGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  229  --------ARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFL  280
                    A   + F +       FDW ++    D YI+ +N  Y   L +  +     +
Sbjct  79   RPFTSKECASHSFSFGD-------FDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGI  131

Query  281  GSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPG  340
               +    V+++           ++++IAVG  P   + PG E+A+ SD  F + E +P 
Sbjct  132  AKLIAKDRVQVNQ----DSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKL-ETQPK  186

Query  341  KTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGIKFIR  399
            K  V+GA Y+A+E AG    +  +  V  R   +LR FD  + D + E ME + G+ F+R
Sbjct  187  KVAVVGAGYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEME-KDGVNFVR  245

Query  400  KTVPQSISRLENRQL-LVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEK  458
            K+  + I++ ++ +L +   + E+ +T  + F+ ++ A GR P    LGL++ GV LNE 
Sbjct  246  KSHLEKITKAKDDKLAITARIGEENQTFSD-FDQIVMAVGRSPRTVGLGLEEVGVALNE-  303

Query  459  TGRIMVK-NEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SVQMDYDKVC  515
            TG I+V   E TS   +YA+GDV     ELTPVAI +GR L+ RL+NN     + Y ++ 
Sbjct  304  TGHIIVDAQENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIP  363

Query  516  TTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCD  575
            T VF+    G  G +E  +  +YGE+N++ Y + FV L +S++ +      +  +K+VC 
Sbjct  364  TVVFSHPPLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTA-MKLVCV  422

Query  576  KSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
             S++  V+G H  G  A E++Q  G+AM++  T     N V IHP  +E L  +
Sbjct  423  GSKET-VVGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PYAP_23435
Length=951

 Score = 234 bits (596),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 159/479 (33%), Positives = 251/479 (52%), Gaps = 23/479 (5%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD VVIGGG GG+A ++ AA++G KV +++  +        GLGGTCVN GC+PKK++  
Sbjct  471  YDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKKVMFN  527

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPV--FDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            ++     + H +    +  +   K      FDW  +    D YI  +N  Y+  + +  +
Sbjct  528  AA---AHVEHLARNGDYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNAGI  584

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
                 + + V  + +++       K  T ++V++AVG  P     PG E+A+ SD  F +
Sbjct  585  DLVQGVATLVSSNQIEVD-----GKVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFFKL  639

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQS  393
             E +P K  V+GA Y+A+E AG    +  E  +  R   +LR+FD  + D + E ME + 
Sbjct  640  -ESQPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-KH  697

Query  394  GIKFIRKTVPQSISRLENRQLLVKW-VDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAG  452
            G+ F+R++  + I +  + +L +   VD + +T E  F+ VL A GR+P    LGLDKAG
Sbjct  698  GVNFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLE-GFDEVLFAIGREPRTRGLGLDKAG  756

Query  453  VKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SVQMD  510
            VKLN+     +   E TS   +YAIGD      ELTPVAI +GR L+ RL+ N     + 
Sbjct  757  VKLNDGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACLH  816

Query  511  YDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYI  570
            Y ++ T VF+    G  G +E  +  ++G D +++Y + FV L  S++        +  +
Sbjct  817  YHQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMADPENKGKTA--M  874

Query  571  KVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            K+VC    D+ V+G H  G  A E++Q  G+AM++  T     N V IHP  AE    +
Sbjct  875  KLVC-VGDDEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHPTAAEEFVTM  932

>SDRG_11131
Length=494

 Score = 225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 150/476 (32%), Positives = 252/476 (53%), Gaps = 18/476 (4%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +V+G G GG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK++  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++L  E++ H +  + +K  ++ +    FDW  + A  D Y+  +N  Y   +    V  
Sbjct  61   AALHAEML-HSARAYAFKGVSDIQ-YGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  118

Query  277  ENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKE  336
                  FVD HT++++  R      T ++++IAVG  P     PG E+A+SSD  F + E
Sbjct  119  VMGAAKFVDNHTIEVNGER-----YTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-E  172

Query  337  KEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGI  395
             +P K  V+GA Y+A+E AG    +     V  R + +LR+FD  + D +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  396  KFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKL  455
            +F+R++   +I +  +  L ++            F TVL A GR P    LGL+   + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  456  NEKTGRIMVKNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SVQMDYDK  513
            + +    +   E T+  N+YAIGDV     ELTPVAI +GR L+ RL+ N  +  ++Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  514  VCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVV  573
            + T VF+    G  GL+E  +  +YG  N+  + ++F  + +++ +E      +  +K+V
Sbjct  352  IPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--MKLV  409

Query  574  CDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            C    ++ V+G H  G  A E++Q  G+A+++        N V IHP  +E L  +
Sbjct  410  C-IGVEEAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_15045
Length=494

 Score = 224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 150/476 (32%), Positives = 252/476 (53%), Gaps = 18/476 (4%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +V+G G GG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK++  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++L  E++ H +  + +K  ++ +    FDW  + A  D Y+  +N  Y   +    V  
Sbjct  61   AALHAEML-HSARAYAFKGVSDIQ-YGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  118

Query  277  ENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKE  336
                  FVD HT++++  R      T ++++IAVG  P     PG E+A+SSD  F + E
Sbjct  119  VMGAAKFVDNHTIEVNGER-----YTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-E  172

Query  337  KEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGI  395
             +P K  V+GA Y+A+E AG    +     V  R + +LR+FD  + D +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  396  KFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKL  455
            +F+R++   +I +  +  L ++            F TVL A GR P    LGL+   + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  456  NEKTGRIMVKNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SVQMDYDK  513
            + +    +   E T+  N+YAIGDV     ELTPVAI +GR L+ RL+ N  +  ++Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  514  VCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVV  573
            + T VF+    G  GL+E  +  +YG  N+  + ++F  + +++ +E      +  +K+V
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--MKLV  409

Query  574  CDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            C    ++ V+G H  G  A E++Q  G+A+++        N V IHP  +E L  +
Sbjct  410  C-IGVEEAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PHYSO_550665
Length=491

 Score = 223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 156/480 (33%), Positives = 248/480 (52%), Gaps = 25/480 (5%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD VVIGGG GG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK++  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFEGMGLGGTCVNFGCVPKKVMFN  63

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPV--FDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            ++     + H +    +  +   K      FDW  +    D YIK +N  Y+  L +  V
Sbjct  64   AAAH---VEHLARNKDYSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAQV  120

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
             +   +   V    V+++      K  T ++V++A G  P     PG E+ + SD  F +
Sbjct  121  DHVQGIAKLVAKDKVEVA-----GKVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDGFFKL  175

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQS  393
             E++P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  + D + E ME ++
Sbjct  176  -EQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KA  233

Query  394  GIKFIRKTVPQSISRLENRQL--LVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKA  451
            G+KF+R      + +  + +L  +V    E+ K  +  F+ +L A GR+P    LGL++ 
Sbjct  234  GVKFVRNMRAARVEKQADGKLTFVVTINGEEHKFPD--FDAILYAVGREPRTKDLGLEEV  291

Query  452  GVKLNEKTGRIMVKNEQTSTSNIYAIGDV-VDAPELTPVAIQSGRLLSQRLYNNS-SVQM  509
            GVKL+E     +   E TS   +YAIGD  +   ELTPVAI +GR LS RL+       +
Sbjct  292  GVKLSEGGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  510  DYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCY  569
            +Y ++ T +F+    G  G +E  +  +YGE+N++ Y + FV L  S++   R    +  
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMADPERKGKTAMK  411

Query  570  IKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +  V ++     V+G H  G  A E++Q  G+A+++  T     N V IHP  AE L  +
Sbjct  412  LVTVGEQET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PHYRA_72037
Length=493

 Score = 223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 155/477 (32%), Positives = 248/477 (52%), Gaps = 19/477 (4%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD VVIGGG GG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK++  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++   E + H +  +  K          FDW  +    D YI  +N  Y+  L +  V +
Sbjct  64   AAAHVEHL-HRNEDYSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNAKVDH  122

Query  277  ENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKE  336
               + + V    V+++      K  T ++V++A G  P     PG E+   SD  F + E
Sbjct  123  VQGIATLVAKDQVEVA-----GKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFFRL-E  176

Query  337  KEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGI  395
            ++P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  + D + + ME ++G+
Sbjct  177  QQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-KAGV  235

Query  396  KFIRKTVPQSISRLENRQL-LVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVK  454
            KF+R T    + + ++ +L  V  VD + +   + F+ +L A GR+P    LGL+K GVK
Sbjct  236  KFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPD-FDVILYAIGREPRTKDLGLEKVGVK  294

Query  455  LNEKTGRIMVKNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SVQMDYD  512
            L +     +   E TS   +YAIGD      ELTPVAI +GR LS RL+       ++Y 
Sbjct  295  LADGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  513  KVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKV  572
            ++ T +F+    G  G +E  +  ++GE+N+++Y + FV L  S++   R    +  +  
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTAMKLVT  414

Query  573  VCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            V ++     V+G H  G  A E++Q  G+A+++  T     N V IHP  AE L  +
Sbjct  415  VGEQET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PHYCA_7619
Length=462

 Score = 221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 152/474 (32%), Positives = 239/474 (50%), Gaps = 36/474 (8%)

Query  170  ACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDS  228
            A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKL+  ++ +   + HD 
Sbjct  2    ASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHDF  52

Query  229  ARFGWKFDNEGKTV---PVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVD  285
              +G++ +  G  +     FDW +L A  D Y+  +N  Y+  L +  V        F  
Sbjct  53   LHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFNQ  112

Query  286  PHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVI  345
               V++       K+I   NV+IAVG +P     PG E  + SD  F + E  P K  V+
Sbjct  113  NGNVEVD-----GKEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFEL-ETLPKKVAVV  166

Query  346  GASYVALECAGFLKGMGYEVKVMVRSI-LLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQ  404
            GA Y+A+E AG L  +G E  +  R   +LR+FD  +   + + ME + G+       P 
Sbjct  167  GAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAME-KDGVHL----CPH  221

Query  405  S-ISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIM  463
            S + R+E      + +     +    +  V+ A GR P    L LDKAGV   +  G I 
Sbjct  222  SNVVRVEQAADNTRTLVLADGSEHSGYEVVIYAAGRVPLTTSLQLDKAGVT-TDNHGFIQ  280

Query  464  VKN-EQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSVQMDYDKVCTTVFTP  521
            V   +QTS SN++A+GD    P LTPVAI +GR LS RL+      ++ Y+ + T VF+ 
Sbjct  281  VDEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSH  340

Query  522  IEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS------CYIKVVCD  575
               G  GL+E  ++ +YG+D I++Y + FV + + L +E    +          +K+VC 
Sbjct  341  PPIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVC-  399

Query  576  KSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
              +D+ V+G H +G  A E++Q  G+A+++  T     + + IHP   E L  L
Sbjct  400  AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>PYAP_21882
Length=502

 Score = 221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 151/487 (31%), Positives = 258/487 (53%), Gaps = 37/487 (8%)

Query  157  YDLVVIggglgglACSKEAASFGQ-KVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            YD +VIG G GG+A S+ AA++   +V V++  +         LGGTCVNVGC+PKK+++
Sbjct  31   YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  81

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVP---VFDWKQLVANVDGYIKTINFKYKVKLRSK  272
             ++ +G  +  D   +G++   +G+ +     F WK+L    D Y+  +N  Y   L + 
Sbjct  82   LAANLGHTLHRDLFHYGFE-STKGEHLAHETQFHWKKLKERRDAYVLRLNGIYGRNLDNS  140

Query  273  NVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIF  332
             V       +F     V++       K+I  +NV+IAVG +P     PG E+ + SD  F
Sbjct  141  KVDLFRGTATFNAKGNVEVD-----GKEIAAKNVLIAVGGKPLIPDIPGKEHCIDSDGFF  195

Query  333  WMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEV  391
             + E++P K  V+GA Y+A+E AG L G+G +  +  R   +LR FD+ +   + + M  
Sbjct  196  EL-EEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDELIRTTLHDAM-A  253

Query  392  QSGIKF-IRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDK  450
            + G+      +V + I   +  + LV     +       F++V+ A GR P    L L+ 
Sbjct  254  KEGVNLRPHSSVTKVIKAADGTKTLVLADGSE----HSGFDSVIYAAGRVPLTESLNLEA  309

Query  451  AGVKLNEKTGRIMVKNEQ--TSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSV  507
            AG++ ++  G I +   Q  T+ +NI+A+GDV   P LTPVAI +GR L+ RL+      
Sbjct  310  AGIETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRLFGGMKDA  368

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSE-----TR  562
            +  Y+ + T VF+    G  GL+E+ ++ ++G+D I++Y + FV + + + +E      +
Sbjct  369  KASYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINEFGEDGQQ  428

Query  563  TASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMT  622
                   +K+VC + +D+ V+G H +G  A E++Q  G+A+++  T     + V IHP  
Sbjct  429  KPKPMTAMKLVC-QGKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCVAIHPTA  487

Query  623  AESLTIL  629
            AE L  +
Sbjct  488  AEELVTM  494

>H257_09722
Length=518

 Score = 221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 155/483 (32%), Positives = 258/483 (53%), Gaps = 27/483 (6%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +V+GGG GG++ ++ AAS+G  V V++  +   QG A GLGGTCVNVGC+PKK+++ 
Sbjct  28   YDYIVLGGGSGGISSARRAASYGANVLVIE--RGREQGGA-GLGGTCVNVGCVPKKVMYN  84

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++   EI+ H +  + +K   +      FDW  +    D Y+  ++  Y+  L   N+  
Sbjct  85   AAFHAEIL-HSAKAYAFK-GVQDVGFGSFDWATMKTKRDSYVARLHGIYERNLAKDNITL  142

Query  277  ENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKE  336
             +   SFVD HT+ +          T  ++++AVG  P+  + PG E+A+SSD  F + E
Sbjct  143  VSGRASFVDNHTIAVD-----GATFTAPHILVAVGGVPQLPSIPGIEHAISSDGFFGL-E  196

Query  337  KEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRS-ILLRSFDQEMADKIGEYMEVQSGI  395
             +P K  VIGA Y+A+E AG    +  E  V  R   +LR+FD  + D + + M  +SG+
Sbjct  197  TQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-RSGV  255

Query  396  KFIRKTVPQSISRLENRQLLVK--WVDEKGKTCEE----AFNTVLNATGRDPEVAHLGLD  449
            +F+  +  QSI +  +  L ++     E G +        F+ ++ A GR P  +   ++
Sbjct  256  QFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSGF-ME  314

Query  450  KAGVKLNEKTGRIMVK-NEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-S  506
               +  NEK G I V   E TS   +YAIGDV +   ELTPVAI +GR L+ RL+     
Sbjct  315  HTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFGGEPD  373

Query  507  VQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASN  566
              + Y ++ T VF+    G  G +E  +  ++G  N+++Y ++FV L +S+ +       
Sbjct  374  ACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPENKPKT  433

Query  567  SCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
            +  +K++C   +++ V+G H  G  A E++Q  G+A+++      + N V IHP  +E  
Sbjct  434  A--MKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPTASEEF  490

Query  627  TIL  629
              +
Sbjct  491  VTM  493

>PYAR_17512
Length=533

 Score = 221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 157/509 (31%), Positives = 264/509 (52%), Gaps = 52/509 (10%)

Query  156  DYDLVVIggglgglACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            +YD +VIG G GG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK++
Sbjct  33   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIM  83

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTV---PVFDWKQLVANVDGYIKTINFKYKVKLRS  271
            + ++ +G ++  D   +G++    G  +     F W +L    D Y+  +N  Y+  L +
Sbjct  84   YLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYERNLGN  143

Query  272  KNVKYENFLGSFVDPHTVKLSH---PRKGT------------------KQITTRNVVIAV  310
              V+      +F     V++     P K                    K+I+ +NV+IAV
Sbjct  144  SKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEISAKNVLIAV  203

Query  311  GSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR  370
            G +P     PG E+ + SD  F ++E  P K  V+GA Y+A+E AG L G+G +  +  R
Sbjct  204  GGKPLIPNIPGKEHCIDSDGFFELEEM-PKKVAVVGAGYIAVELAGVLHGLGSDTTIFCR  262

Query  371  SI-LLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQS-ISRLENRQLLVKWVDEKGKTCEE  428
               +LR FD+ +   + + M+ + G+K      P S ++++  +    K +  +  T   
Sbjct  263  KDGVLRGFDELIRSTLHDAMD-KDGLKL----RPHSLVAKVTKQADGTKTLVLQDGTEHA  317

Query  429  AFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTS--NIYAIGDVVDAPEL  486
             F+TV+ A GR P    L L+ AGV+ + + G I +   Q +T+  NI+A+GDV   P L
Sbjct  318  GFDTVIYAAGRVPLTQSLNLEGAGVETDAQ-GFIKIDEYQRTTAKKNIFAVGDVCGTPAL  376

Query  487  TPVAIQSGRLLSQRLYNN-SSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEI  545
            TPVAI +GR LS RL+      +M Y+ + T VF+    G  GL+E+ ++ ++G+D +++
Sbjct  377  TPVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVKV  436

Query  546  YHTNFVPLEWSLSSE-----TRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMG  600
            Y + FV + + + +E      +       +K+VC    +K V+G H +G  A E++Q  G
Sbjct  437  YSSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEK-VVGVHLIGMAADEILQGFG  495

Query  601  LAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +A+++  T     + V IHP  AE L  +
Sbjct  496  VAVKMGATKADFDSCVAIHPTAAEELVTM  524

>H257_17037
Length=498

 Score = 220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 155/480 (32%), Positives = 256/480 (53%), Gaps = 25/480 (5%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +VIGGG GG++ +  A  +G KV V++  +    G A G+GGTCVNVGC+PKK+++ 
Sbjct  8    YDYIVIGGGSGGVSSASRAVEYGAKVLVIE--RGRANGGA-GMGGTCVNVGCVPKKIMYN  64

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPV----FDWKQLVANVDGYIKTINFKYKVKLRSK  272
            +    EI+ H +  + +K     + V V    FDW  + A  D Y+  +   Y+  L  +
Sbjct  65   AGFHAEIL-HSAKDYSFK-----EVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEE  118

Query  273  NVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIF  332
            N+ +     +FVD HTV+++  R      T  +++IAVG  P+  T PG E+A+SSD  F
Sbjct  119  NIDHVIGAATFVDDHTVEVNGLR-----FTAPHILIAVGGVPQLPTIPGIEHAISSDGFF  173

Query  333  WMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRS-ILLRSFDQEMADKIGEYMEV  391
             +   +P K  V+GA Y+A+E AG    +  +  V  R   +LR FD  + D + + M  
Sbjct  174  DLP-TQPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEM-A  231

Query  392  QSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKA  451
            +SG+ F+ ++  QSI +  +  L +       +     FN +++A GR P    +GLDK 
Sbjct  232  KSGVTFVTQSHLQSIRKEADGTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKT  291

Query  452  GVKLNEKTGRIMVKNEQTSTSNIYAIGDV-VDAPELTPVAIQSGRLLSQRLYNN-SSVQM  509
             V+L+     ++   E T+   +YAIGD  +   ELTPVAI +GR L+ RL+ + ++  +
Sbjct  292  TVELSTDGFVVVDAQENTTVPGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACI  351

Query  510  DYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCY  569
             Y ++ T +F+    G  GL+E  +  +YG+ N+  Y ++F  L +SL         +  
Sbjct  352  HYHQIPTVIFSHPPIGTIGLTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTA-  410

Query  570  IKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +K+VC    ++ V+G H  G  A E++Q  G+A+++        N V IHP  +E +  +
Sbjct  411  MKLVC-IGVEETVVGAHVAGLGADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEEMVTM  469

>PYIW_25301
Length=512

 Score = 219 bits (558),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 159/486 (33%), Positives = 255/486 (52%), Gaps = 36/486 (7%)

Query  157  YDLVVIggglgglACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            YD +VIG G GG+A S+ AA +   +V V++  +         LGGTCVNVGC+PKK+++
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  216  QSSLIGEIIRHDSARFGWKFDNE---GKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSK  272
             ++ +  ++  D+  +G++  +    G  V  F W +L    D YI  +N  Y+  L + 
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNV-AFHWDKLKERRDAYILRLNDIYERNLGNS  149

Query  273  NVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIF  332
             V        F     V++       K+I  +N++IAVG +P     PG E  + SD  F
Sbjct  150  KVDLLTGTAVFNAHGNVEMD-----GKEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFF  204

Query  333  WMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI-LLRSFDQEMADKIGEYMEV  391
             + E+ P K  V+GA Y+A+E AG L G+G    +  R   +LR+FD+ + D + + M  
Sbjct  205  EL-EQLPKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAM-A  262

Query  392  QSGIKFIRKTVPQS-ISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDK  450
            + GI  +R   PQS ++R+E      K +  +  +    F+TV+ A GR P  + L L  
Sbjct  263  KDGI-VVR---PQSNVARVEQTADGKKTLFLQNGSEHAGFDTVIYAAGRVPLTSELNLSA  318

Query  451  AGVKLNEKTGRIMVKNEQT-STSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSVQ  508
            AG+   +K G I V   QT S SN++A+GDV     LTPVAI +GR LS RL+   +  +
Sbjct  319  AGIA-TDKHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMADAK  377

Query  509  MDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS-  567
            + YD + T VF+    G  GL+E  ++ ++G+  I+ Y + FV + + L ++      + 
Sbjct  378  ISYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVDADGAAK  437

Query  568  ----CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTA  623
                  +K+VC   +D+ V+G H +G  A E++Q  G+A+++  T     N V IHP   
Sbjct  438  PKPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVAIHPTAG  496

Query  624  ESLTIL  629
            E L  +
Sbjct  497  EELVTM  502

>H310_11259
Length=519

 Score = 214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 154/482 (32%), Positives = 257/482 (53%), Gaps = 25/482 (5%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +V+GGG GG+A ++ AAS+G KV V++  +        GLGGTCVNVGC+PKK+++ 
Sbjct  29   YDYIVLGGGSGGIASARRAASYGAKVLVVERGR---TLGGAGLGGTCVNVGCVPKKVMYN  85

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++ + EI+ H +  + +K   +G     FDW  + +  D Y+  ++  Y+  L    +  
Sbjct  86   AAFLAEIM-HSAKTYTFK-GVQGVEFGSFDWPAMKSKRDAYVTRLHGIYERNLAKDGISL  143

Query  277  ENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKE  336
             + + +FVD HT+ +     G K  T  ++++AVG  P+  + PG E A+SSD  F + E
Sbjct  144  VSGVAAFVDNHTIAVD----GAK-FTAPHILVAVGGTPQLPSIPGIELAISSDGFFAL-E  197

Query  337  KEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGI  395
             +P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  + D + + M  ++G+
Sbjct  198  TQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVRDHVNKEMR-RAGV  256

Query  396  KFIRKTVPQSISRLENRQLLVKWV--DEKGKTCEEAF---NTVLNATGRDPEVAHLGLDK  450
             F+ ++   SI +  N  L ++     E G    + F   + V+ A GR P     G D+
Sbjct  257  AFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDCGFDR  316

Query  451  AGVKLNEKTGRIMVK-NEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-SV  507
              +  + K G I V   E T+   +YAIGD      ELTPVAI +GR L+ RL+      
Sbjct  317  TDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGGEPDA  375

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS  567
             ++Y ++ T VF+    G  G +E  +  +YG  N+++Y ++FV L ++L       S +
Sbjct  376  CINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPKDMPSTA  435

Query  568  CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLT  627
              +KVVC   +++ V+G H  G  A E++Q  G+A+++      + N + IHP  +E L 
Sbjct  436  --MKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHPTASEELV  492

Query  628  IL  629
             +
Sbjct  493  TM  494

>HYAP_08763
Length=473

 Score = 213 bits (541),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 143/465 (31%), Positives = 237/465 (51%), Gaps = 23/465 (5%)

Query  170  ACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSA  229
            A ++ AA++G KV V++  +   Q    GLGGTCVN GC+PKK++  ++     + H + 
Sbjct  2    ASARRAATYGAKVLVIERGR---QYDGMGLGGTCVNFGCVPKKIMFNTA---AHVEHLNR  55

Query  230  RFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTV  289
               +           FDW ++    D YI  +   Y+  L +  V +   +  FV  + V
Sbjct  56   AKDYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNKV  115

Query  290  KLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASY  349
            +++      +  T ++V+IA G  P +   PG  + + SDD F + E++P K  V+GA Y
Sbjct  116  QVA-----DRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRL-EQQPQKVAVVGAGY  169

Query  350  VALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISR  408
            +A+E AG    +  +  +  R   +LR F+  + D + E ME ++G+ F+R      + +
Sbjct  170  IAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGVEK  228

Query  409  -LENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVK-N  466
             L+ +  LV  V  + +   + F+T+L A GR P    LGL+  GVKL E  G I V   
Sbjct  229  QLDGKLTLVVNVHNEEQKFTD-FDTILFAVGRKPRTEDLGLEDIGVKLAE-GGFIQVDAQ  286

Query  467  EQTSTSNIYAIGDV-VDAPELTPVAIQSGRLLSQRLYNNS-SVQMDYDKVCTTVFTPIEY  524
            E TS   +YAIGD  V   ELTPVAI +GR L+ RL+       ++Y ++ + +F+    
Sbjct  287  ENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPPI  346

Query  525  GCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLG  584
            G  G +E  +  +YGE+N+++Y + FV L  S++        +  +  V ++     V+G
Sbjct  347  GTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLVTVGEQET---VVG  403

Query  585  FHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
             H  G  A E++Q  G+A+++  T     N V IHP  +E L  +
Sbjct  404  VHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>PHALS_09136
Length=493

 Score = 211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 157/482 (33%), Positives = 249/482 (52%), Gaps = 29/482 (6%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +VIGGG GG+A ++ AA+ G KV V   V+   +    GLGGTCVN GC+PKK++  
Sbjct  7    YDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPV--FDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
            +++    + H +    +  +   K      FDW  +    D YI+ +N  Y+  L +  V
Sbjct  64   TAVH---VEHLNRNKDYSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIYERNLSNAQV  120

Query  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
                 +   V    ++++         T ++V++A G  P     PG E+ + SD  F +
Sbjct  121  DVIQGIAKIVAKDKIQVA-----GHIYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFFKL  175

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQS  393
             E++P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  + D + E ME ++
Sbjct  176  -EQQPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-KA  233

Query  394  GIKFIRKTVPQSISRLE--NRQLLVKWVDEKGKTCE-EAFNTVLNATGRDPEVAHLGLDK  450
            G++F+R     S +R+E  N   L   V   G+  E   F+T+L A GR P    LGL++
Sbjct  234  GVEFVRN---MSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEE  290

Query  451  AGVKLNEKTGRIMVK-NEQTSTSNIYAIGDV-VDAPELTPVAIQSGRLLSQRLYNNS-SV  507
             GVKL +  G I V   E T+   +YAIGDV V   ELTPVAI +GR L+ RL+      
Sbjct  291  IGVKLADG-GYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDA  349

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS  567
             ++Y ++ T +F+    G  G +E  +  R+G++NI+IY + FV L  +++   R    +
Sbjct  350  CLNYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMADPERKGKTA  409

Query  568  CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLT  627
              +  V     ++ V+G H  G  A E++Q  G+A+++  T     N V IHP  +E L 
Sbjct  410  MKLVTV---GEEETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELV  466

Query  628  IL  629
             +
Sbjct  467  TM  468

>PHYKE_6836
Length=493

 Score = 210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 151/483 (31%), Positives = 252/483 (52%), Gaps = 31/483 (6%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD VVIGGG GG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK++  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGR---KYDGMGLGGTCVNYGCVPKKVMFN  63

Query  217  SSL-IGEIIRH-----DSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLR  270
            +++ +  + R+     ++A+  ++F +       FDW  +    D YI  +N  Y+  L+
Sbjct  64   TAMHVEHLARNRDYSINTAQRDFQFGD-------FDWSNMKTKRDAYILRLNGIYERNLQ  116

Query  271  SKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDD  330
            ++ V +   +   V    +++       +  T +N+++A G  P     PG E+ + SD 
Sbjct  117  NQQVDHVQGIAKIVAKDKIQVD-----GQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDG  171

Query  331  IFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYM  389
             F + E++P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  + D + E M
Sbjct  172  FFKL-EQQPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEM  230

Query  390  EVQSGIKFIRKTVPQSISRLENRQL-LVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGL  448
            E ++G+KF+R +    + +  + +L  V  VD K +   + F+T+L A GR P    LGL
Sbjct  231  E-KAGVKFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPD-FDTILYAVGRTPRTKDLGL  288

Query  449  DKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNS-S  506
            ++  VKL++     +   E TS   +YAIGD      ELTPVAI +GR LS RL+     
Sbjct  289  EEINVKLSQDGFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKD  348

Query  507  VQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASN  566
              ++Y ++ T +F+    G CG +E  +  ++G++NI+ Y + FV L  S++   R    
Sbjct  349  ACLNYHQIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKT  408

Query  567  SCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
            +  +  V ++     V         A E++Q  G+AM++  T     N V IHP  AE L
Sbjct  409  AMKLVCVGEEEVVVGVHVAGEG---ADEMIQGFGVAMKMNATKADFDNIVAIHPTAAEEL  465

Query  627  TIL  629
              +
Sbjct  466  VTM  468

>HYAP_04843
Length=430

 Score = 206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 133/418 (32%), Positives = 217/418 (52%), Gaps = 24/418 (6%)

Query  224  IRHDSARFGWKFDNEGKTVPV---FDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFL  280
            ++HD   +G++ +  G ++     FDW +L    D Y++ +N  Y+  L S  V++    
Sbjct  5    LQHDVVHYGFEKEGTGGSLGAQMHFDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGS  64

Query  281  GSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPG  340
              F     V++       K++  +NV+IAVG +P     PG E  + SD  F + +  P 
Sbjct  65   ARFNKQGNVEVD-----GKEVLAKNVMIAVGGKPMIPDIPGKELCIDSDGFFEL-DTLPK  118

Query  341  KTLVIGASYVALECAGFLKGMGYEVKVMVRSI-LLRSFDQEMADKIGEYMEVQSGIKFIR  399
            K  VIGA Y+A+E AG L  +G E  +  R   +LR+FD    D +   +E    I  + 
Sbjct  119  KVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFD----DIVRTTLEDAMAIDGLH  174

Query  400  KTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKT  459
                 +++R+E        +     +    F+ V+ A GR P    L LD AGV  N K 
Sbjct  175  LRPNSNVARVEQAADGTNTLVLTDGSAHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KH  233

Query  460  GRIMVKN-EQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN-SSVQMDYDKVCTT  517
            G I+V   ++TS S ++A+GDV   P LTPVA+ +GR LS RL+ N    ++ Y+ + T 
Sbjct  234  GYIVVNEFQETSNSKVFAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTV  293

Query  518  VFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS------CYIK  571
            VF+    G  GL+E+ ++G+YG+D+I++Y ++FV + + L +E   A+          IK
Sbjct  294  VFSHPPIGTIGLTEKQAQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIK  353

Query  572  VVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +VC   ++K V+G H +G  A E++Q  G+A+++  T     N + IHP  +E L  L
Sbjct  354  LVCAGKKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYVX_21517
Length=482

 Score = 182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 144/498 (29%), Positives = 240/498 (48%), Gaps = 76/498 (15%)

Query  156  DYDLVVIggglgglACSKEAASF-GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            ++DL+VIG G GG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK++
Sbjct  27   EFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPKKIM  77

Query  215  HQSSLIGEIIRHDSARFGWK-FDNEGKTVPV---FDWKQLVANVDGYIKTINFKYKVKLR  270
            +  + +   +  D+  +G++   + GK++     FDW++L    D Y+  +N  Y+  L 
Sbjct  78   YTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYERNLA  137

Query  271  SKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCP----GGEYAV  326
            +  V+       F     +++        ++  + V++AVG +P     P    G E  +
Sbjct  138  NSKVELLTGTARFNVDGKIEVD-----GVEVRAKKVLLAVGGKPLIPDIPVAATGKELCI  192

Query  327  SSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFD-------  378
             SD  F + E+ P K  V+GA Y+A+E AG L  +G +  +  R   +LRSFD       
Sbjct  193  DSDGFFEL-EQLPRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWNSQFL  251

Query  379  -----QEMADKIGEYMEVQSGIKFIRKTVPQS-ISRLENRQLLVKWVDEKGKTCEEAFNT  432
                 QE+     +    Q G+       P S I R+E      K +     +    F +
Sbjct  252  AGDSEQEIVRSTLQDTMAQDGVTL----RPHSNIERVELAADGTKTLVLADGSTHTGFES  307

Query  433  VLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKN-EQTSTSNIYAIGDVVDAPELTPVAI  491
            V+ A GR P    LGLD AGV  +E+ G I V   +QT+  +I A+GD      LTP++ 
Sbjct  308  VIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTIALTPIS-  365

Query  492  QSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFV  551
                               Y+ V T VF+    G  GL+E+ ++ ++G++ I+IY + FV
Sbjct  366  -------------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYKSTFV  406

Query  552  PLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQ  611
             + + + +E           +VC    D+ ++G H +G  A E++Q  G+A+++  T   
Sbjct  407  NMYYGVVNE-----------LVC-AGPDEKIVGLHVIGMGADEMLQGFGVAVKMGATKAD  454

Query  612  MVNTVGIHPMTAESLTIL  629
            + + V IHP  AE L  +
Sbjct  455  LDSCVAIHPTGAEELVTM  472

>PYAR_17714
Length=444

 Score = 176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 143/479 (30%), Positives = 229/479 (48%), Gaps = 66/479 (14%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI-H  215
            YD +VIGGG GG+A ++ AA  G KV +++  + +      GLGGTCVN GC+PKK++ +
Sbjct  7    YDYIVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPKKVMWN  63

Query  216  QSSLIGEIIRHD--SARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKN  273
             +S +  + R+   S R G +F         FDW  + A  D YI  +N  Y+  + +  
Sbjct  64   AASHVEHLARNADYSIRSGAEFQYGD-----FDWANMAAKRDAYILRLNGIYERNIGNAK  118

Query  274  VKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFW  333
            +     + S      V +      T     +++++AVG  P     PG E+A+ SDD F 
Sbjct  119  IDLIEGIASLTAKDAVTVDGK---TXXXXGKHILVAVGGVPAMPQIPGIEHAIDSDDFFK  175

Query  334  MKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQ  392
            +K  +P K  V+GA Y+A+E AG    +  E  +  R   +LR+FD  + D +   M+ +
Sbjct  176  LK-TQPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMD-K  233

Query  393  SGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAG  452
             G+ F+R++   +I +  + +L V+   +   T    F+ VL A GR+P    LGL+  G
Sbjct  234  HGVHFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLESVG  293

Query  453  VKLNEKTGRIMV-KNEQTSTSNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNSSVQMD  510
            VKL++  G I V K E TS   +YAIGD      ELTP                      
Sbjct  294  VKLSD-AGFIEVDKFENTSVDGVYAIGDATTTGYELTP----------------------  330

Query  511  YDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYI  570
                                E   K  +G D++++Y + FV L ++++     +  +  +
Sbjct  331  -------------------PEAVEK--FGADHVKVYTSTFVNLLYAMADPDHKSKTA--M  367

Query  571  KVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            K+VC    ++ V+G H  G  A E++Q  G+A+++  T     N V IHP  AE L  +
Sbjct  368  KLVCVGENEQ-VVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEELVTM  425

>PYIR_23431
Length=468

 Score = 172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 128/462 (28%), Positives = 215/462 (47%), Gaps = 46/462 (10%)

Query  173  KEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFG  232
            + AA++G KV V++  +   +    GLGGTCVN GC+PKK++  +S     + H +    
Sbjct  23   RRAATYGAKVLVVERGR---KYDGMGLGGTCVNYGCVPKKVMFNAS---AHVEHLNRNAD  76

Query  233  WKFDNEGKT---VPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTV  289
            +     G        FDW  +    D YI  +N  Y+  L +  V     +   V  + +
Sbjct  77   YSITTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQI  136

Query  290  KLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASY  349
            +++         T +++++AVG +P     PG E+ + SD  F + E +P K  V+GA Y
Sbjct  137  EVN-----GVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRL-EAQPKKVAVVGAGY  190

Query  350  VALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISR  408
            +A+E AG    +  +  +  R   +LR FD  + D I E  E ++GI F+R +  + I +
Sbjct  191  IAIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDK  249

Query  409  LENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQ  468
              +  L +    +  +     F+T+L A GR+P    LGL++ GVKL +    ++   E 
Sbjct  250  QADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQEN  309

Query  469  TSTSNIYAIGDV-VDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCC  527
            TS   IYAIGD  +   ELTP+                          T VF+    G  
Sbjct  310  TSVPGIYAIGDATITGWELTPIP-------------------------TVVFSHPPLGTI  344

Query  528  GLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHY  587
            G +E  +  ++G +N+++Y + FV L ++++        +  +K+V     +  V   H 
Sbjct  345  GYTEPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTA--MKLVTVGEDEVVVG-VHV  401

Query  588  LGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
             G  A E++Q  G+A+++  T     N V IHP  AE L  +
Sbjct  402  AGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>PYVX_16175
Length=446

 Score = 161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 126/459 (27%), Positives = 207/459 (45%), Gaps = 58/459 (13%)

Query  173  KEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFG  232
            + AAS G KV +++  + +      GLGGTCVN GC+PKK++  ++   E +        
Sbjct  23   RRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPKKVMFNAAAHVEHLNRAGDYSV  79

Query  233  WKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLS  292
                        FDW  +    D YI  +N  Y+  L +  +     +   V  + +++ 
Sbjct  80   TTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKIDVVQGVARVVARNQLEVD  139

Query  293  HPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVAL  352
                  K  T +N+++A G  P     PG E+A+ SD  F + E++P K  V+GA Y+A+
Sbjct  140  -----GKVYTGKNLLLAPGGVPTLPPIPGIEHAIDSDGFFKL-EQQPRKVAVVGAGYIAV  193

Query  353  ECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLEN  411
            E AG    +  E  +  R   +LR+FD  + D +   ME ++G++F+R++    I +LE+
Sbjct  194  EIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME-KNGVQFVRRSHITRIDKLED  252

Query  412  RQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTST  471
             +L +    +        F+TVL A GR+P  A LGL+  GV L++K    +   E TS 
Sbjct  253  GKLQITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEAIGVDLDDKGFIKVDAQENTSA  312

Query  472  SNIYAIGDVVDAP-ELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLS  530
            + +YAIGD      ELTP                       D V                
Sbjct  313  AGVYAIGDATTTGWELTPP----------------------DAVA---------------  335

Query  531  EETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGP  590
                  +YG +N+++Y + FV L  +++        +  +  V  +   + V+G H  G 
Sbjct  336  ------KYGAENVKVYTSTFVNLVHAMADPDHKGKTAMKLVTVGAQ---ETVVGVHVAGE  386

Query  591  NAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
             A E++Q  G+A++L  T     N V IHP  +E L  +
Sbjct  387  GADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELVTM  425

>CCA22989
Length=494

 Score = 135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 136/480 (28%), Positives = 220/480 (46%), Gaps = 34/480 (7%)

Query  156  DYDLVVIggglgglACSKEAASFGQK-VCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            +YDL+VIGGG GG   + +AA  G K VC+        +GT   LGGTC+NVGCIP K +
Sbjct  26   EYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPSKAL  76

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
              SS +    +HD    G +  +        ++ +++   +  +K +    +   +   V
Sbjct  77   LHSSHMFHTAQHDFKAIGIEASD-----LRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKV  131

Query  275  KYENFLGSFV--DPHTVKLSHPRKGTKQITTRNVVIAVGSRPREL-TCPGGE---YAVSS  328
             Y    G+ V  D  +V  S   KG + I  +N++IA GS    L  CP        V S
Sbjct  132  AYIKGHGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRIVDS  191

Query  329  DDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVM-VRSILLRSFDQEMADKIGE  387
                 +K   P + +V+GA  + LE     + +G  V V+   + +    D E+  +  +
Sbjct  192  TGALVLKST-PKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREFAK  250

Query  388  YMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLG  447
             ++ Q G KF   T   S    E+R  +     + G       + VL ATGR P   +LG
Sbjct  251  TLQKQ-GFKFKFATKVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPFTQNLG  309

Query  448  LDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSS  506
            L+  G++  +K GRI V N  +T   NIYAIGDV+  P L   A + G + +  +     
Sbjct  310  LENLGIQ-TDKLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGKQ  367

Query  507  VQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASN  566
              ++Y+ +   ++T  E  C G +EE  K    E+ +  Y+    P+  + S        
Sbjct  368  GHVNYNAIPGVIYTFPEVACVGRTEEQLK----EEGVS-YNVGKFPM-IANSRARAVGET  421

Query  567  SCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
              ++KV+  K  D+ +LG H +  NAGE++    L +    + + +  T   HP  +E+L
Sbjct  422  DGFVKVLAQKDNDR-ILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTLSEAL  480

>CCI10477
Length=494

 Score = 135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 141/484 (29%), Positives = 223/484 (46%), Gaps = 42/484 (9%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  26   EYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKALL  77

Query  216  QSSLIGEIIRHDSARFGWKFD----NEGKTVPVFD--WKQLVANVDGYIKTINFKYKVKL  269
             SS +    +HD    G +      N GK +   +   K L + ++G  K     Y +K 
Sbjct  78   HSSHLFHTAQHDFKSIGIEVSDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAY-IKG  136

Query  270  RSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPREL-TCP-GGEYAVS  327
              K V             +V LS   KG + IT +N++IA GS    L  CP   E    
Sbjct  137  HGKIVAKNQV--------SVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKI  188

Query  328  SDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGMGYEVKVM-VRSILLRSFDQEMADKI  385
             D    +  K  P + +V+GA  + LE     + +G  V V+   + +    D E+  + 
Sbjct  189  VDSTGALVLKSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREF  248

Query  386  GEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKG--KTCEEAFNTVLNATGRDPEV  443
             + ++ Q G+KF   T   S +++    + +   D KG  +T  E  + VL ATGR P  
Sbjct  249  AKTLQKQ-GLKFKFATRVTS-TKVNGDNVTITMEDAKGGNETSMEC-DVVLVATGRRPFT  305

Query  444  AHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLY  502
              LGL+  G++  +K GRI V +  +T+  +IYAIGDV+  P L   A + G + +  + 
Sbjct  306  NGLGLESMGIQ-TDKMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IAAVEIM  363

Query  503  NNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETR  562
                  ++Y+ +   ++T  E  C G +EE  K    E+ I  Y+    P+  + S    
Sbjct  364  LGKHGHVNYNAIPGVIYTHPEVACVGKTEEQLK----EEGIS-YNVGKFPM-IANSRARA  417

Query  563  TASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMT  622
                  ++KV+  K  D+ +LG H +  NAGE++    L +      + +  T   HP  
Sbjct  418  VGETDGFVKVLAQKDNDR-ILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTL  476

Query  623  AESL  626
            +E+L
Sbjct  477  SEAL  480

>PYAP_22645
Length=1565

 Score = 135 bits (341),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 138/490 (28%), Positives = 228/490 (47%), Gaps = 39/490 (8%)

Query  145   SSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCV  204
             SSTA  E     YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+
Sbjct  1093  SSTASSE-----YDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCL  1139

Query  205   NVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFK  264
             NVGCIP K +  ++ +    +HD +++G +  +        ++  ++ + +  +KT+   
Sbjct  1140  NVGCIPSKALLHATHMYHAAQHDFSKYGIEVSDVK-----MNFDGMMKSKEKAVKTLTGG  1194

Query  265   YKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSR-----PRELTC  319
              +   +   V Y    G  V  + V ++    G + +  +N++IA GS      P  +  
Sbjct  1195  IEGLFKKNKVTYVKGFGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDN  1254

Query  320   PGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVM-VRSILLRSFD  378
               G+  V S     +K K P   +VIG   + LE     K +G +V V+     +    D
Sbjct  1255  AAGKI-VDSTGALELK-KVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLD  1312

Query  379   QEMADKIGEYMEVQSGIKFIRKT-VPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNAT  437
             QE+  +  + ++ Q G++F   T V  S    +   L V+       +  EA +TVL AT
Sbjct  1313  QELGKEFTKLLKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVAT  1370

Query  438   GRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRL  496
             GR P    LGL++ G++  +K GRI V N  +T   NI+AIGDV+  P L   A + G  
Sbjct  1371  GRRPFTKGLGLEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIA  1429

Query  497   LSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWS  556
               + +       ++YD +   ++T  E    G +EE  K    E+ +  Y+    P+  +
Sbjct  1430  CVENIAGLHG-HVNYDAIPGVIYTYPEVASVGKTEEQLK----EEGV-AYNVGKFPM-MA  1482

Query  557   LSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTV  616
              S     A +  ++KV+ DK+ D+ +LG H +  NAGE++    L M      + +  T 
Sbjct  1483  NSRARAVAESDGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTC  1541

Query  617   GIHPMTAESL  626
               HP  +E+ 
Sbjct  1542  HAHPTLSEAF  1551

>PYIR_20273
Length=505

 Score = 132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 133/499 (27%), Positives = 221/499 (44%), Gaps = 40/499 (8%)

Query  142  AEISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGG  201
            A+++S         +YDLVVIGGG GG   + +AA  G K   ++        +   LGG
Sbjct  19   AQVTSARAFSSASTEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGG  70

Query  202  TCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTI  261
            TC+NVGCIP K +  S+ +    +HD A++G +           ++ +++ + +  +KT+
Sbjct  71   TCLNVGCIPSKALLHSTHLYHSAQHDFAKYGIEVSEVS-----MNFGKMMKSKEKAVKTL  125

Query  262  NFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSR-----PRE  316
                +   +   V Y    G  V  + V ++    G + +T +N++IA GS      P  
Sbjct  126  TGGIEQLFKKNKVTYIKGHGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVP  185

Query  317  LTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLR-  375
            +    G+  V S     +K K P   +V+GA  + LE     K +G   KV V   L R 
Sbjct  186  VDNAAGKI-VDSTGALELK-KVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRV  241

Query  376  --SFDQEMADKIGEYMEVQS-GIKFIRKTVPQSIS----RLENRQLLVKWVDEKGKTCEE  428
                D E+  +  + ++ Q  G +F  K     ++     L             G     
Sbjct  242  CPGLDLELGKEFTKLLKKQGLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTI  301

Query  429  AFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELT  487
              + VL ATGR P    LGL+  G++  +K GRI V +  +T   NI+AIGDV+  P L 
Sbjct  302  ECDAVLVATGRRPYTNGLGLENMGIQ-TDKFGRISVDDHFRTQIPNIFAIGDVIAGPMLA  360

Query  488  PVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYH  547
              A + G   ++ +       ++Y+ +   ++T  E    G +EE  K    E+ +  Y+
Sbjct  361  HKAEEEGIACAETIAGKHG-HVNYNAIPGVIYTFPEVASVGKTEEQLK----EEGV-TYN  414

Query  548  TNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRF  607
                P+  + S           +KV+ DK+ DK +LG H +  NAGE++    L M    
Sbjct  415  VGKFPM-LANSRARAVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGA  472

Query  608  TYDQMVNTVGIHPMTAESL  626
            + + +  T   HP  +E+ 
Sbjct  473  SSEDIARTCHAHPTLSEAF  491

>PYVX_21248
Length=502

 Score = 126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 143/520 (28%), Positives = 235/520 (45%), Gaps = 59/520 (11%)

Query  124  RSGIAVGRPQGMHTSDEVAEISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVC  183
            RS +A  RP    TS   A  S          +YD+VVIGGG GG   + +AA  G K  
Sbjct  11   RSALATRRPFLSSTSRAFASASDP--------EYDVVVIGGGPGGYVAAIKAAQLGLKTA  62

Query  184  VLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVP  243
             ++        +   LGGTC+NVGCIP K +  S+ +    +HD A++G + +       
Sbjct  63   CVE--------SRGKLGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEG------  108

Query  244  VFDWKQLVANVDGYIK-------TINFKYKVKLRSKNVKYENFLGSFVDPHTVKLS-HPR  295
                  + AN+ G +K       T+    +   +   V Y    G  V  + V ++ +  
Sbjct  109  ------VKANLGGMMKAKEKAVTTLTGGIESLFKKNKVTYIKGHGKIVGKNEVAVALNDD  162

Query  296  KGTKQITTRNVVIAVGSRPREL---TCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVAL  352
            KG + +T +N++IA GS P  L        ++ +          K P   +V+GA  + L
Sbjct  163  KGNQTVTAKNIMIATGSEPAPLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGL  222

Query  353  ECAGFLKGMGYEVKVMVRSILLRS---FDQEMADKIGEYMEVQSGIKFIRKT-VPQSISR  408
            E     K +G   KV V   L R+    D E++ +  + ++ Q G++F   T V  S  +
Sbjct  223  ELGSVYKRLGS--KVTVVEFLDRACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVK  279

Query  409  LENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-  467
             +N  L V+     G       +TVL ATGR P    LGL++ G++  +K GR+ V +  
Sbjct  280  GDNVTLTVEP-SAGGSAASIECDTVLVATGRRPFTEGLGLEQMGIQ-TDKQGRVEVDSHF  337

Query  468  QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCC  527
            +T   NIYA GDV+    L   A + G   ++ + +     ++YD +   ++T  E    
Sbjct  338  RTQIPNIYAFGDVIKGAMLAHKAEEEGVACAE-IISGKHGHVNYDAIPGVIYTTPEVASV  396

Query  528  GLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRT-ASNSCYIKVVCDKSRDKFVLGFH  586
            G +EE  K     +    Y+    P+    +S  RT A    ++K++ DK+ D+ +LG H
Sbjct  397  GKTEEELK-----NEGVTYNVGKFPMMA--NSRARTIAEADGFVKILADKATDR-ILGVH  448

Query  587  YLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
             +  NAGE++    L +    + + +  T   HP  +E+ 
Sbjct  449  IIAGNAGEMVAEGVLGLEYGASSEDIARTCHAHPTLSEAF  488

>SPRG_09825
Length=492

 Score = 125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 135/490 (28%), Positives = 224/490 (46%), Gaps = 55/490 (11%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSKALL  76

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
             ++      +HD    G + D         D+ +L+A+ D  +K +    +   +   V 
Sbjct  77   SATHKYHAAQHDFKNVGIEVDG-----LRIDFAKLMASKDKSVKILTGGIEGLFKKNKVD  131

Query  276  YENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVSSDD  330
            Y    G  V  + V ++    G K ++T+N++IA GS      P  +    G+  + S  
Sbjct  132  YIKGFGKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKI-IDSTG  190

Query  331  IFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYME  390
               +K + P   +VIG   + LE       +G ++ V+           E ADKI   M+
Sbjct  191  ALSLK-RIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMD  238

Query  391  VQSGIKFIRKTVPQSISRLENRQLLVKWV--DEKGKTCEEAF---------NTVLNATGR  439
             ++G +F +    Q ++    +++    V  D+   T E A          +TVL ATGR
Sbjct  239  FETGREFQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGR  298

Query  440  DPEVAHLGLDKAGVKLNEKTGRIMV--KNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLL  497
             P    LGL++ G++  +K GRI V   N +T+  NI+AIGD ++   L   A + G   
Sbjct  299  RPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISC  357

Query  498  SQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSL  557
             + +       ++Y+ +   V+T  E    G +EE  K      N+  Y+    P+    
Sbjct  358  VESIAGGHG-HVNYNAIPGVVYTFPEVASVGKTEEELKAA----NVA-YNVGKFPMMA--  409

Query  558  SSETRTASNS-CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTV  616
            +S  RT   +  ++K++  K  DK +LG H +  NAGE++    L +    + + +  T 
Sbjct  410  NSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTC  468

Query  617  GIHPMTAESL  626
              HP  +E+ 
Sbjct  469  HAHPTLSEAF  478

>SPRG_19943
Length=343

 Score = 122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 142/270 (53%), Gaps = 18/270 (7%)

Query  144  ISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTC  203
            + + A   + +  YD +V+G G GG++ +  A ++G KV V++           GLGGTC
Sbjct  8    VGTVANYARSMATYDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTC  64

Query  204  VNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINF  263
            VNVGC+PKK++  ++L  E++ H +  + +K   + +    FDW  + A  D Y+K +N 
Sbjct  65   VNVGCVPKKIMFNAALHAEML-HSARAYAFKGVQDIQ-FGAFDWAAMKAKRDAYVKWLND  122

Query  264  KYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGE  323
             Y   +    V        FVD HTV+++  R      T ++++IAVG  P     PG E
Sbjct  123  MYGEGMLEDKVDLVMGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIE  177

Query  324  YAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMA  382
            +A+SSD  F + E +P K  V+GA Y+A+E AG    +  +  +  R + +LR+FD  + 
Sbjct  178  HAISSDGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVR  236

Query  383  DKIGEYME------VQSGIKFIRKTVPQSI  406
            D +   ME      VQ+ +K +   V +++
Sbjct  237  DLVNSEMEHAGKEKVQTAMKLVCIGVEETV  266

 Score = 35.4 bits (80),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 32/60 (53%), Gaps = 1/60 (2%)

Query  570  IKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +K+VC    ++ V+G H  G  A E++Q  G+A+++        N V IHP  +E L  +
Sbjct  255  MKLVC-IGVEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  313

>SDRG_06945
Length=492

 Score = 123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 133/490 (27%), Positives = 222/490 (45%), Gaps = 55/490 (11%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSKALL  76

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
             ++      +HD    G + D         D+ +L+A+ D  +K +    +   +   + 
Sbjct  77   SATHKYHAAQHDFKNVGIEVDG-----LRIDFAKLMASKDKSVKILTGGIEGLFKKNKID  131

Query  276  YENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVSSDD  330
            Y    G  V  + V ++    G K ++T+N++IA GS      P  +    G+  + S  
Sbjct  132  YIKGFGKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKI-IDSTG  190

Query  331  IFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYME  390
               +K + P   +VIG   + LE       +G ++ V+           E ADKI   M+
Sbjct  191  ALSLK-RIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMD  238

Query  391  VQSGIKFIRKTVPQSISRLENRQLLVKWV--DEKGKTCEEAF---------NTVLNATGR  439
             ++G +F +    Q ++    +++    V  D+   T E A          +TVL ATGR
Sbjct  239  FETGREFQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGR  298

Query  440  DPEVAHLGLDKAGVKLNEKTGRIMV--KNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLL  497
             P    LGL++ G++  +K GRI V   N +T+  NI+AIGD ++   L   A + G   
Sbjct  299  RPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISC  357

Query  498  SQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSL  557
             + +       ++Y+ +   V+T  E    G +EE  K          Y+    P+    
Sbjct  358  VESIAGGHG-HVNYNAIPGVVYTFPEVASVGKTEEELKAAG-----VAYNVGKFPMMA--  409

Query  558  SSETRTASNS-CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTV  616
            +S  RT   +  ++K++  K  DK +LG H +  NAGE++    L +    + + +  T 
Sbjct  410  NSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTC  468

Query  617  GIHPMTAESL  626
              HP  +E+ 
Sbjct  469  HAHPTLSEAF  478

>PYU1_G001737
Length=133

 Score = 112 bits (281),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query  31   TFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFG  90
            T+++AGW+ C  F KA ++ +AMQ+LYPD L F +  F DR+ FR WL  S+ DFA  FG
Sbjct  37   TYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFG  96

Query  91   AKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIA  128
            A S A+ H +SPFVW SN   FVGGCD LL   R  I+
Sbjct  97   ATSPALTHTSSPFVW-SNAGEFVGGCDALLATIRGSIS  133

>PHYKE_9680
Length=498

 Score = 119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 116/439 (26%), Positives = 201/439 (46%), Gaps = 31/439 (7%)

Query  199  LGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYI  258
            LGGTC+NVGCIP K +  S+ +    +HD   +G   D  G      ++ Q++   +  +
Sbjct  66   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYG--IDAPGVKA---NFPQMMKAKEKAV  120

Query  259  KTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLS-HPRKGTKQITTRNVVIAVGSR----  313
            KT+    ++  +   V Y    G       V ++    KG + +  +N++IA GS     
Sbjct  121  KTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTPL  180

Query  314  -PRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVM-VRS  371
             P  +    G+   S+  +    ++ P   +V+GA  + LE     K +G +V V+  + 
Sbjct  181  PPVPVDNEAGKIIDSTGALVL--KRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQD  238

Query  372  ILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAF-  430
                  D+E   +  + ++ Q G+ F   T    ++  E    +VK   E  K  +EA  
Sbjct  239  AACPGMDKECVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEASI  294

Query  431  --NTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELT  487
              +TVL ATGR    A LGL++ G++  +K GR+ V +  +T    I+AIGDV+    L 
Sbjct  295  ECDTVLVATGRRAYTAGLGLEQMGIQ-TDKLGRVEVDDAFRTQVPGIFAIGDVIKGAMLA  353

Query  488  PVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYH  547
              A + G    + +       ++Y  +   ++T  E+   G +EE  K     + IE Y+
Sbjct  354  HKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKA----EGIE-YN  407

Query  548  TNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRF  607
                P+  +  + T  A     +KV+ DK  DK +LG H +  NAGE++    +A+    
Sbjct  408  VGKFPMMANSRART-VAEADGLVKVLSDKKTDK-MLGVHIIASNAGEMIAEGVIALEYGA  465

Query  608  TYDQMVNTVGIHPMTAESL  626
            + + +  T   HP  +E+L
Sbjct  466  SSEDIARTCHAHPTLSEAL  484

>PHYRA_72215
Length=499

 Score = 114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 132/483 (27%), Positives = 219/483 (45%), Gaps = 41/483 (8%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  32   DYDVVVIGGGPGGYVAAIKAAQLGFKTACVE--------SRGKLGGTCLNVGCIPSKALL  83

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
             S+ +    +HD   +G   D  G T    ++ Q++   +  + T+    +   +   V 
Sbjct  84   HSTHLLHTAQHDFKSYG--IDAPGVTA---NFPQMMKAKEKAVTTLTGGIESLFKKNKVT  138

Query  276  YENFLGSFVDPHTVKLS-HPRKGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVSSD  329
            Y    G       V ++ +  KG + +  +N++IA GS      P  +    G+   S+ 
Sbjct  139  YIKGYGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTG  198

Query  330  DIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVM-VRSILLRSFDQEMADKIGEY  388
             +     + P   +V+GA  + LE     K +G +V V+  +       D+E   +  + 
Sbjct  199  ALALT--RVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKEAVKEFTKL  256

Query  389  MEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAF---NTVLNATGRDPEVAH  445
            ++ Q G+ F   T    ++  E    +VK   E  K    A    +TVL ATGR    A 
Sbjct  257  LKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGNAATIECDTVLVATGRRAFTAG  312

Query  446  LGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN  504
            LGL++ G++  +K GRI V +  +T    I+AIGDV+    L   A + G    + +   
Sbjct  313  LGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGK  371

Query  505  SSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRT-  563
                ++Y  +   ++T  E+   G +EE  K     + IE Y+    P+    +S  RT 
Sbjct  372  HG-HVNYGAIPGVIYTFPEFASVGKTEEELKA----EGIE-YNVGKFPMMA--NSRARTV  423

Query  564  ASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTA  623
            A     +KV+ DK  DK +LG H +  NAGE++    +A+    + + +  T   HP  +
Sbjct  424  AEADGLVKVLADKKTDK-MLGVHIIASNAGEMISEGVIALEYGASSEDIARTCHAHPTLS  482

Query  624  ESL  626
            E+ 
Sbjct  483  EAF  485

>HYAP_12621
Length=501

 Score = 114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 126/481 (26%), Positives = 207/481 (43%), Gaps = 37/481 (8%)

Query  156  DYDLVVIggglgglACSKEAASFGQK-VCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            DYDLVVIGGG GG   + +AA  G K  CV    K         LGGTC+NVGCIP K +
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVESRGK---------LGGTCLNVGCIPSKAL  84

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
              S+ +    +H+   +G    N     P     Q++   +  ++T+    +       V
Sbjct  85   LHSTHLLHTAQHEFKSYGIDAPNVTANFP-----QMMKAKEKAVRTLTAGIESLFSKNKV  139

Query  275  KYENFLGSFVDPHTVKLS-HPRKGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVSS  328
             Y   +G       V ++   R+G   +T +N+++A GS      P  +    G+   S+
Sbjct  140  TYIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDST  199

Query  329  DDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEY  388
              +   +   P   +V+GA  + LE     K +G   KV V   L  +        + E+
Sbjct  200  GALALTRV--PEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDSACSGMDKGAVKEF  255

Query  389  MEV--QSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHL  446
            +++  + G++F   T   +     +   L       G       +TVL ATGR    A L
Sbjct  256  LKLLKKQGLEFQFGTKVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAGL  315

Query  447  GLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNS  505
            GL++ G++  +K GRI V +  QT    ++AIGDV+    L   A + G    + +    
Sbjct  316  GLEQMGIQ-TDKQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGKH  374

Query  506  SVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTAS  565
               ++Y  +   ++T  E+   G +EE  K    E N+  +     P+  +  + T  A 
Sbjct  375  G-HVNYGAIPNVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PMMANSRART-VAE  427

Query  566  NSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAES  625
                +KV+ DK  DK  LG H +  NAGE++    + +      + +  T   HP  +E+
Sbjct  428  ADGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEA  486

Query  626  L  626
             
Sbjct  487  F  487

>PHYSO_556052
Length=500

 Score = 114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 130/483 (27%), Positives = 217/483 (45%), Gaps = 41/483 (8%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  33   DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  84

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
             S+ +    +HD   +G          P     Q++   +  +KT+    +   +   V 
Sbjct  85   HSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKAKEKAVKTLTGGIESLFKKNKVT  139

Query  276  YENFLGSFVDPHTVKLS-HPRKGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVSSD  329
            Y    G       V ++ +  KG + +  +N++IA GS      P  +    G+  + S 
Sbjct  140  YIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKI-IDST  198

Query  330  DIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVM-VRSILLRSFDQEMADKIGEY  388
                +K + P   +V+GA  + LE     K +G +V V+  +       D+E   +  + 
Sbjct  199  GALSLK-RVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKL  257

Query  389  MEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAF---NTVLNATGRDPEVAH  445
            ++ Q G++F   T    ++  E    +VK   E  K  + +    +TVL ATGR    A 
Sbjct  258  LKKQ-GLEFQFGT---KVTASEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAG  313

Query  446  LGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN  504
            LGL++ G++  +K GRI V +  +T    I+AIGDV+    L   A + G    + +   
Sbjct  314  LGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENIAGK  372

Query  505  SSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTA  564
                ++Y  +   ++T  E+   G +EE  K     + IE Y+    P+    +S  RT 
Sbjct  373  HG-HVNYGAIPGVIYTFPEFASVGKTEEELKA----EGIE-YNVGKFPMMA--NSRARTV  424

Query  565  SNS-CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTA  623
            + S   +KV+ DK  DK  LG H +  NAGE++    + +      + +  T   HP  +
Sbjct  425  AESDGLVKVLADKKTDKL-LGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLS  483

Query  624  ESL  626
            E+ 
Sbjct  484  EAF  486

>PYU1_G014259
Length=244

 Score = 109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 132/248 (53%), Gaps = 22/248 (9%)

Query  127  IAVGRPQGMHTSDEVAEISSTAVQEKPIFDYDLVVIggglgglACSKEAASF-GQKVCVL  185
            + + + + + +  +++   S + Q++   +YD +VIG G GG+A S+ AAS+   +V V+
Sbjct  7    VQLAKRKALRSMRQISSTRSLSSQQQD--EYDYLVIGAGSGGMASSRRAASYPNTRVAVV  64

Query  186  DYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVP--  243
            +  +         LGGTCVNVGC+PKK+++ ++ +  ++  D+  +G++   +GK +   
Sbjct  65   EKAR---------LGGTCVNVGCVPKKIMYLAADMNHMLHRDAFHYGFE-TQDGKRIGEN  114

Query  244  -VFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQIT  302
              F W +L    D Y+  +N  Y+  L +  V       +F     V++       K++ 
Sbjct  115  VSFHWNKLKERRDAYVLRLNGIYERNLANSKVDLLQGTAAFNAQGNVEVD-----GKEVK  169

Query  303  TRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMG  362
             +N++IAVG +P     PG E+ + SD  F + E  P K  V+GA Y+A+E AG L G+G
Sbjct  170  AKNILIAVGGKPLIPDIPGKEHCIDSDGFFEL-EVLPKKVAVVGAGYIAVELAGVLNGLG  228

Query  363  YEVKVMVR  370
             +  +  R
Sbjct  229  SDTTIFCR  236

>H310_02523
Length=494

 Score = 112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 130/489 (27%), Positives = 215/489 (44%), Gaps = 53/489 (11%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            +YD+VV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K + 
Sbjct  27   EYDVVVVGGGPGGYVAAIKAAQLGLKTACVE-----ARGT---LGGTCLNVGCIPSKALL  78

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
              + +    +HD    G K DN        D+ QL+ + +  +K +    +   +   V 
Sbjct  79   HGTHLYHAAQHDFKSVGIKVDNVS-----IDFNQLMKSKEKTVKILTGGIEGLFKKNKVD  133

Query  276  YENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVSSDD  330
            Y    G  V    + ++    G + + T+N++IA GS      P  +   GG+  V S  
Sbjct  134  YVKGFGKIVAKGQLSVALNGGGNQTLHTKNILIATGSEVTPLPPVPVDNEGGKI-VDSTG  192

Query  331  IFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYME  390
               +K + P   +V+G   + LE       +G ++ V+           E ADKI   M+
Sbjct  193  ALSLK-RIPNHLVVVGGGVIGLEMGSVYGRLGSKITVV-----------EYADKICPTMD  240

Query  391  VQSGIKFIRKTVPQSISRLENRQLLVKWVD-----------EKGKTCEEAFNTVLNATGR  439
             +   +F +    Q ++    +++    VD             G       + VL ATGR
Sbjct  241  HELTKEFQKLLTKQGMTFKLGQKVTASKVDGDTVTLTVEPAAGGDATTIEADCVLVATGR  300

Query  440  DPEVAHLGLDKAGVKLNEKTGRIMVK--NEQTSTSNIYAIGDVVDAPELTPVAIQSGRLL  497
             P  A LGL+  G++  ++ GRI V   N QT+   IYAIGDV++   L   A + G  +
Sbjct  301  RPYTAGLGLEDMGIQ-TDRFGRIKVNLSNFQTNVDGIYAIGDVIEGAMLAHKAEEEGIAV  359

Query  498  SQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSL  557
             + +       ++YD +   ++T  E    G +EE  K      N+  Y+    P+  + 
Sbjct  360  VETIAGKHG-HVNYDAIPGVIYTFPEVASVGKTEEELKAA----NVA-YNVGKFPM-MAN  412

Query  558  SSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVG  617
            S          ++KV+  K  DK +LG H +  NAGE++    L +    + + +  T  
Sbjct  413  SRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEGVLGIEYGASAEDIGRTCH  471

Query  618  IHPMTAESL  626
             HP  +E+ 
Sbjct  472  AHPTLSEAF  480

>PYAR_20075
Length=469

 Score = 112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 125/483 (26%), Positives = 208/483 (43%), Gaps = 69/483 (14%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            +YDLVV+GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  30   EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  81

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
             S+ +    +HD  ++G +  +        D+  ++ + +  +KT+    +   +   V 
Sbjct  82   HSTHLFHTAQHDFKKYGIEVSD-----VQMDFGGMMKSKEKAVKTLTAGIESLFKKNKVT  136

Query  276  YENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMK  335
            Y    G  V  + V ++        +   N               G E  V S     +K
Sbjct  137  YIKGFGKIVAANEVAVA--------LNDNN---------------GNETIVDSTGALALK  173

Query  336  EKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGI  395
             K P   +VIG   + LE     K +G +V V+           E AD++   ++++ G 
Sbjct  174  -KAPEHLVVIGGGVIGLELGSVYKRLGSKVTVV-----------EYADRVCPGLDLELGK  221

Query  396  KFIRKTVPQSISRLENRQLLVKWV--DEKGKTCEEAF---------NTVLNATGRDPEVA  444
            +F +    Q +      ++    V  D+   T E A          +TVL ATGR P   
Sbjct  222  EFAKLLKKQGLDLQFKTKVTASQVNGDKVTLTVEPAAGGEATTIEADTVLVATGRRPFTN  281

Query  445  HLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYN  503
             LGL++ G++  +K GRI V    +T   +IYAIGDV+  P L   A + G    + +  
Sbjct  282  GLGLEQMGIQ-TDKMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIAG  340

Query  504  NSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRT  563
                 ++Y+ +   ++T  E    G +EE  K    E+ I  Y+    P+  + S     
Sbjct  341  LHG-HVNYNAIPGVIYTHPEVASVGKTEEQLK----EEGIA-YNVGKFPM-MANSRARAV  393

Query  564  ASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTA  623
                 ++KV+ DK+ DK +LG H +  NAGE++    L +      + +  T   HP  +
Sbjct  394  GEGDGFVKVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHPTLS  452

Query  624  ESL  626
            E+ 
Sbjct  453  EAF  455

>H257_16541
Length=494

 Score = 112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 115/446 (26%), Positives = 194/446 (43%), Gaps = 45/446 (10%)

Query  199  LGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYI  258
            LGGTC+NVGCIP K +   + +    +H+    G K DN        D+ QL+ + D  +
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHSAQHNFKSVGIKVDNVS-----IDFDQLMKSKDKTV  116

Query  259  KTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSR-----  313
            K +    +   +   V Y    G  V    V ++    G + + T+N++IA GS      
Sbjct  117  KILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVALNAGGNQTVNTKNILIATGSEVTPLP  176

Query  314  PRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSIL  373
            P  +   GG+  + S     +K + P   +V+G   + LE       +G ++ V+     
Sbjct  177  PVPVDNEGGKI-IDSTGALALK-RVPKHLVVVGGGVIGLEMGSVYGRLGSKITVV-----  229

Query  374  LRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVD-----------EK  422
                  E ADKI   M+ +   +F +    Q ++    +++    VD             
Sbjct  230  ------EYADKICPTMDHEVTKEFQKLLTKQGMTFKLGQKVTASKVDGDVVTLTVEPAAG  283

Query  423  GKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVK--NEQTSTSNIYAIGDV  480
            G+      + VL ATGR P  A LGL++ G++  +K GRI V   N QT+   I+AIGDV
Sbjct  284  GEATTIEADCVLVATGRRPFTAGLGLEEMGIQ-TDKFGRIKVNLSNFQTNVDGIFAIGDV  342

Query  481  VDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGE  540
            ++   L   A + G  + + +       ++YD +   ++T  E    G +EE  K     
Sbjct  343  IEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAIPGVIYTFPEVASVGKTEEELK----T  397

Query  541  DNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMG  600
             N+  Y+    P+  + S          ++KV+  K  DK +LG H +  NAGE++    
Sbjct  398  ANVA-YNVGKFPM-MANSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEGV  454

Query  601  LAMRLRFTYDQMVNTVGIHPMTAESL  626
            L +    + + +  T   HP  +E+ 
Sbjct  455  LGIEYGASAEDIGRTCHAHPTLSEAF  480

>PHALS_09942
Length=496

 Score = 111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 134/492 (27%), Positives = 214/492 (43%), Gaps = 59/492 (12%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            +YD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  29   EYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALL  80

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVP--VFDWKQLVANVDGYIKTINFKYKVKLRSKN  273
             S+ +    +H+       F N G   P    ++ Q++   D  +KT+    +   +   
Sbjct  81   HSTHLLHTAQHE-------FKNYGIDAPEVTANFPQMMKAKDKAVKTLTSGIESLFKKNK  133

Query  274  VKYENFLGSFVDPHTVKLS-HPRKGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVS  327
            V Y    G       V ++ H  KG + +  +N++IA GS      P  +    G+  V 
Sbjct  134  VTYIKGSGKISAQGEVSVALHDHKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-VD  192

Query  328  SDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGE  387
            S     +K + P   +V+GA  + LE     K +G +V V+           E  D    
Sbjct  193  STGALELK-RIPDHLVVVGAGVIGLELGSVYKRLGAKVTVV-----------EYLDDACT  240

Query  388  YMEVQSGIKFIRKTVPQS--------ISRLENRQLLVKWVDEKGKTCEEAF---NTVLNA  436
             M+  S   FI+    Q         ++  E    +VK   E  +  + A    +TVL A
Sbjct  241  GMDKGSVKDFIKLLKKQGLEFKFGTKVTASEINGDVVKLTTEPSQGGDAASIECDTVLVA  300

Query  437  TGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGR  495
            TGR    A LGL++ G++  +K GRI V    +T    I+AIGDV+    L   A + G 
Sbjct  301  TGRRAFTAGLGLEQMGIQ-TDKFGRIEVDEAFRTQVPGIFAIGDVIKGAMLAHKAEEEGI  359

Query  496  LLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEW  555
              ++ +       ++Y  +   ++T  E+   G +EE  K     + IE Y+    P+  
Sbjct  360  ACAEIIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKA----EGIE-YNVGKFPMMA  413

Query  556  SLSSETRTASNS-CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVN  614
              +S  RT   S   +KV+ DK  DK  LG H +  NAGE++    + +      + +  
Sbjct  414  --NSRARTVGESDGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDVAR  470

Query  615  TVGIHPMTAESL  626
            T   HP  +E+ 
Sbjct  471  TSHAHPTLSEAF  482

>PITG_15359
Length=496

 Score = 109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 128/483 (27%), Positives = 215/483 (45%), Gaps = 41/483 (8%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  29   DYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALL  80

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
             S+ +    +HD   +G          P     Q++ + +  +KT+    +   +   V 
Sbjct  81   HSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKSKEKAVKTLTGGIESLFKKNKVT  135

Query  276  YENFLGSFVDPHTVKLS-HPRKGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVSSD  329
            Y    G       + ++ +  KG + +  +N++IA GS      P  +    G+  + S 
Sbjct  136  YIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDST  194

Query  330  DIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVM-VRSILLRSFDQEMADKIGEY  388
                +K + P   +V+GA  + LE     K +G +V V+          D+E   +  + 
Sbjct  195  GALELK-RVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEFTKL  253

Query  389  MEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAF---NTVLNATGRDPEVAH  445
            ++ Q G+ F   T    ++  E    +VK   E  K  + +    +TVL ATGR    + 
Sbjct  254  LKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTSG  309

Query  446  LGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN  504
            LGL++ G++  +K GRI V +  +T    I+AIGDV+    L   A + G    + +   
Sbjct  310  LGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGK  368

Query  505  SSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRT-  563
                ++Y  +   ++T  E+   G +EE  K     + IE Y+    P+    +S  RT 
Sbjct  369  HG-HVNYGAIPGVIYTFPEFASVGKTEEELKA----EGIE-YNVGKFPMMA--NSRARTI  420

Query  564  ASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTA  623
            A     +KV+ DK  DK  LG H +  NAGE++    + +      + +  T   HP  +
Sbjct  421  AEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLS  479

Query  624  ESL  626
            E+ 
Sbjct  480  EAF  482

>PHYCA_123621
Length=495

 Score = 107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 131/498 (26%), Positives = 216/498 (43%), Gaps = 41/498 (8%)

Query  141  VAEISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLG  200
            VA  +STA       DYD+VVIGGG GG   + +AA  G K   ++        +   LG
Sbjct  13   VALRTSTARAFSSTNDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLG  64

Query  201  GTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKT  260
            GTC+NVGCIP K +  S+ +    +HD   +G          P     Q++   +  + T
Sbjct  65   GTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKAKEKAVTT  119

Query  261  INFKYKVKLRSKNVKYENFLGSFVDPHTVKLS-HPRKGTKQITTRNVVIAVGSR-----P  314
            +    +   +   V Y    G       V ++ +  KG + +  +N++IA GS      P
Sbjct  120  LTGGIESLFKKNKVTYIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPP  179

Query  315  RELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVM-VRSIL  373
              +    G+   S+  +     + P   +V+GA  + LE     K +G +V V+      
Sbjct  180  VPVDNAAGKIIDSTGALSLT--RVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAA  237

Query  374  LRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAF---  430
                D+    +  + ++ Q G+ F   T    ++  E    +VK   E  K  + +    
Sbjct  238  CPGMDKGAVKEFTKLLKKQ-GLDFKFST---KVTASEVNGDVVKLTTEPSKGGDASSIEC  293

Query  431  NTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPV  489
            +TVL ATGR    A LGL++ G++  +K GRI V +  +T    I+AIGDV+    L   
Sbjct  294  DTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHK  352

Query  490  AIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTN  549
            A + G    + +       ++Y  +   ++T  E+   G +EE  K    E N+  +   
Sbjct  353  AEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAEGVEYNVGKF---  408

Query  550  FVPLEWSLSSETRT-ASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFT  608
              P+    +S  RT A     +KV+ DK  DK  LG H +  NAGE++    + +     
Sbjct  409  --PMMA--NSRARTVAEADGLVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAA  463

Query  609  YDQMVNTVGIHPMTAESL  626
             + +  T   HP  +E+ 
Sbjct  464  SEDLARTCHAHPTLSEAF  481

>PHYRA_73883
Length=551

 Score = 101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 131/533 (25%), Positives = 230/533 (43%), Gaps = 71/533 (13%)

Query  145  SSTAVQEKPIFD----------YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQG  194
            SS A + KP+ D          +DL+VIG G  G  C+ ++A  G+ V ++D        
Sbjct  24   SSVACEPKPLTDTLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM----  79

Query  195  TAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANV  254
                LGG CV+ G +P K   +++L     RH +   G       K   V D  Q V  V
Sbjct  80   ----LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQA--GPSKRFGVEDILQRVRKV  133

Query  255  DGYIKTIN----FKYKVKLRSKNVKY----ENFLGSFVDPHTVKLSHPRKGT------KQ  300
            +     I      +  V+L +   ++    +N +    +      +  ++ T      + 
Sbjct  134  EDAETDITRHQLMRNGVQLINGTARFLPGNKNMVAVLSNESYETATDAKRHTSADICKRV  193

Query  301  ITTRNVVIAVGSRP-RELTCP-GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGF  357
            +T    ++ VG+RP R    P  GE    SD + W K K  P + +V+GA  V +E A  
Sbjct  194  LTADKFLVCVGTRPARHPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASM  253

Query  358  LKGM-GYEVKVM-VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLL  415
            +  + G +V V+  R  +L   D+E+++ +  Y   Q+G +F+ +   +S+ + +N ++ 
Sbjct  254  MTIIPGTDVTVIDGRKEILNMADKEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIF  312

Query  416  VKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNI  474
            V    E GKT     + +L   GR   V  L L+  G+   +K GRI V N  QT+  +I
Sbjct  313  VHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAAPHI  367

Query  475  YAIGDVVDAPELTPVAIQSGRL----------LSQRLYNNSSVQMDYDKVCTTVFTP--I  522
            YA GD++  P L   +++ GRL          L+ ++ ++     D D+V T + +    
Sbjct  368  YAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSGEVF  427

Query  523  EYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CD  575
             +G   + E +  G+    N +       P E  ++     A          ++K++ C 
Sbjct  428  PFGIYTVPEISMVGK----NEQQLTKEQTPYEVGMARYEELARGQMLGGVPGFLKIIFCP  483

Query  576  KSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
             +    +LG H +G  A E++    + M      +   N V  +P  AE+  +
Sbjct  484  DTLK--ILGVHAIGEGATEIIHIGQVVMSTGGNLEYFRNAVFNYPTLAEAYRV  534

>PYAP_19280
Length=512

 Score = 100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 127/501 (25%), Positives = 220/501 (44%), Gaps = 58/501 (12%)

Query  154  IFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKL  213
            +  YDLVVIG G     C+ E+A  G++V V+D      +G++  +GG CV+ G IP K 
Sbjct  27   VAQYDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKT  78

Query  214  IHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANV-DGYIKTINFKYKVKLRSK  272
              ++ L     RH    +G  +    KTV + D    V  V D  +  I    K +L++ 
Sbjct  79   FREAVLHLSGYRH-HGFYGKSYSM--KTVTIDDILYRVKRVVDSEVDVI----KAQLKAA  131

Query  273  NVKYENFLGSFVDPHTVKL------------SHPRKGTKQITTRNVVIAVGSRPRE--LT  318
             V Y      F + H + +               R  T+ +     +IA G+RP    L 
Sbjct  132  RVDYIPGFARFENDHEISIVREPTETNPEEEEPARLATR-LQADKFLIACGTRPAHSPLV  190

Query  319  CPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLR  375
               G+    SD I     +E P   +V+GA  + +E A  L  + G+ V V+  R  +L 
Sbjct  191  PIDGKVVFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILS  250

Query  376  SFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLN  435
              D E+   +   M V+ G +F+   + +SI ++E     VK +   GK    + + +L 
Sbjct  251  FCDNEVVSMLQHEMRVK-GARFL---LGESIQKVEKTAKGVKVLLNSGKVT--SADALLY  304

Query  436  ATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGR  495
              GR      L ++  G+  N++    + K+ QT  ++IYA+GD + AP L   +++ GR
Sbjct  305  TVGRQANTDGLNIEAVGLSRNQRGLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGR  364

Query  496  LLSQRLYNN----SSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFV  551
            L +  +++     ++ Q++       ++T  E    G +E+       + N EI    + 
Sbjct  365  LAACHMWDGNCDIATSQLENGNYPYGIYTIPEISMVGKTEQQLTAE--KVNYEIGIAKYS  422

Query  552  PLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQ--AMGLAMRLRFTY  609
             L      +    S++  +K++ D    K   G H +G  A E++    + +AM    TY
Sbjct  423  ELA---KGQMGGGSHNGILKILFDPDTLKL-HGVHAIGEGATEIIHIGQVAIAMGCSLTY  478

Query  610  --DQMVNTVGIHPMTAESLTI  628
              D + N    +P  AE+  +
Sbjct  479  FRDAVFN----YPTLAEAYRV  495

>PYVX_20512
Length=528

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 127/510 (25%), Positives = 216/510 (42%), Gaps = 65/510 (13%)

Query  152  KP-IFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIP  210
            KP + DYDLVVIG G     C+ E+A  G++V ++D            +GG CV+ G IP
Sbjct  32   KPRVADYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIP  83

Query  211  KKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVP--VFDWKQLVANVDGYIKTINFKYKVK  268
             K   ++ L     RH    +G  +  +  T+   ++  +++VA+    IK        +
Sbjct  84   SKTFREAVLHLSGYRH-HGFYGKSYSMKNITIDDILYRVQRVVASEVDVIKA-------Q  135

Query  269  LRSKNVKYENFLGSFVDPHTVKLSHPRKGT----------------KQITTRNVVIAVGS  312
            L++  V Y     SF  PH + +S     +                 ++     +IA G+
Sbjct  136  LKAARVDYIAGTASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGT  195

Query  313  RPRE--LTCPGGEYAVSSDDIFWMK-EKEPGKTLVIGASYVALECAGFLKGM-GYEVKVM  368
            RP    L    G+    SD I   +  + P   +V+GA  + +E A  +  + G+ V V+
Sbjct  196  RPAHNPLVPVDGKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVV  255

Query  369  -VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCE  427
              R  +L   D E+   +   M  + G +F+   + ++I  +E  +  VK     GK   
Sbjct  256  DGRPDILSFCDTEIISNLMYEMRSK-GARFL---LGETIKSIEKSERGVKVFFNSGKVAT  311

Query  428  EAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELT  487
               + +L   GR      L L+  G+  N +    + KN QT  ++IYA GD + AP L 
Sbjct  312  A--DALLYTVGRQASTDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALA  369

Query  488  PVAIQSGRLLSQRLYNN-----SSVQMDYDKVCTTVFTPIEYGCCGLSEE--TSKGRYGE  540
              +++ GRL +  ++++     S+ Q+D       ++T  E    G +E+  T +G   E
Sbjct  370  STSMEQGRLAACHMWDDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQQLTKEGVNYE  429

Query  541  DNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQ--A  598
              I  Y       E +    T   +      + C  S + F  G H +G  A E++    
Sbjct  430  VGIAKYS------ELAKGQMTGAIAGGMLKILFCPDSLELF--GVHAIGEGATEIIHIGQ  481

Query  599  MGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            + +AM    TY    N V  +P  AE+  +
Sbjct  482  VAIAMGCSLTY--FRNAVFNYPTLAEAYRV  509

>PYIW_25190
Length=206

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 95/186 (51%), Gaps = 5/186 (3%)

Query  446  LGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGD-VVDAPELTPVAIQSGRLLSQRLYNN  504
            LGL+  GVKLN+    ++   E TS S IYAIGD  +   ELTPVAI +GR L+ RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  505  S-SVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRT  563
                 + Y ++ T VF+    G  G +E  +  ++G  N++ Y + FV L  +++     
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMADPDHK  121

Query  564  ASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTA  623
               +  +K+V     +  V   H  G  A E++Q  G+AM++  T     N V IHP  +
Sbjct  122  GKTA--MKLVTVGEDEVVVGV-HVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAS  178

Query  624  ESLTIL  629
            E L  +
Sbjct  179  EELVTM  184

>PYAR_16840
Length=536

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 130/525 (25%), Positives = 223/525 (42%), Gaps = 73/525 (14%)

Query  146  STAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVN  205
            +T+  ++ +  YDLVVIG G     C+ E+A  G++V V+D        T  G+GG CV+
Sbjct  26   ATSSLKRHVAAYDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVH  77

Query  206  VGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANV-DGYIKTINFK  264
             G IP K   ++ L     RH    +G  +    KTV + D    V  V D  +  I   
Sbjct  78   TGTIPSKTFREAVLHLSGYRHHGF-YGKSYSM--KTVTIDDILYRVKRVVDSEVDVI---  131

Query  265  YKVKLRSKNVKYENFLGSFVDPHTVKL-------SHPRKGTKQITTRNVVIAVGSRPRE-  316
             K +L++  + Y   L  F + H + +               ++     +IA G+RP   
Sbjct  132  -KAQLKAARIDYLPGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHN  190

Query  317  -LTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-----  368
             L    G+  + SD I     +E P   +V+GA  + +E A  L  + G+ V V+     
Sbjct  191  PLVPVDGKVILDSDQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRND  250

Query  369  VRSILLRSFDQEMA----------------DKIGEYMEVQSGIKFIRKTVPQSISRLENR  412
            VR+ LL S D  +                 D+I   ++ +  +K  R  + ++I ++E  
Sbjct  251  VRN-LLTSRDMSLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKT  309

Query  413  QLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTS  472
               VK     GK    + + +L   GR      L L+  G+  N++    + K  QT   
Sbjct  310  ATGVKVFLTSGKVT--SGDALLYTVGRQASTDGLNLEAVGLGRNKRGLLTVNKAYQTEKP  367

Query  473  NIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSV---QMDYDKVCTTVFTPIEYGCCGL  529
            +IYA+GD + AP L   +++ GRL +  ++    +   Q++       ++T  E    G 
Sbjct  368  HIYAVGDCIGAPSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGK  427

Query  530  SEE--TSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHY  587
            +E+  TS+    + N EI    +      L+    +      +K++ D    + V G H 
Sbjct  428  TEQQLTSE----KVNYEIGLAKY----SELAKGQMSGGAFGMLKILFDPDTLR-VHGVHA  478

Query  588  LGPNAGEVMQ--AMGLAMRLRFTY--DQMVNTVGIHPMTAESLTI  628
            +G  A E++    + +AM    TY  D + N    +P  AE+  +
Sbjct  479  IGEGATEIIHIGQVAIAMGCSLTYFRDAVFN----YPTLAEAYRV  519

>CCI50816
Length=807

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 123/494 (25%), Positives = 212/494 (43%), Gaps = 47/494 (10%)

Query  154  IFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKL  213
            I  YDL+VIG G     C+ +AA  G+ V ++D            +GG CV+ G IP K 
Sbjct  27   IVSYDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKT  78

Query  214  IHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKN  273
              ++ L     RH    +G  +  +  T+       ++  V+  I++     +V+ +S  
Sbjct  79   FREAVLHLSGYRHHGF-YGKSYSMKNVTI-----DDILYRVNRVIQSEVDLLRVQFKSAR  132

Query  274  VKYENFLGSFVDPHTVKL------SHPRKGTKQITTRNVVIAVGSRP-RELTCP-GGEYA  325
            V Y +    F D H V +      +H  K TK++     ++A G+RP      P  G+  
Sbjct  133  VDYISGHARFEDDHQVSIIEADGPAH-EKITKRLRASKFLVACGTRPAHNPNIPIDGKVI  191

Query  326  VSSDDIF-WMKEKEPGKTLVIGASYVALECAGFLKGM-GYEVKVMV-RSILLRSFDQEMA  382
              SD I  W   + P   +V+GA  + +E A  L  + G+ V V+  R  +L   D E+ 
Sbjct  192  FDSDQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEII  251

Query  383  DKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPE  442
              +   M    G +F+     +S+ +  +R +LV    + GK      + +L   GR   
Sbjct  252  STLTHEMR-NHGARFLLGETIESVDK-SSRGVLVGL--KSGKKVHG--DALLYVVGRQAN  305

Query  443  VAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRL  501
               L L+ AG+  N + G + V  + QT   +I+A+GD + AP L   +++ GRL S  +
Sbjct  306  TDGLNLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYM  364

Query  502  YNNSS-------VQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLE  554
            +N           Q+        ++T  E    G +E+    +  + N EI    +  L 
Sbjct  365  WNEDESNDDSIPSQLKTGNFPYGIYTIPEISMVGHTEKQLTSQ--QINYEIGVAKYSELA  422

Query  555  WSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVN  614
                 +   AS    +K++ D    K + G H +G  A E++    +A+ +  T     +
Sbjct  423  ---KGQMSGASADGMLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRD  478

Query  615  TVGIHPMTAESLTI  628
             V  +P  AE+  +
Sbjct  479  AVFNYPTLAEAYRV  492

>CCA16670
Length=520

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 124/495 (25%), Positives = 220/495 (44%), Gaps = 49/495 (10%)

Query  154  IFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKL  213
            I  YDL+VIG G     C+ +AA  G+ V ++D  K S       +GG CV+ G IP K 
Sbjct  27   IISYDLIVIGSGPSASNCALDAAKRGKHVAIID--KKSS------VGGVCVHTGTIPSKT  78

Query  214  IHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKT-INFKYKVKLRSK  272
              ++ L     RH    +G  +  +  T+       ++  V+  I++ ++F  + + +S 
Sbjct  79   FREAVLHLSGYRHHGF-YGKSYSMKHVTI-----DDILYRVNRVIQSEVDF-LRTQFKSA  131

Query  273  NVKYENFLGSFVDPHTVKL------SHPRKGTKQITTRNVVIAVGSRP-RELTCP-GGEY  324
             + Y +    F D H V +      +H  K TK++     ++A G+RP      P  G+ 
Sbjct  132  RIDYISGHARFEDDHQVSIIEADGPAH-EKTTKRLRASKFLVACGTRPAHNPNIPIDGKV  190

Query  325  AVSSDDIF-WMKEKEPGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSFDQEM  381
               SD I  W   + P   +V+GA  + +E A  L  + G+ V V+  R  +L   D E+
Sbjct  191  IFDSDQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEI  250

Query  382  ADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDP  441
               +   M    G +F+   + +S+ +  +R + V    + GK      + +L   GR  
Sbjct  251  ISTLTHEMR-NHGARFLLGEIIESVEK-SSRGVSVGL--KSGKKVHG--DALLYVVGRQA  304

Query  442  EVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQR  500
                L L+ AG+  N + G + V  + QT   +I+A+GD + AP L   +++ GRL S  
Sbjct  305  NTDGLNLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCY  363

Query  501  LYNNSSVQMDYDKVCTTVFT-PIEYGCCGLSEETSKGRYGED------NIEIYHTNFVPL  553
            ++N +  + + D + + + T    YG   + E +  G+  ++      N EI    +  L
Sbjct  364  MWNEN--EANDDSIPSQLTTGNFPYGIYTIPEISMVGKTEKELTSLKMNYEIGVAKYSEL  421

Query  554  EWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMV  613
                  +   AS    +K++ D    K   G H +G  A E++    +A+ +  T     
Sbjct  422  A---KGQMSGASADGMLKILFDPISLKL-YGVHAIGEGATEIIHIGQVAIAMGATLTYFR  477

Query  614  NTVGIHPMTAESLTI  628
            + V  +P  AE+  +
Sbjct  478  DAVFNYPTLAEAYRV  492

>PHALS_12028
Length=579

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 130/515 (25%), Positives = 219/515 (43%), Gaps = 69/515 (13%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G IP K   +
Sbjct  36   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTIPSKTFRE  87

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++L     RH +   G       K   V D  Q V  V+     I    + +L    V+ 
Sbjct  88   AALHLTGYRHKAFYNGQ--GGPSKRFGVEDILQRVKKVESAETDIT---RHQLLRNGVQL  142

Query  277  ENFLGSFV------------DPHTVKLSHPRKGTKQITTR-----NVVIAVGSRP-RELT  318
             N    F+            + +       R  +  I  R       ++ VG+RP R   
Sbjct  143  INGTARFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFLLCVGTRPARRAD  202

Query  319  CP-GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILL  374
             P  GE    SD + W K K  P + +V+GA  + +E A  +  + G +V V+  R  +L
Sbjct  203  IPFDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDARKEIL  262

Query  375  RSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVL  434
               D E+++ +   M  Q+G +F+   V +S+ +    ++ V    E GKT     + +L
Sbjct  263  NMADNEVSEALCFSM-AQTGTRFLTGEVIKSVEKSAMGEVFVHL--ESGKTV--VGDGLL  317

Query  435  NATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQS  493
               GR   V  L L+  G+ + +K G+I V N  QT+  +IYA GD++  P L   +++ 
Sbjct  318  YTVGRQGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQ  376

Query  494  GRLLS-----------QRLYNNSSVQMDYDKVCTTVFTP--IEYGCCGLSEETSKGRYGE  540
            GRL S           Q++ ++  +  D D+V T + +     +G   + E +  G+   
Sbjct  377  GRLASVHMRTSQPLNDQKISDDKKMD-DPDRVRTRMRSGEVFPFGIYTVPEISMVGK---  432

Query  541  DNIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CDKSRDKFVLGFHYLGPNAG  593
             N +      VP E  ++     A          ++K++ C  +    VLG H +G  A 
Sbjct  433  -NEQQLTKEGVPYEVGVARYEELAKGQMLGGVPGFLKIIFCPDTLK--VLGVHAIGEGAT  489

Query  594  EVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            E++    + M    T +   N V  +P  AE+  +
Sbjct  490  EIIHIGQVLMSTDGTLEYFRNAVFNYPTLAEAYRV  524

>PYIR_14132
Length=513

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 126/514 (25%), Positives = 213/514 (41%), Gaps = 67/514 (13%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAVDHAKHGKSVAVIDKRDM--------LGGVCIHTGTVPSKTFRE  62

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++L     RH S   G    N  K   + D  Q V  V+     I    + +L   N++ 
Sbjct  63   ATLHLTAYRHRSFYDGQS--NPTKRFGIEDILQRVKKVEHAETDIT---RHQLLRNNIEL  117

Query  277  ENFLGSFV-------------DPHTVKLSHPRKGTKQITTR-----NVVIAVGSRP-REL  317
             N    F+             D +T      R  +  I  R       +IAVG+RP R  
Sbjct  118  INGTARFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLIAVGTRPARRP  177

Query  318  TCP-GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSIL  373
              P  G+    SD + W   K  P + +V+GA  + +E A  +  + G EV ++  R  +
Sbjct  178  DIPFDGQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEI  237

Query  374  LRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTV  433
            L   D+E+++ +   M  Q+G +F  +   +S+ + +N +++V      GKT     + +
Sbjct  238  LDMADREVSEALCYSMR-QTGARFFVEETIKSVEKADNGEVIVHL--NSGKTL--VGDGL  292

Query  434  LNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQ  492
            L   GR      L L   G++ + K G I V ++ QT   +IYA GD +  P L   +++
Sbjct  293  LYTLGRQGNTEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIGFPALASTSME  351

Query  493  SGRLLSQRLYNN-----------SSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGED  541
             GRL S  +  +            S    Y +          +G   + E +  G+    
Sbjct  352  QGRLASVHMRTSKPTNKKGESETESTDPQYMRTRMRSGEVFPFGIYTVPEISMVGK----  407

Query  542  NIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CDKSRDKFVLGFHYLGPNAGE  594
            N +   +  +P E  ++     A          ++K++ C K+    VLG H +G  A E
Sbjct  408  NEQQLTSQNIPYEVGVARYEELAKGQMLGGVPGFLKIIFCPKTLQ--VLGVHAIGEGATE  465

Query  595  VMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            ++    + M    T +   N V  +P  AE+  +
Sbjct  466  IIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAYRV  499

>H257_01186
Length=496

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 122/499 (24%), Positives = 220/499 (44%), Gaps = 52/499 (10%)

Query  146  STAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVN  205
            ST+V  K   +YDL+VIG G  GL C+ E+A  G+ V ++D  +         +GG CV+
Sbjct  21   STSVSPK---EYDLIVIGSGPSGLQCALESAKMGKSVAIIDKSEE--------IGGVCVH  69

Query  206  VGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKY  265
             G IP K   ++ L      H    +G  +  E  T+       ++  V+  + +     
Sbjct  70   TGTIPSKTFREAVLHLSGFNHH-GFYGKSYSRERITL-----SDILHRVNVVVSSEMDVI  123

Query  266  KVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRN--VVIAVGSRPRE--LTCPG  321
            + +L++ +V+       F + + V + +     + +  R    +IA G+ P    +    
Sbjct  124  RAQLKAAHVQIIPGKARFENANEVSVENGTVHREAMIYRGKKFLIACGTYPAHSPVVPVD  183

Query  322  GEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSFD  378
            GE  + SD I    + E P   +V+GA  + +E A  L  + G  V V+  R  +L   D
Sbjct  184  GEVILDSDGILEASKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCD  243

Query  379  QEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATG  438
             E+   +   M    G +F+     QS++R+  + + V +   K    E     +L   G
Sbjct  244  DEIVSALKMEMR-HKGARFLLGETIQSVTRVA-KGVRVDFASGKSSFAE----ALLYCVG  297

Query  439  RDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLS  498
            R      L L+  G+  N++    + K  QTS  +IYA GD + AP L   +++ GRL +
Sbjct  298  RQANTDALNLEGVGLAKNKRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAA  357

Query  499  QRLYNNS---SVQMDYDKVCTTVFTPIEYGCCGLSEE--TSKGRYGEDNIEIYHTNFVPL  553
              ++++    + Q+D       ++T  E    G +E+  T +GR    N  +    +  L
Sbjct  358  CDMWHHEDQPTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKEGR----NYAVGMAKYSEL  413

Query  554  EWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQ--AMGLAMRLRFTY--  609
               + +  +  +    +K++ D    + VLG H +G  A E++    + +AM  + TY  
Sbjct  414  AKGMMAGGQKGA----LKILFDPD-TQSVLGVHAIGQGATEIIHIGQVAMAMNCKITYFR  468

Query  610  DQMVNTVGIHPMTAESLTI  628
            D + N    +P  AE+  +
Sbjct  469  DAVFN----YPTLAEAYRV  483

>PPTG_00938
Length=550

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 132/558 (24%), Positives = 233/558 (42%), Gaps = 71/558 (13%)

Query  120  LLFFRSGIAVGRPQGMHTSDEVAEISSTAVQEKPIFD----------YDLVVIggglggl  169
            +L  RS  A  RP         A  +    + +P+ D          +DL+VIG G  G 
Sbjct  1    MLLRRSVTAASRPARSLLRAANAFSTEAPAENRPLTDTLRELRASEHFDLIVIGSGPAGQ  60

Query  170  ACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSA  229
             C+ ++A  G+ V ++D            LGG CV+ G +P K   +++L     RH + 
Sbjct  61   KCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTVPSKTFREAALHLTGYRHKAF  112

Query  230  RFGWKFDNEGKTVPVFDWKQLVANVDGYIKTIN----FKYKVKLRSKNVKY----ENFLG  281
              G       K   V D  Q V  V+     I      +  V+L +   ++    +N + 
Sbjct  113  YNGQA--GPSKRFGVEDILQRVRKVENAETDITRHQLLRNGVQLINGTARFLPGSKNMVA  170

Query  282  SFVDPHTVKLSHPRKGT------KQITTRNVVIAVGSRP-RELTCP-GGEYAVSSDDIFW  333
               +      +  ++ +      + +T    ++ VG+RP R    P  GE    SD++ W
Sbjct  171  VLSNESYETATDAKRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDGETIFDSDELLW  230

Query  334  MKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSFDQEMADKIGEYME  390
             K K  P + +++GA  V +E A  +  + G +V V+  R  +L   D+++++ +  Y  
Sbjct  231  GKVKSVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADKQVSEALC-YSM  289

Query  391  VQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDK  450
             Q+G +F+     +S+ +    ++ V    E GKT     + +L   GR   V  L L+ 
Sbjct  290  TQTGTRFLTGETIKSVEKSPKGEVFVHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEA  345

Query  451  AGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQ-  508
             G+   +K GRI V N  QT+  +IYA GD++  P L   +++ GRL S  +  +  +  
Sbjct  346  VGLS-PDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLND  404

Query  509  ---------MDYDKVCTTVFTP--IEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSL  557
                      D D+V T + +     +G   + E +  G+    N +      VP E  +
Sbjct  405  LELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGK----NEQQLTKEQVPYEVGV  460

Query  558  SSETRTASNSC------YIKVV-CDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYD  610
            +     A          ++K++ C  +   F  G H +G  A E++    + M    T +
Sbjct  461  ARYEELARGQMLGGVPGFLKIIFCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTLE  518

Query  611  QMVNTVGIHPMTAESLTI  628
               N V  +P  AE+  +
Sbjct  519  YFRNAVFNYPTLAEAYRV  536

>PYIW_19795
Length=519

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 130/532 (24%), Positives = 223/532 (42%), Gaps = 55/532 (10%)

Query  120  LLFFRSGIAVGRPQGMHTSDEVAEISSTAVQEKPIFDYDLVVIggglgglACSKEAASFG  179
            LL  RS +   +PQ          +SS   Q   +  YDLVVIG G     C+ E+A  G
Sbjct  3    LLTMRSALLRAKPQVFAQQQWRGVVSSIKPQ---VASYDLVVIGSGPSATQCAIESAKKG  59

Query  180  QKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEG  239
            ++V V+D            +GG CV+ G IP K   ++ L     RH    +G  +    
Sbjct  60   KRVAVVD--------KKTFVGGVCVHTGTIPSKTFREAVLHLSGYRHH-GFYGKSYSM--  108

Query  240  KTVPVFDWKQLVANV-DGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGT  298
            KTV + D    V  V +  +  I    K +L++  V+Y   L  F   H + +       
Sbjct  109  KTVTIDDILYRVKRVVNSEVDVI----KAQLKAARVEYIPGLARFEGDHEISIVRDAADA  164

Query  299  K-----------QITTRNVVIAVGSRPRE--LTCPGGEYAVSSDDIFWMKEKE-PGKTLV  344
            +           ++     +IA G+RP    L    G+    SD I     +E P   +V
Sbjct  165  EASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDGKVIFDSDQILSGDIRELPRSLIV  224

Query  345  IGASYVALECAGFLKGM-GYEVKVM-VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTV  402
            +GA  + +E A  L  + G+ V V+  R  +L   D E+   +   M  + G +F+   +
Sbjct  225  VGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDNEIISNLTYEMRSK-GARFL---L  280

Query  403  PQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRI  462
             ++I ++E  +  V      GKT     + +L   GR      L L+   +  N +    
Sbjct  281  GETIKQVEKTEDGVTVHFNSGKTATA--DALLYTVGRQASTDGLNLEAVNLARNPRGLLT  338

Query  463  MVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNS----SVQMDYDKVCTTV  518
            +  + QT+ S+IYA GD + AP L   +++ GRL +  +++      + Q++       +
Sbjct  339  VNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAACHMWDQEEQLVTSQLENGNYPYGI  398

Query  519  FTPIEYGCCGLSEE--TSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDK  576
            +T  E    G +E+  T +G     N EI    +  L      +   ++    +K++ D 
Sbjct  399  YTIPEISMVGKTEQQLTKEGA----NYEIGIAKYSELA---KGQMSGSTAGGMLKILFDP  451

Query  577  SRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            +  K  LG H +G  A E++    +AM +  +     + V  +P  AE+  +
Sbjct  452  TTLKL-LGVHAIGEGATEIIHIGQVAMAMGCSVTYFRDAVFNYPTLAEAYRV  502

>PYIW_24688
Length=259

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/262 (30%), Positives = 129/262 (49%), Gaps = 27/262 (10%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD + IGGG GG+A ++ AA+FG KV V++  +    G A GLGGTCV+ GC+PKK++  
Sbjct  7    YDYISIGGGSGGMASARRAATFGAKVLVVE--RGRKYGGA-GLGGTCVHYGCVPKKIMFN  63

Query  217  SSLIGEIIRHDSARFGWKFDNEGK-TVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
            ++   E +   +A +    +   K     FDW  +    D YI  +N  Y+  L +  V 
Sbjct  64   AATHVEHLNR-AADYSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYERNLGNAQVD  122

Query  276  YENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMK  335
                +   V  + V++          T +++++AVG +P               D F+  
Sbjct  123  LVEGVAKLVAKNQVEVDGV-----VYTGKHILVAVGGKP---------------DGFFKL  162

Query  336  EKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVR-SILLRSFDQEMADKIGEYMEVQSG  394
            E +P K  V+GA Y+A+E AG    +  +  +  R   +LR+FD  + D I E  E ++G
Sbjct  163  EAQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE-KAG  221

Query  395  IKFIRKTVPQSISRLENRQLLV  416
            I F+R +  + I +  +  L +
Sbjct  222  INFVRNSRIERIEKQADGSLTI  243

>PHYCA_504445
Length=548

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 128/514 (25%), Positives = 220/514 (43%), Gaps = 67/514 (13%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DL+VIG G  G  C+ ++A  G+ V ++D            +GG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKSGKSVAIIDKRDM--------MGGVCVHTGTVPSKTFRE  97

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++L     RH +  F        K   V D  Q V  V+     I    + +L    V+ 
Sbjct  98   AALHLTGYRHKA--FYNGHGGPSKRFGVEDILQRVRKVEDAETDIT---RHQLMRNGVQL  152

Query  277  ENFLGSFV--DPHTVK-LSHPRKGT--------------KQITTRNVVIAVGSRP-RELT  318
             N    F+  + H V  LS+    T              + +T    ++ VG+RP R   
Sbjct  153  INGTARFLPGNNHMVAVLSNESYETATDAQRHSSADICKRVLTADKFLVCVGTRPARRPD  212

Query  319  CP-GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILL  374
             P  GE    SD + W K K  P + +++GA  V +E A  +  + G +V V+  R  +L
Sbjct  213  IPFDGETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEIL  272

Query  375  RSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVL  434
               D+E+++ +  Y   Q+G +F+     +S+ +    ++ V    E GKT     + +L
Sbjct  273  NMADKEVSEALC-YSMAQTGTRFLTGETIKSVEKTAKGEVFVHL--ESGKTV--VGDGLL  327

Query  435  NATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQS  493
               GR   V  L L+  G++  +K GRI V N  QT+  +IYA GD++  P L   +++ 
Sbjct  328  YTVGRQGNVEGLNLEAVGLE-PDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQ  386

Query  494  GRLLSQRLYNNSSVQM----------DYDKVCTTVFTP--IEYGCCGLSEETSKGRYGED  541
            GRL S  +  + ++            D D+V T + +     +G   + E +  G+    
Sbjct  387  GRLASVHMRTSKTLNTKELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGK----  442

Query  542  NIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CDKSRDKFVLGFHYLGPNAGE  594
            N +      VP E   +     A          ++K++ C ++    +LG H +G  A E
Sbjct  443  NEQQLTKEQVPYEVGKARYEELARGQMLGGVPGFLKIIFCPETLK--ILGVHAIGEGATE  500

Query  595  VMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            ++    + M      +   N V  +P  AE+  +
Sbjct  501  IIHIGQVVMSTGGDLEYFRNAVFNYPTLAEAYRV  534

>PHYRA_47253
Length=481

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 123/499 (25%), Positives = 212/499 (42%), Gaps = 56/499 (11%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            + L     RH    +G  +    KTV + D   ++  V   + +     + +L++  V  
Sbjct  53   AVLHLSGYRH-HGFYGKSYSM--KTVTIED---ILYRVQRVVSSEEDVVRAQLKAARVDV  106

Query  277  ENFLGSFVDPHTVKL-----SHPRKGTKQITTRN---------VVIAVGSRPRE--LTCP  320
                  F   H + +        +KG    +T +          +IA G+RP    L   
Sbjct  107  VPGFARFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVPI  166

Query  321  GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSF  377
             G+  + SD I      + P   +V+GA  + +E A  +  + G+ V V+  R  +L   
Sbjct  167  DGQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFC  226

Query  378  DQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNAT  437
            D+E+   +   M+  +G +F+   + ++I ++E     VK   + GK    + + +L   
Sbjct  227  DREIISNLTYEMQ-SNGARFL---LGETIKKVETADNRVKVFFDSGKVL--SADALLYTV  280

Query  438  GRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSNIYAIGDVVDAPELTPVAIQSGRL  496
            GR      L L+  G+  N + G I V KN QT   +IYA GD + AP L   +++ GRL
Sbjct  281  GRQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRL  339

Query  497  LSQRLYNNS-----SVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGED--NIEIYHTN  549
             S  ++        + Q++       ++T  E    G +E+    +  +D  N EI    
Sbjct  340  ASCHMWKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTEQ----QLTKDCVNYEIGVAK  395

Query  550  FVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTY  609
            +  L      +   A     +K++ D    K V G H +G  A E++    +AM +  + 
Sbjct  396  YSELA---KGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSL  451

Query  610  DQMVNTVGIHPMTAESLTI  628
                + V  +P  AE+  +
Sbjct  452  TYFRDAVFNYPTLAEAYRV  470

>PITG_18935
Length=480

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 127/485 (26%), Positives = 211/485 (44%), Gaps = 61/485 (13%)

Query  156  DYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIH  215
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  29   DYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALL  80

Query  216  QSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVK  275
             S+ +    +HD   +G          P     Q++ + +  +KT+    ++  +   V 
Sbjct  81   HSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKSKEKAVKTLTGGIELLFKKNKVT  135

Query  276  YENFLGSFVDPHTVKLS-HPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334
            Y    G       + ++ +  KG + +  +N++IA GS    L        V  D+    
Sbjct  136  YIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLP------PVPVDN----  185

Query  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSF--------DQEMADKIG  386
                 GK +    S  ALE    LK +   + V+   + +  F        D+E   +  
Sbjct  186  ---AAGKII---DSTGALE----LKRVPEHLVVVGAGVTVVEFLDAACPGSDKEAVKEFT  235

Query  387  EYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAF---NTVLNATGRDPEV  443
            + ++ Q G+ F   T    ++  E    +VK   E  K  + +    +TVL ATGR    
Sbjct  236  KLLKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFT  291

Query  444  AHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLY  502
            + LGL++ G++  +K GRI V +  +T    I+AIGDV+    L   A + G    + + 
Sbjct  292  SGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIA  350

Query  503  NNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETR  562
                  ++Y  +   ++T  E+   G +EE  K     + IE Y+    P+    +S  R
Sbjct  351  GKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKA----EGIE-YNVGKFPMMA--NSRAR  402

Query  563  T-ASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPM  621
            T A     +KV+ DK  DK  LG H +  NAGE++    + +      + +  T   HP 
Sbjct  403  TIAEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPT  461

Query  622  TAESL  626
             +E+ 
Sbjct  462  LSEAF  466

>PYU1_G011605
Length=524

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 126/506 (25%), Positives = 215/506 (42%), Gaps = 62/506 (12%)

Query  152  KP-IFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIP  210
            KP + DYDLVVIG G     C+ E+A  G++V ++D            +GG CV+ G IP
Sbjct  35   KPQVADYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIP  86

Query  211  KKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANV-DGYIKTINFKYKVKL  269
             K   ++ L     RH    +G  +    KTV + D    V  V +  +  I    K +L
Sbjct  87   SKTFREAVLHLSGYRHH-GFYGKSYSM--KTVTIDDILYRVKRVVNSEVDVI----KAQL  139

Query  270  RSKNVKYENFLGSFVDPHTVKL-SHPRKGTKQ-----------ITTRNVVIAVGSRP-RE  316
            ++  V+Y      F + H + +   P  G  Q           +     +IA G+RP   
Sbjct  140  KAARVEYIPGFARFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHN  199

Query  317  LTCP-GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSI  372
               P  G+    SD I     ++ P   +V+GA  + +E A  L  + G+ V V+  R  
Sbjct  200  PNVPIDGKVIFDSDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPE  259

Query  373  LLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNT  432
            +L   D E+   +  Y     G +F+   + ++I+R+E     V      GK    + + 
Sbjct  260  ILSFCDNEIISNL-TYEMRSKGARFL---LGETINRVEKTGNGVTVYLNSGKVT--SADA  313

Query  433  VLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQ  492
            +L   GR      L L+   +  N +    + K+ QT   +IYA+GD + AP L   +++
Sbjct  314  MLYTVGRQASTDGLNLEAVNLSRNPRGLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSME  373

Query  493  SGRLLSQRLYNNS----SVQMDYDKVCTTVFTPIEYGCCGLSEE--TSKGRYGEDNIEIY  546
             GRL +  +++      + Q++       ++T  E    G +E+  T +G     N EI 
Sbjct  374  QGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGV----NFEIG  429

Query  547  HTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQ--AMGLAMR  604
               +  L      +   ++    +K++ D +  K   G H +G  A E++    + +AM 
Sbjct  430  IAKYSELA---KGQMSGSTAGGMLKILFDPTTLKL-FGVHAIGEGATEIIHIGQVAIAMG  485

Query  605  LRFTY--DQMVNTVGIHPMTAESLTI  628
               TY  D + N    +P  AE+  +
Sbjct  486  CSVTYFRDAVFN----YPTLAEAYRV  507

>PPTG_09121
Length=520

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 119/500 (24%), Positives = 207/500 (41%), Gaps = 55/500 (11%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  32   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  83

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            + L     RH    +G  +    KTV + D   ++  V   + +     + +L++  V  
Sbjct  84   AVLHLSGYRH-HGFYGKSYSM--KTVTIED---ILYRVQRVVSSEEDVVRAQLKAARVDV  137

Query  277  ENFLGSFVDPHTVKLSHPRKGTKQ-----------------ITTRNVVIAVGSRPRE--L  317
                  F + H + +       K+                 I     +IA G+RP    L
Sbjct  138  VPGFARFENEHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNPL  197

Query  318  TCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILL  374
                G+  + SD I      + P   +V+GA  + +E A  +  + G+ V V+  R  +L
Sbjct  198  IPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDIL  257

Query  375  RSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVL  434
               D E+   +   M+  +G +F+   + +++ ++E     VK     GK    + + +L
Sbjct  258  SFCDSEIISNLTYEMQ-SNGARFL---LGETVKKVETTDKRVKVFFNSGKVL--SADALL  311

Query  435  NATGRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSNIYAIGDVVDAPELTPVAIQS  493
               GR      L L+  G+  N + G I V KN QT   +IYA GD + AP L   +++ 
Sbjct  312  YTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQ  370

Query  494  GRLLSQRLYN-----NSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHT  548
            GRL S  ++N      ++ Q++       ++T  E    G +E+    +  +D +  Y  
Sbjct  371  GRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQTEQ----QLTKDCVN-YEI  425

Query  549  NFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFT  608
                       +   A     +K++ D    K V G H +G  A E++    +AM +  +
Sbjct  426  GIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCS  484

Query  609  YDQMVNTVGIHPMTAESLTI  628
                 + V  +P  AE+  +
Sbjct  485  LTYFRDAVFNYPTLAEAYRV  504

>H310_00561
Length=497

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 126/527 (24%), Positives = 223/527 (42%), Gaps = 63/527 (12%)

Query  119  LLLFFRSGIAVGRPQGMHTSDEVAEISSTAVQEKPIFDYDLVVIggglgglACSKEAASF  178
            LL   R  ++  +P+  H S  V +            +YDL+VIG G  GL C+ E+A  
Sbjct  4    LLHPLRRAVSHPKPRRAHLSTMVPK------------EYDLIVIGSGPSGLQCALESAKM  51

Query  179  GQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNE  238
            G+ V ++D         +  +GG CV+ G IP K   ++ L      H    +G  +  E
Sbjct  52   GKSVAIVD--------KSEEIGGVCVHTGTIPSKTFREAVLHLSGFNHHGF-YGKSYSRE  102

Query  239  GKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGT  298
              T+     + ++  V+  + +     + +L++ +V+       F + + V ++    G+
Sbjct  103  RITL-----RDILHRVNVVVSSEMDVIRAQLKAAHVQIIPGKARFENANEVSVATEPVGS  157

Query  299  KQITTRN--VVIAVGSRPRE--LTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALE  353
            +    R    +IA G+ P    +    GE  + SD I    + E P   +V+GA  + +E
Sbjct  158  EATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSDGILDASKGELPRSWIVVGAGVIGME  217

Query  354  CAGFLKGM-GYEVKVM-VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLEN  411
             A  L  + G  V V+  R  +L   D E+   +   M    G +F+     QS+ R+  
Sbjct  218  YASMLNVLPGVSVTVVDGRPDILTFCDDEIVSALKMEMR-HKGARFLLGETIQSVKRVR-  275

Query  412  RQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTS  470
            + + V +   K    E     +L   GR      L L+  G+  N K G + V  + QT+
Sbjct  276  KGVRVDFASGKSSFAE----ALLYCVGRQANTDTLNLEGVGLSKN-KRGLLSVNEQYQTT  330

Query  471  TSNIYAIGDVVDAPELTPVAIQSGRLLSQRLY---NNSSVQMDYDKVCTTVFTPIEYGCC  527
              +I+A GD + AP L   +++ GRL +  ++   +  + Q+D       ++T  E    
Sbjct  331  QPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRHEDQPTSQLDSGNYPYGIYTIPEISMV  390

Query  528  GLSEE--TSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGF  585
            G +E+  T +GR     +  Y          L+           +K++ D      VLG 
Sbjct  391  GKTEQQLTKEGRNYAVGVAKYS--------ELAKGMMAGGQKGALKLLFDPDSHS-VLGV  441

Query  586  HYLGPNAGEVMQ--AMGLAMRLRFTY--DQMVNTVGIHPMTAESLTI  628
            H +G  A E++    + +AM  + TY  D + N    +P  AE+  +
Sbjct  442  HAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFN----YPTLAEAYRV  484

>HYAP_04149
Length=564

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 130/520 (25%), Positives = 219/520 (42%), Gaps = 70/520 (13%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DL+VIG G  G  C+ ++A  G  V ++D            LGG CV+ G +P K   +
Sbjct  53   FDLIVIGSGPAGQKCAIDSAKHGYSVAIVDKRDM--------LGGVCVHTGTVPSKTFRE  104

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTIN----FKYKVKLRSK  272
            ++L     RH +   G       K V V D  Q V  V+     I      +  V+L + 
Sbjct  105  AALHLTGYRHRAFYNGQA--GPSKRVGVEDILQRVNKVEKAETDITRHQLMRNGVQLITG  162

Query  273  NVKYENFLGSFV-----DPHTVKLSHPRKGTKQITTR-----NVVIAVGSRP-RELTCP-  320
              ++       +     + +       R  +  I  R     N ++ VG+RP R    P 
Sbjct  163  TARFMPGNSHMIAVLSNESYETATDAKRHSSANICKRVLTADNFLVCVGTRPARRADIPF  222

Query  321  GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSF  377
             GE    SD + W K K  P + +V+GA  V +E A  +  + G +V V+  R  +L   
Sbjct  223  DGETIFDSDQLLWGKVKAVPRRLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKEILEMA  282

Query  378  DQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNAT  437
            D+E+++ +  Y   Q+G +F+   V +S+ +    ++ V    E GKT     + +L   
Sbjct  283  DKEVSEALC-YSMAQTGTRFLVDEVIKSVEKSAKGEVGVHL--ESGKTV--VGDGLLYTV  337

Query  438  GRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYA---------IGDVVDAPELT  487
            GR   V  L L+  G+   +K GRI+V N  QT+  ++YA          GD++  P L 
Sbjct  338  GRQGNVEGLNLEAVGLA-PDKRGRIIVDNNFQTAVPHMYAQSRLIADQNAGDIIGFPALA  396

Query  488  PVAIQSGRLLSQRLYNNSSVQM----------DYDKVCTTVFTP--IEYGCCGLSEETSK  535
              +++ GRL S  +  + S             D D+V T + +     +G   + E +  
Sbjct  397  STSMEQGRLASVHMRTSKSFYTKEISDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMV  456

Query  536  GRYGEDNIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CDKSRDKFVLGFHYL  588
            G+    N +      VP E  ++     A          ++K++ C K+    +LG H +
Sbjct  457  GK----NEQQLTREQVPYEVGIARYEELAKGQMLGGVPGFLKIIFCPKTLK--LLGVHAI  510

Query  589  GPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            G  A E++    + M    T +   N V  +P  AE+  +
Sbjct  511  GEGATEIIHIGQVVMSTDGTLEYFRNAVFNYPTLAEAYRV  550

>SDRG_14446
Length=495

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 125/500 (25%), Positives = 217/500 (43%), Gaps = 54/500 (11%)

Query  145  SSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCV  204
            ++T++Q K   +YDLVVIG G   + C+ E+   G+ V V+D           G+GG CV
Sbjct  20   TTTSLQLK---EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCV  68

Query  205  NVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFK  264
            + G IP K   +S L     RH    +G  +  +  T+       ++  V+  +      
Sbjct  69   HTGTIPSKTFRESVLHLSGFRHQ-GFYGKSYARDNITL-----NDILGRVNTVVSKEMDV  122

Query  265  YKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRE--LTCPGG  322
             + +L++  V     L  F + + V +        ++  +  ++A G+RP    L    G
Sbjct  123  IQAQLKAARVDLVPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDG  182

Query  323  EYAVSSDDIF-WMKEKEPGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSFDQ  379
            +  + SD I      K P   +V+GA  + +E A  L  + G  V V+  R+ +L   D 
Sbjct  183  KVILDSDQILNHGTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDD  242

Query  380  EMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTC-EEAFNTVLNATG  438
            E+   +   M    G +F+   + +SI  +E+ +  VK     GK    EA    L   G
Sbjct  243  EIVSSLKMEMR-HKGARFL---LGESIKSVEHFKNGVKVEFNSGKAMFAEAL---LYCVG  295

Query  439  RDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLL  497
            R      L L+  G+  N + G I V  + QTS  +IYA GD + AP L   +++ GRL 
Sbjct  296  RQANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLA  354

Query  498  SQRLYNN---SSVQMDYDKVCTTVFTPIEYGCCGLSEE--TSKGRYGEDNIEIYHTNFVP  552
            +  ++++   ++ Q++       ++T  E    G +E+  T +G     N  +    F  
Sbjct  355  ACDMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGA----NYAVGLAKF--  408

Query  553  LEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQ--AMGLAMRLRFTY-  609
                L+    +      +K++ D    +  LG H +G  A E++    + +AM  + TY 
Sbjct  409  --SELAKGQMSGDIEGILKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKLTYF  465

Query  610  -DQMVNTVGIHPMTAESLTI  628
             D + N    +P  AE   +
Sbjct  466  RDAVFN----YPTLAEGYRV  481

>PYIW_20257
Length=503

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 123/503 (24%), Positives = 205/503 (41%), Gaps = 94/503 (19%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDHAKHGKTVAVIDKRDM--------LGGVCIHTGTVPSKTFRE  101

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++L     RH S         EG++ P                           +K    
Sbjct  102  ATLHLTAYRHRSF-------YEGQSTP---------------------------AKRFGI  127

Query  277  ENFLGSFVDPHTVKLSHPRKGTKQITTRN----VVIAVGSRP-RELTCP-GGEYAVSSDD  330
            E+ L        VK  H R G +    R      +IAVG+RP R    P  GE    SD 
Sbjct  128  EDIL------QRVKKLHDRHGRQTPLERRHLQAFLIAVGTRPARRPDIPFDGETIFDSDQ  181

Query  331  IFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSFDQEMADKIGE  387
            + W   K  P + +V+GA  + +E A  +  + G EV ++  R  +L   D+E+++ +  
Sbjct  182  LLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREILDMADREVSEALCY  241

Query  388  YMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLG  447
             M  Q+G +F  +   +S+ + +N +++V      GKT     + +L   GR      L 
Sbjct  242  SMR-QTGARFFVEETIKSVEKADNGEVIVHL--NSGKTL--VGDGLLYTLGRQGNTEGLN  296

Query  448  LDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSS  506
            L+  G+K + K G I V ++ QT+  +IYA GD +  P L   +++ GRL S  +     
Sbjct  297  LEAIGLKAD-KRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRTAKP  355

Query  507  VQMDYDKVCTT--------------VFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVP  552
                 D    +              VF    +G   + E +  G+    N +   +  +P
Sbjct  356  TNKKGDSETESTDPAFMRTRMRSGEVFP---FGIYTVPEISMVGK----NEQQLTSQCIP  408

Query  553  LEWSLSSETRTASNSC------YIKVV-CDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRL  605
             E  ++     A          ++K++ C  +    VLG H +G  A E++    + M  
Sbjct  409  YEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLQ--VLGVHAIGEGATEIIHIGQVVMST  466

Query  606  RFTYDQMVNTVGIHPMTAESLTI  628
              T +   N V  +P  AE+  +
Sbjct  467  GGTIEYFRNAVFNYPTLAEAYRV  489

>PYU1_G005699
Length=550

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 123/509 (24%), Positives = 211/509 (41%), Gaps = 60/509 (12%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DL+VIG G  G  C+ ++A  G+ V ++D             GG CV+ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDMH--------GGVCVHTGTVPSKTFRE  101

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            ++L     RH S      +D +      F  + ++  V           + +L    V+ 
Sbjct  102  ATLHLTAYRHRSF-----YDGQSSPTKRFGIEDILQRVKKVEHAETDITRHQLLRNGVEL  156

Query  277  ENFLGSFV-------------DPHTVKLSHPRKGTKQITTR-----NVVIAVGSRP-REL  317
             N    F+             D +T      R  +  I  R       +IAVG+RP R  
Sbjct  157  INGTARFLPDANKNMIAVLSNDSYTTATDAKRHASADICKRVLTADKFLIAVGTRPARRP  216

Query  318  TCP-GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSIL  373
              P  G+    SD + W   K  P + +V+GA  + +E A  +  + G EV ++  R  +
Sbjct  217  DIPFDGQAVFDSDQLLWGGVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEI  276

Query  374  LRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTV  433
            L   D+E+++ +   M  Q+G +F  +   +S+ ++ N +++V      GKT     + +
Sbjct  277  LDMADREVSEALCYSMR-QTGARFFVEETIKSVEKV-NGEVIVHL--NSGKTL--VGDGL  330

Query  434  LNATGRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSNIYAIGDVVDAPELTPVAIQ  492
            L   GR      L L   G++ + K G I V +N QT+  +IYA GD +  P L   +++
Sbjct  331  LYTLGRQGNTDGLNLPAVGLEAD-KRGLIQVDENFQTAVPHIYAAGDCIGFPALASTSME  389

Query  493  SGRLLSQRLYNNSSVQMDYDKVCTT---VFTPIEYGCC---GLSEETSKGRYGEDNIEIY  546
             GRL S  +          D   T    + T +  G     G+         G++  ++ 
Sbjct  390  QGRLASVHMRTEKPTNKTGDSESTDPQFMRTRMRSGDVFPFGIYTVPEISMVGKNEQQLT  449

Query  547  HTNFVPLEWSLSSETRTASNSC------YIKVV-CDKSRDKFVLGFHYLGPNAGEVMQAM  599
              N VP E  L+     A          ++K++ C K+    +LG H +G  A E++   
Sbjct  450  KEN-VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPKTLQ--LLGVHAIGEGATEIIHIG  506

Query  600  GLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
             + M    T +   N V  +P  AE+  +
Sbjct  507  QVVMSTGGTIEYFRNAVFNYPTLAEAYRV  535

>SDRG_05060
Length=559

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 128/512 (25%), Positives = 211/512 (41%), Gaps = 61/512 (12%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K   +
Sbjct  50   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  101

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            + L     RH            GK + + D    V  V+     +    + +L    +  
Sbjct  102  AVLHLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLT---RNQLLRNGIYL  158

Query  277  ENFLGSFV-------------DPHTVKLSHPRKGTKQITTR-----NVVIAVGSRPRELT  318
             N    F+             D +T      R     I  R       +I+VG+RP    
Sbjct  159  INGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPAR--  216

Query  319  CPG----GEYAVSSDDIFWMK-EKEPGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRS  371
             P     GE    SD + W      P + +V+GA  + +E A  +  + G +V V+  R 
Sbjct  217  HPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRK  276

Query  372  ILLRSFDQEMADKIGEYMEVQSGIKFI-RKTVPQSISRLENRQLLVKWVDEKGKTCEEAF  430
             +L   D+E++D +   M  Q G +F+  +T+     RL+ ++++V    + GK      
Sbjct  277  EILEMADKEVSDALCYSMR-QRGTRFLTEETIDFVEKRLDEKEVVVHL--KSGKII--VG  331

Query  431  NTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPV  489
            + +L   GR   V  L L+  G++ N + G + V N  QTS  +IYA GD +  P L  V
Sbjct  332  DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYPALASV  390

Query  490  AIQSGRLLSQRLYNNSSV---QMDYDKVCTTVF-TPIEYGCC---GLSEETSKGRYGEDN  542
            +++ GRL S  +  +      + D D   T+ F T +  G     G+         G+  
Sbjct  391  SMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISMVGKSE  450

Query  543  IEIYHTNFVPLEWSLSSETRTASNSC------YIKVVCDKSRDKFVLGFHYLGPNAGEVM  596
             ++   N VP E  ++     A          ++K++   S  K +LG H +G  A E++
Sbjct  451  QQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK-LLGVHAIGEGATEII  508

Query  597  QAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
                + M    T +   N V  +P  AE+  +
Sbjct  509  HIGQVVMSTGGTLEYFRNAVFNYPTLAEAYRV  540

>SPRG_12054
Length=558

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 128/512 (25%), Positives = 210/512 (41%), Gaps = 61/512 (12%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K   +
Sbjct  49   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  100

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            + L     RH            GK + + D    V  V+     +    + +L    +  
Sbjct  101  AVLHLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLT---RNQLLRNGIYL  157

Query  277  ENFLGSFV-------------DPHTVKLSHPRKGTKQITTR-----NVVIAVGSRPRELT  318
             N    F+             D +T      R     I  R       +I+VG+RP    
Sbjct  158  INGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPAR--  215

Query  319  CPG----GEYAVSSDDIFWMK-EKEPGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRS  371
             P     GE    SD + W      P + +V+GA  + +E A  +  + G +V V+  R 
Sbjct  216  HPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRK  275

Query  372  ILLRSFDQEMADKIGEYMEVQSGIKFI-RKTVPQSISRLENRQLLVKWVDEKGKTCEEAF  430
             +L   D+E++D +   M  Q G +F+  +T+     RL+ ++++V    + GK      
Sbjct  276  EILEMADKEVSDALCYSMR-QRGTRFLTEETIDFVEKRLDEKEVVVHL--KSGKII--VG  330

Query  431  NTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPV  489
            + +L   GR   V  L L+  G++ N + G + V N  QTS  +IYA GD +  P L  V
Sbjct  331  DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYPALASV  389

Query  490  AIQSGRLLSQRLYNNSSV---QMDYDKVCTTVF-TPIEYGCC---GLSEETSKGRYGEDN  542
            +++ GRL S  +  +      + D D   T+ F T +  G     G+         G+  
Sbjct  390  SMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISMVGKSE  449

Query  543  IEIYHTNFVPLEWSLSSETRTASNSC------YIKVVCDKSRDKFVLGFHYLGPNAGEVM  596
             ++   N VP E  ++     A          ++K++   S  K  LG H +G  A E++
Sbjct  450  QQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLKL-LGVHAIGEGATEII  507

Query  597  QAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
                + M    T +   N V  +P  AE+  +
Sbjct  508  HIGQVVMSTGGTLEYFRNAVFNYPTLAEAYRV  539

>PPTG_13000
Length=387

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 92/342 (27%), Positives = 154/342 (45%), Gaps = 27/342 (8%)

Query  296  KGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYV  350
            KG + +  +N++IA GS      P  +    G+  + S     +K + P   +V+GA  +
Sbjct  48   KGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDSTGALELK-RVPEHLVVVGAGVI  105

Query  351  ALECAGFLKGMGYEVKVM-VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRL  409
             LE     K +G +V V+          D+E   +  + ++ Q G+ F   T    ++  
Sbjct  106  GLELGSVYKRLGAKVTVVEFLDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KVTSS  161

Query  410  ENRQLLVKWVDEKGKTCEEAF---NTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKN  466
            E    +VK   E  K  + +    +TVL ATGR    A LGL++ G++  +K GRI V +
Sbjct  162  EVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIEVDD  220

Query  467  E-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYG  525
              +T    I+AIGDV+    L   A + G    + +       ++Y  V   ++T  E+ 
Sbjct  221  AFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG-HVNYGAVPGVIYTFPEFA  279

Query  526  CCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS-CYIKVVCDKSRDKFVLG  584
              G +EE  K     + IE Y+    P+    +S  RT + S   +KV+ DK  DK  LG
Sbjct  280  SVGKTEEELKA----EGIE-YNVGKFPM--MANSRARTVAESDGLVKVLADKKTDKL-LG  331

Query  585  FHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
             H +  NAGE++    + +      + +  T   HP  +E+ 
Sbjct  332  VHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  373

>PHYSO_489418
Length=471

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 118/472 (25%), Positives = 203/472 (43%), Gaps = 59/472 (13%)

Query  199  LGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYI  258
            +GG CV+ G +P K   +++L     RH +   G       K   V D  Q V  V+   
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQA--GPSKRFGVEDILQRVKKVEDAE  59

Query  259  KTINFKYKVKLRSKNVKYENFLGSFV--DPHTVKL---------SHPRKGT------KQI  301
              I    + +L    V+  N    F+  + H V +         +  ++ T      + +
Sbjct  60   TDIT---RHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAKRHTSADICKRVL  116

Query  302  TTRNVVIAVGSRP-RELTCP-GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFL  358
            T    ++ VG+RP R    P  GE    SD + W K K  P + +V+GA  V +E A  +
Sbjct  117  TADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMM  176

Query  359  KGM-GYEVKVM-VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLV  416
              + G +V V+  R  +L   D+E+++ +  Y   Q+G +F+     +S+ +    ++ V
Sbjct  177  TIIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLVGETIKSVEKTPKGEVFV  235

Query  417  KWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIY  475
                E GKT     + +L   GR   V  L L+  G+ + +K GRI V N  QT+  +IY
Sbjct  236  HL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGL-VPDKRGRIKVDNNFQTAVPHIY  290

Query  476  AIGDVVDAPELTPVAIQSGRLLSQRL-----YNNSSVQMDY-----DKVCTTVFTP--IE  523
            A GD++  P L   +++ GRL S  +      NN  +  D      D+V T + +     
Sbjct  291  AAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSGEVFP  350

Query  524  YGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CDK  576
            +G   + E +  G+    N +      VP E  ++     A          ++K++ C +
Sbjct  351  FGIYTVPEISMVGK----NEQQLTKEQVPYEVGMARYEELARGQMLGGLPGFLKIIFCPE  406

Query  577  SRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            +    +LG H +G  A E++    + M    T +   N V  +P  AE+  +
Sbjct  407  TLK--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAYRV  456

>PHYCA_555180
Length=521

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 123/515 (24%), Positives = 214/515 (42%), Gaps = 61/515 (12%)

Query  146  STAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVN  205
            S+A  +  +  YDLVVIG G     C+ E+A  G++V ++D            LGG CV+
Sbjct  20   SSATLKHQVAAYDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVH  71

Query  206  VGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKY  265
             G IP K   ++ L     RH    +G  +    KTV + D   ++  V   + +     
Sbjct  72   TGTIPSKTFREAVLHLSGYRH-HGFYGKSYSM--KTVTIED---ILYRVQRVVSSEEDVV  125

Query  266  KVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQ--------------------ITTRN  305
            + +L++  V        F + H + +       K+                    +    
Sbjct  126  RAQLKAARVDVIPGFARFENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADK  185

Query  306  VVIAVGSRPRE--LTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-  361
             +IA G+RP    L    G+  + SD I      + P   +V+GA  + +E A  +  + 
Sbjct  186  FLIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVP  245

Query  362  GYEVKVM-VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVD  420
            G+ V V+  R  +L   D+E+   +   M+  +G +F+   + +++ ++E     VK   
Sbjct  246  GHSVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVEVTDR-VKVFF  300

Query  421  EKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSNIYAIGD  479
            + GK      + +L   GR      L L+  G+  N + G I V KN QT   +IYA GD
Sbjct  301  DSGKVLSA--DALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGD  357

Query  480  VVDAPELTPVAIQSGRLLSQRLYNNS-----SVQMDYDKVCTTVFTPIEYGCCGLSEET-  533
             + AP L   +++ GRL S  ++N       + Q++       ++T  E    G +E+  
Sbjct  358  CIGAPALASTSMEQGRLASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQL  417

Query  534  SKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAG  593
            +K      N EI    +  L      +   A     +K++ D    K V G H +G  A 
Sbjct  418  TKACI---NYEIGVAKYSELA---KGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGAT  470

Query  594  EVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            E++    +AM +  +     + V  +P  AE+  +
Sbjct  471  EIIHIGQVAMAMDCSLTYFRDAVFNYPTLAEAYRV  505

>PHALS_10055
Length=516

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 121/506 (24%), Positives = 210/506 (42%), Gaps = 60/506 (12%)

Query  152  KP-IFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIP  210
            KP + +YDL+VIG G     C+ E+A  G++V ++D            LGG CV+ G IP
Sbjct  26   KPQVANYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIP  77

Query  211  KKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLR  270
             K   ++ L     RH    +G  +    KTV + D   ++  V   + +     + +L+
Sbjct  78   SKTFREAVLHLSGYRHH-GFYGKSYSM--KTVTIED---ILYRVQRVVSSEEDVVRAQLK  131

Query  271  SKNVKYENFLGSFVDPHTVKLSHP--RKGTKQITTRNV-----------VIAVGSRPRE-  316
            +  V        F + H + +      +  K+I+  +V           +IA G+RP   
Sbjct  132  AARVDVIPGFARFENEHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHN  191

Query  317  -LTCPGGEYAVSSDDIFWMK-EKEPGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSI  372
             L    G+  + SD I        P   +V+GA  + +E A  +  + G+ V V+  R  
Sbjct  192  PLIPIDGKVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPD  251

Query  373  LLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNT  432
            +L   D E+   +   M+  +G +F+   + +++ ++E  +  VK     GK    + + 
Sbjct  252  ILPFCDLEIISNLTYEMQ-SNGARFL---LGETVKKVETTKNQVKVFFNSGKVL--SADA  305

Query  433  VLNATGRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSNIYAIGDVVDAPELTPVAI  491
            +L   GR      L L+  G+  N + G I V KN QT   +IYA GD + AP L   ++
Sbjct  306  LLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSM  364

Query  492  QSGRLLSQRLYN-----NSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIY  546
            + GRL S  ++       ++ Q++       ++T  E    G +E+         N   Y
Sbjct  365  EQGRLASCHMWKPNEELAATSQLESGNYPYGIYTIPEISMVGQTEQQLT-----KNCINY  419

Query  547  HTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQ----AMGLA  602
                         +   A     +K++ D       LG H +G  A E +     AM + 
Sbjct  420  EIGIAKYSELAKGQMMGAMAGGTLKILFDPETLSL-LGVHAIGEGATETIHIGQVAMAMG  478

Query  603  MRLRFTYDQMVNTVGIHPMTAESLTI  628
              L +  D + N    +P  AE+  +
Sbjct  479  CSLTYFRDAVFN----YPTLAEAYRV  500

>H257_07450
Length=567

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 110/407 (27%), Positives = 174/407 (43%), Gaps = 47/407 (12%)

Query  119  LLLFFRSGIAVGRPQGMHTSDEV--AEISSTAVQEKPIFDYDLVVIggglgglACSKEAA  176
            L L  RSG  VG P+  H S EV  ++ S      +    +DLVVIG G  G  C+ ++A
Sbjct  2    LRLVRRSGWRVG-PR--HFSAEVKPSDFSEVLRNLRASEHFDLVVIGSGPAGQKCAIDSA  58

Query  177  SFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFG--WK  234
              G+KV ++D             GG CV+ G IP K   ++ L     RH    +G  + 
Sbjct  59   KHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFREAVLHLTAHRH-KGFYGNAYT  109

Query  235  FDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENFLGSFV----------  284
                GK + + +    V  V+     +    + +L    +   N    F+          
Sbjct  110  ASTTGKRLSLEEILDRVKKVEDAETDLT---RNQLTRNGIILINGTARFLPTEDKKTIAV  166

Query  285  ---DPHTVKLSHPRKGTKQITTR-----NVVIAVGSRP--RELTCPGGEYAVSSDDIFWM  334
               D +T K    R     I  R      V+IAVG+RP  R      G     SD + W 
Sbjct  167  LSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPARRPDLDYDGRLIFDSDQLLWG  226

Query  335  K-EKEPGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSFDQEMADKIGEYMEV  391
              +  P + +V+GA  + +E A  +  + G +V V+  R  +L   D+E++D +  YM  
Sbjct  227  GVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEILDMADKEVSDALCYYMR-  285

Query  392  QSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKA  451
            + G +F+ +     +   +N ++LV      GK      + +L   GR   VA L L+  
Sbjct  286  KRGSRFLTEESIVKVETKDNSEVLVYLT--SGKVI--VGDALLYTQGRQGNVAGLDLEAV  341

Query  452  GVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLS  498
            G+  N++    +  N QT   +IYA GD +  P L   +++ GRL S
Sbjct  342  GLAANKRGVLDVNNNFQTDVPHIYAAGDCIGYPALASTSMEQGRLAS  388

>PYAP_19148
Length=535

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 122/523 (23%), Positives = 209/523 (40%), Gaps = 75/523 (14%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DL+VIG G  G  C+ + A  G+ V ++D             GG CV+ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTVPSKTFRE  62

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            + L     RH S      +D   K    F  + ++  V           + +L    ++ 
Sbjct  63   AILHLTAHRHRSF-----YDGASKPKKRFGIEDILQRVRKVENAETDITRHQLLRNGIEL  117

Query  277  ENFLGSFV-DP---------------------HTVKLSHPRKGTKQ-------ITTRNVV  307
             N    F+ DP                     HT      R G          +T    +
Sbjct  118  INGTARFLPDPSKKMVAVLSNDSYETATDTKRHTSADICKRTGADSSILLISVLTADKFL  177

Query  308  IAVGSRP-RELTCP-GGEYAVSSDDIFWMK-EKEPGKTLVIGASYVALECAGFLKGM-GY  363
            +AVG+RP R    P  G+    SD I W   +  P + +V+GA  + +E A  +  + G 
Sbjct  178  VAVGTRPARRADIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGS  237

Query  364  EVKVM-VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEK  422
            EV V+  R  +L   D+E+A+ + +Y   Q+G +F       ++ +  N +++VK     
Sbjct  238  EVTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVIVKL--NS  294

Query  423  GKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVD  482
            GKT     + +L   GR      L L   G++ +++    +  N +TS  +IYA GD + 
Sbjct  295  GKTI--VGDGLLYTVGRQGNTDGLNLAAVGLEADKRGLLKVDDNFRTSVPHIYAAGDCIG  352

Query  483  APELTPVAIQSGRLLS----------QRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEE  532
             P L   +++ GRL S          ++  +N      Y +          +G   + E 
Sbjct  353  YPALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYTVPEI  412

Query  533  TSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CDKSRDKFVLGF  585
            +  G+  +   ++   N +P E  ++     A          ++K+V C KS    VLG 
Sbjct  413  SMVGKSEQ---QLTREN-IPYEVGVARYEELAKGQMLGGVPGFLKIVFCPKSLQ--VLGV  466

Query  586  HYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            H +G  A E++    + M    T +   N V  +P  AE+  +
Sbjct  467  HAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAYRV  509

>CCI39993
Length=550

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 99/366 (27%), Positives = 159/366 (43%), Gaps = 43/366 (12%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YDL+VIG G  G  C+ ++A  G+ V ++D  +          GG CV+ G +P K   +
Sbjct  45   YDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTVPSKTFRE  96

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            + L   +  H    F     +  K   + D    V  V+     I    + +L   NV+ 
Sbjct  97   AIL--HLTAHRHRNFYTGLSSPKKRFGIEDILTRVRKVENAETDIT---RHQLVRNNVEL  151

Query  277  ENFLGSFV-DPHTVKLSHPRKGTKQ-----------------ITTRNVVIAVGSRP--RE  316
             N    F+ DP    L +     KQ                 +T    +IAVG+RP  R+
Sbjct  152  INGTARFLPDPSKKMLYYQIAHLKQQRMEIAIFELIFVNGKILTADKFLIAVGTRPARRD  211

Query  317  LTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSIL  373
                 G+    SD I W   K  P + +V+GA  + +E A  +  + G +V V+  R  +
Sbjct  212  DIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEI  271

Query  374  LRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTV  433
            L   D+E+ + +  Y   Q+G +F  +   + +  L N+  ++  ++  GKT     + +
Sbjct  272  LEMADREVVEAL-TYAMRQTGSRFYMEETIKCVE-LSNKDEVIIHLNS-GKTI--VGDGL  326

Query  434  LNATGRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSNIYAIGDVVDAPELTPVAIQ  492
            L   GR      L L   G++  +K G I V +N QTS  +IYA GD    P L   +++
Sbjct  327  LYTVGRQGNTEGLDLSAIGLQ-TDKRGLIKVNENFQTSVPHIYAAGDCTGFPALASTSME  385

Query  493  SGRLLS  498
             GRL S
Sbjct  386  QGRLAS  391

>H310_07641
Length=548

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 103/370 (28%), Positives = 164/370 (44%), Gaps = 48/370 (13%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K   +
Sbjct  41   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  92

Query  217  SSLIGEIIRHDSARFG--WKFDNEGKTVPVFDWKQLVANVD-------------GYIKTI  261
            + L     RH    +G  +     GK + + +    V  V+               I  I
Sbjct  93   AVLHLTAHRH-KGFYGNAYTASTTGKRLSLEEILDRVKKVEEAETDLTRNQLTRNGIILI  151

Query  262  NFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTR-----NVVIAVGSRPRE  316
            N   +  L++++ K    L +  D +T K    R     I  R      V+IAVG+RP  
Sbjct  152  NGTARF-LQTEDKKTIAVLSN--DSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPAR  208

Query  317  LTCPGGEY----AVSSDDIFWMK-EKEPGKTLVIGASYVALECAGFLKGM-GYEVKVM-V  369
               P  EY       SD + W   +  P + +V+GA  + +E A  +  + G +V V+  
Sbjct  209  --HPDLEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDG  266

Query  370  RSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEA  429
            R  +L   D+E++D +  YM  Q G +F+ +     +   ++ +++V      GK     
Sbjct  267  RKEILDMADKEVSDALCYYMR-QRGSRFLTEESILKVETKDDSEVVVHLT--SGKVI--M  321

Query  430  FNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTP  488
             + +L   GR   VA L L+  G+  N K G + V N  QT+  +IYA GD +  P L  
Sbjct  322  GDALLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALAS  380

Query  489  VAIQSGRLLS  498
             +++ GRL S
Sbjct  381  TSMEQGRLAS  390

>PHYKE_9807
Length=557

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 125/517 (24%), Positives = 217/517 (42%), Gaps = 74/517 (14%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G        +
Sbjct  56   FDLIVIGSGPAGQKCAIDSAKHGKSVAIVDKRDM--------LGGVCVHTGTT----FRE  103

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            +++     RH +  F        K + V D  Q V  V+     I    + +L+   V+ 
Sbjct  104  AAMHLTGYRHRA--FYNGHGGISKRIGVEDILQRVKKVEAAETDIT---RHQLQRNGVQL  158

Query  277  ENFLGSFV--DPHTVK-LSHPRKGT--------------KQITTRNVVIAVGSRP-RELT  318
             +    F+  D H +  LS+    T              + +T    ++ VG+RP R   
Sbjct  159  ISGTARFLAGDSHMLAVLSNEEYETATDAKRHTEADICKRVLTADKFLVCVGTRPARHPD  218

Query  319  CP-GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILL  374
             P  GE    SD + W K K  P + +++G   V +E A  +  + G +V V+  R  +L
Sbjct  219  IPFDGETIFDSDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMTIIPGTDVTVIDGRKEIL  278

Query  375  RSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVL  434
               D+E+++ +  Y   Q+G +F+     + + +    ++LV+   + GKT     + +L
Sbjct  279  NMADKEVSEALC-YSMAQTGTRFLVGETIKKVEKNSKGEVLVRL--DSGKTV--VGDGLL  333

Query  435  NATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQS  493
               GR   V  L L+  G+   +K GRI V N  QT   +IYA GD++  P L   +++ 
Sbjct  334  YTVGRQGNVEGLHLESVGIH-PDKRGRIKVDNNFQTEVPHIYAAGDIIGFPGLASTSMEQ  392

Query  494  GRLLSQRLYNNSSVQM-------------DYDKVCTTVFTP--IEYGCCGLSEETSKGRY  538
            GRL S  +   S V               D D++ T + +     +G   + E +  G+ 
Sbjct  393  GRLASVHMRTASPVATKPSKELPDDKLMDDPDRMRTRMRSGEVFPFGIYTVPEISMVGK-  451

Query  539  GEDNIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CDKSRDKFVLGFHYLGPN  591
               N +      VP E  ++     A          ++K++ C  +    +LG H +G  
Sbjct  452  ---NEQQLTQEQVPYEVGMARYEELARGQMLGGVPGFLKIIFCPNTLQ--ILGVHAIGEG  506

Query  592  AGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            A E++    + M    T +   N V  +P  AE+  +
Sbjct  507  ATEIIHIGQVVMSTGGTLEYFRNAVMNYPTLAEAYRV  543

>CCA14030
Length=560

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 98/366 (27%), Positives = 160/366 (44%), Gaps = 43/366 (12%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YDL+V+G G  G  C+ ++A  G+ V ++D  +          GG CV+ G +P K   +
Sbjct  55   YDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTVPSKTFRE  106

Query  217  SSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKY  276
            + L   +  H    F     +  K   + D    V  V+     I    + +L   NV+ 
Sbjct  107  AIL--HLTAHRHRNFYTGMSSPKKRFGIEDILTRVRKVENAETDIT---RHQLVRNNVEL  161

Query  277  ENFLGSFV-DPHTVKLS---------------HPRKGTKQ--ITTRNVVIAVGSRP--RE  316
             N    F+ DP    ++               H R    Q  +T    +IAVG+RP  R+
Sbjct  162  INGTARFLPDPSKNMVAVLSNSSYETATDGNRHFRANICQRILTADKFLIAVGTRPARRD  221

Query  317  LTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSIL  373
                 G+    SD I W   K  P + +V+GA  + +E A  +  + G +V V+  R  +
Sbjct  222  DVVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEI  281

Query  374  LRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTV  433
            L   D+E+ + +  Y   Q+G +F  +   + +  L N+  ++  ++  GKT     + +
Sbjct  282  LEMADREVVEAL-TYAMRQTGSRFYMEETIKCVE-LSNKDEVITHLN-SGKTV--VGDGL  336

Query  434  LNATGRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSNIYAIGDVVDAPELTPVAIQ  492
            L   GR      L L   G++  +K G I V +N QTS  +IYA GD    P L   +++
Sbjct  337  LYTVGRQGNTEGLDLSAIGLE-TDKRGLIKVNENFQTSVPHIYAAGDCTGFPALASTSME  395

Query  493  SGRLLS  498
             GRL S
Sbjct  396  QGRLAS  401

>PYVX_23499
Length=519

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 124/532 (23%), Positives = 215/532 (40%), Gaps = 75/532 (14%)

Query  144  ISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTC  203
            +S T  + K    +DL+V+G G  G  C+ ++A  G+ V ++D            LGG C
Sbjct  2    LSETLRELKASEHFDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVC  53

Query  204  VNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINF  263
            V+ G +P K   +++L     RH +  F        + + + D  Q V  V+G    I  
Sbjct  54   VHTGTVPSKTFREATLHLTGYRHRA--FYDSASVSSRRLEIDDILQRVHKVEGAETDIT-  110

Query  264  KYKVKLRSKNVKYENFLGSFVDPH---------TVKLSHPRKGTKQ---------ITTRN  305
              + +L   NV+  +    F+              K   P    +          +T   
Sbjct  111  --RHQLMRNNVELIHGTARFLPDEKRNMVAVLSNAKYDTPTDAKRHTSADICKRVLTADK  168

Query  306  VVIAVGSRP--RELTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-  361
             +I VG+RP  RE     G+    SD + W   K  P + +V+GA  + +E A  +  + 
Sbjct  169  FLICVGTRPARREDIPFDGKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIP  228

Query  362  GYEVKVM-VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVD  420
            G EV V+  R  +L   D+E+++ +   M  Q+G +F  +   + + + EN +++     
Sbjct  229  GTEVTVIDGRKEILDMADKEVSESLCYSMR-QTGTRFYTEESIKKVEKRENGEVVAHL--  285

Query  421  EKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGD  479
              GK      + +L   GR      L L   G++  +K G + V ++ QT   +IYA GD
Sbjct  286  NSGKVI--VGDGLLYTLGRQGNTDGLNLQAVGLE-TDKRGFLNVNDDFQTEVPHIYAAGD  342

Query  480  VVDAPELTPVAIQSGRLLSQRLYNNSSVQM-----------DYDKV-----CTTVFTPIE  523
             +  P L   +++ GRL S  +   S               D +++        VF    
Sbjct  343  CIGYPALASTSMEQGRLASVHMRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFP---  399

Query  524  YGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CDK  576
            +G   + E +  G+    N +      VP E  L+     A          ++K++ C  
Sbjct  400  FGIYTIPEISMVGK----NEQQLTKENVPYEVGLARYEELAKGQMLGGVPGFLKIIFCPD  455

Query  577  SRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            +    VLG H +G  A E++    + M    T +   N V  +P  AE+  +
Sbjct  456  TLK--VLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAYRV  505

>PYAR_16664
Length=577

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 110/440 (25%), Positives = 181/440 (41%), Gaps = 78/440 (18%)

Query  141  VAEISSTAVQEKPIFD----------YDLVVIggglgglACSKEAASFGQKVCVLDYVKP  190
            V+  + +A   KP+ +          +DL+VIG G  G  C+ + A  G+ V ++D    
Sbjct  38   VSPAADSAATRKPLSELLQDLKASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKRDM  97

Query  191  SPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVF---DW  247
                    +GG C++ G +P K   ++ L     RH S      +D E +    F   D 
Sbjct  98   --------VGGVCIHTGTVPSKTFREAILHLTAHRHRSF-----YDGESEPKKRFGIEDV  144

Query  248  KQLVANVDGY-------------IKTINFKYKVK---------LRSKNVKYENFLGSFVD  285
             Q V  V+               I+ IN   +           L    ++  N    F+ 
Sbjct  145  LQRVRKVESAETDITRHQLLRNGIELINGTARFXXXXCDRALILLRNGIELINGTARFLP  204

Query  286  PHTVK----LSHPRKGTKQITTRNV--------------VIAVGSRP--RELTCPGGEYA  325
              ++K    LS+    T   T R+               +IAVG+RP  RE     G+  
Sbjct  205  DPSMKMVAVLSNDSYDTPTDTKRHTSADICKRVLTADKFLIAVGTRPARREDIPFDGKTI  264

Query  326  VSSDDIFWMK-EKEPGKTLVIGASYVALECAGFLKGM-GYEVKVMV-RSILLRSFDQEMA  382
              SD I W   +  P + +V+GA  + +E A  +  + G EV V+  R  +L   D+E+A
Sbjct  265  FDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGSEVTVIDGRKEILDMADKEVA  324

Query  383  DKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPE  442
            + + +Y   QSG +F      +S+ +  N +++VK     GKT     + +L   GR   
Sbjct  325  EAL-KYAMRQSGTRFYTDETIKSVEKAANGEVIVKL--NSGKTI--IGDGLLYTVGRQGS  379

Query  443  VAHLGLDKAGVKLNEKTGRIMVK-NEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRL  501
               L L   G++  +K G + V  N +TS  +IYA GD +  P L   +++ GRL S  +
Sbjct  380  TDGLNLAAVGLE-TDKRGLLQVDDNFRTSVPHIYAAGDCIGYPALASTSMEQGRLASVHM  438

Query  502  YNNSSVQMDYDKVCTTVFTP  521
             +   +    D     +  P
Sbjct  439  RSAKPINKKRDTDANQLSDP  458

>PITG_01778
Length=470

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 109/469 (23%), Positives = 196/469 (42%), Gaps = 53/469 (11%)

Query  199  LGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYI  258
            LGG CV+ G +P K   +++L     RH +   G       +   V D  Q V  V+   
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQA--GPSRRFGVEDILQRVRKVEDAE  59

Query  259  KTIN----FKYKVKLRSKNVKY----ENFLGSFVDPHTVKLSHPRKGT------KQITTR  304
              I      +  V+L +   ++    +N +    +      +  ++ T      + +T  
Sbjct  60   TDITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETATDAKRHTSADICKRVLTAD  119

Query  305  NVVIAVGSRP-RELTCP-GGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM  361
              ++ VG+RP R    P  GE    SD + W   K  P + +++GA  V +E A  +  +
Sbjct  120  KFLVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMMTII  179

Query  362  -GYEVKVM-VRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWV  419
             G +V V+  R  +L   D+++++ +  Y   Q+G +F+     +S+ +    ++     
Sbjct  180  PGTDVTVIDGRQEILNMADKQVSEALC-YSMAQTGTRFLTGETIKSVEKSPKGEVFAHL-  237

Query  420  DEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIG  478
             E GKT     + +L   GR   V  L L+  G+   +K GRI V N  QT+  +IYA G
Sbjct  238  -ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAVPHIYAAG  293

Query  479  DVVDAPELTPVAIQSGRLLSQRLYNNSSVQ----------MDYDKVCTTVFTP--IEYGC  526
            D++  P L   +++ GRL S  +  +  +            D D+V T + +     +G 
Sbjct  294  DIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPFGI  353

Query  527  CGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSC------YIKVV-CDKSRD  579
              + E +  G+    N +      VP E  ++     A          ++K++ C  +  
Sbjct  354  YTVPEISMVGK----NEQQLTKEQVPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTLK  409

Query  580  KFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
             F  G H +G  A E++    + M    T +   N V  +P  AE+  +
Sbjct  410  IF--GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAYRV  456

>PHYKE_2864
Length=486

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 115/512 (22%), Positives = 197/512 (38%), Gaps = 94/512 (18%)

Query  146  STAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVN  205
            ST+++ + +  YDLVVIG G     C+ E+A  G++V ++D            LGG CV+
Sbjct  24   STSIKPQ-VAAYDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTSLGGVCVH  74

Query  206  VGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKY  265
             G IP K   ++ L     RH    +G  +    KTV + D   ++  V   + +     
Sbjct  75   TGTIPSKTFREAVLHLSGYRHH-GFYGKSYSM--KTVTIED---ILYRVQRVVSSETDVV  128

Query  266  KVKLRSKNVKYENFLGSFVDPHTVKL---------------SHPRKGTKQITTRNVVIAV  310
            + +L++  V        F + H + +               S+      ++     +IA 
Sbjct  129  RAQLKAARVDVIPGFARFENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIAC  188

Query  311  GSRPRE--LTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVK  366
            G+RP    L    G+  + SD I      + P   +V+GA  + +E A  +  + G+ V 
Sbjct  189  GTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVT  248

Query  367  VMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTC  426
            V+                                       R +     VK     GK  
Sbjct  249  VV-------------------------------------DGRPDTTDKRVKVFFNSGKVL  271

Query  427  EEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSNIYAIGDVVDAPE  485
              + + +L   GR      L L+  G+  N + G I V KN QT   +IYA GD + AP 
Sbjct  272  --SADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPA  328

Query  486  LTPVAIQSGRLLSQRLYN-----NSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGE  540
            L   +++ GRL S  ++N      ++ Q++       ++T  E    G +E+    +  +
Sbjct  329  LASTSMEQGRLASCHMWNPDEELAATSQLESGNYPYGIYTIPEISMVGQTEQ----QLTK  384

Query  541  DNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQ---  597
            D +  Y             +   A     +K++ D    K V G H +G  A E++    
Sbjct  385  DCVN-YEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQ  442

Query  598  -AMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
             AM +   L +  D + N    +P  AE+  +
Sbjct  443  VAMAMGCSLTYFRDAVFN----YPTLAEAYRV  470

>PHYSO_562795
Length=415

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 84/337 (25%), Positives = 144/337 (43%), Gaps = 32/337 (9%)

Query  307  VIAVGSRPRE--LTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-G  362
            +IA G+RP    L    G+  + SD I      + P   +V+GA  + +E A  +  + G
Sbjct  80   LIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPG  139

Query  363  YEVKVMV-RSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDE  421
            + V V+  R  +L   D+E+   +   M+  +G +F+     + +   ENR   VK   +
Sbjct  140  HSVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFLLGETVKKVETTENR---VKVFFD  195

Query  422  KGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSNIYAIGDV  480
             GK    + + +L   GR      L L+  G+  N + G I V +N QT   +IYA GD 
Sbjct  196  SGKVL--SADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNQNYQTDQPHIYAAGDC  252

Query  481  VDAPELTPVAIQSGRLLSQRLYN-----NSSVQMDYDKVCTTVFTPIEYGCCGLSEETSK  535
            + AP L   +++ GRL S  ++N       + Q+D       ++T  E    G +E+   
Sbjct  253  IGAPALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYGIYTIPEISMVGQTEQ---  309

Query  536  GRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEV  595
             +  +D +  Y             +   A     +K++ D    K   G H +G  A E+
Sbjct  310  -QLTKDCVN-YEVGIAKYSELAKGQMMGAMAGGTLKILFDPDTLKL-FGVHAIGEGATEI  366

Query  596  MQ----AMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            +     AM +   L +  D + N    +P  AE+  +
Sbjct  367  IHIGQVAMAMGCSLTYFRDAVFN----YPTLAEAYRV  399

>PITG_19065
Length=416

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 84/344 (24%), Positives = 149/344 (43%), Gaps = 32/344 (9%)

Query  300  QITTRNVVIAVGSRPRE--LTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAG  356
            +I     +IA G+RP    L    G+  + SD I      + P   +V+GA  + +E A 
Sbjct  74   RIKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYAS  133

Query  357  FLKGM-GYEVKVMV-RSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQL  414
             +  + G+ V V+  R  +L   D+E+   +   M+  +G +F+   + +++ ++E    
Sbjct  134  MVNVVPGHTVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVETTDK  189

Query  415  LVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGRIMV-KNEQTSTSN  473
             VK     GK    + + +L   GR      L L+  G+  N + G I V KN QT   +
Sbjct  190  RVKVFFNSGKAL--SADALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPH  246

Query  474  IYAIGDVVDAPELTPVAIQSGRLLSQRLYN-----NSSVQMDYDKVCTTVFTPIEYGCCG  528
            IYA GD + AP L   +++ GRL S  ++N      ++ Q++       ++T  E    G
Sbjct  247  IYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVG  306

Query  529  LSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYL  588
             +E+    +  +D +  Y             +   A     +K++ D    K V G H +
Sbjct  307  QTEQ----QLTKDCVN-YEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAI  360

Query  589  GPNAGEVMQ----AMGLAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            G  A E++     AM +   L +  D + N    +P  AE+  +
Sbjct  361  GEGATEIIHIGQVAMAMGCSLTYFRDAVFN----YPTLAEAYRV  400

>HYAP_08069
Length=255

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 98/220 (45%), Gaps = 23/220 (10%)

Query  156  DYDLVVIggglgglACSKEAASFGQK-VCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214
            DYDLVVIGGG GG   + +AA  G K  CV    K         LGGTC+NVGCIP K +
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVESRGK---------LGGTCLNVGCIPSKAL  84

Query  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274
              S+ +    +H+   +G    N     P     Q++   +  ++T+    +       V
Sbjct  85   LHSTHLLHTAQHEFKSYGIDAPNVTANFP-----QMMKAKEKAVRTLTAGIESLFSKNKV  139

Query  275  KYENFLGSFVDPHTVKLS-HPRKGTKQITTRNVVIAVGSR-----PRELTCPGGEYAVSS  328
             Y   +G       V ++   R+G   +T +N+++A GS      P  +    G+   S+
Sbjct  140  TYIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDST  199

Query  329  DDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVM  368
              +   +  E    +V+GA  + LE     K +G +V V+
Sbjct  200  GALALTRVPE--HLVVVGAGVIGLELGSVYKRLGAKVTVV  237

>PYIR_21896
Length=518

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 117/508 (23%), Positives = 205/508 (40%), Gaps = 69/508 (14%)

Query  152  KP-IFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIP  210
            KP + +YDLVVIG G     C+ E+A  G++V V+D            +GG CV+ G IP
Sbjct  32   KPQVANYDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIP  83

Query  211  KKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLR  270
             K   ++ L     RH    +G  +    KTV + D    V  V      +N +  + + 
Sbjct  84   SKTFREAVLHLSGYRH-HGFYGKSYSM--KTVTIDDILYRVKRV------VNSEVDISIV  134

Query  271  SKNVKYENFLGSFVDPHTVKLSHPRKGT-KQITTRNVVIAVGSRPRE--LTCPGGEYAVS  327
                      G   D       H    T  ++     +IA G+RP    L    G+    
Sbjct  135  RDTPDAAG--GDAGDS-----DHDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKVIFD  187

Query  328  SDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSFDQEMADK  384
            SD I     +E P   +V+GA  + +E A  +  + G+ V V+  RS +L   D E+   
Sbjct  188  SDQILSGDIRELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIISN  247

Query  385  IGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVA  444
            +   M  + G +F+   + ++I  +E  +  V      GK    + + +L   GR     
Sbjct  248  LTYEMRSK-GARFL---LGETIKHVEKTESGVTVHFNSGKIT--SADALLYTVGRQAATD  301

Query  445  HLGLDKAGVKLNEKTGRIMVKNEQTSTSNI------------------YAIGDVVDAPEL  486
             L L+   +  N +    + K+ QT+  ++                  YA GD + AP L
Sbjct  302  GLNLEAVDLSRNPRGLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSL  361

Query  487  TPVAIQSGRLLSQRLYNNS----SVQMDYDKVCTTVFTPIEYGCCGLSEE--TSKGRYGE  540
               +++ GRL +  +++      + Q++       ++T  E    G +E+  T +G    
Sbjct  362  ASTSMEQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGL---  418

Query  541  DNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMG  600
             N EI    +  L      +   ++    +K++ D +  K   G H +G  A E++    
Sbjct  419  -NFEIGIAKYSELA---KGQMSGSTAGGMLKILFDPTTLKL-FGVHAIGEGATEIIHIGQ  473

Query  601  LAMRLRFTYDQMVNTVGIHPMTAESLTI  628
            +AM +  +     + V  +P  AE+  +
Sbjct  474  VAMAMGCSITYFRDAVFNYPTLAEAYRV  501

>SPRG_04114
Length=376

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 87/358 (24%), Positives = 155/358 (43%), Gaps = 31/358 (9%)

Query  266  KVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRE--LTCPGGE  323
            + +L++  V     L  F + + V +        ++  +  ++A G+RP    L    G+
Sbjct  5    QAQLKAARVDLVPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGK  64

Query  324  YAVSSDDIFWMKE-KEPGKTLVIGASYVALECAGFLKGM-GYEVKVM-VRSILLRSFDQE  380
              + SD I      K P   +V+GA  + +E A  L  + G  V V+  R+ +L   D E
Sbjct  65   IILDSDQILNHDTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDE  124

Query  381  MADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTC-EEAFNTVLNATGR  439
            +   +   M    G +F+   + +SI  +E+ +  VK     GK    EA    L   GR
Sbjct  125  IVSSLKMEMR-HKGARFL---LGESIKSVEHFKNGVKVEFNSGKAMFAEAL---LYCVGR  177

Query  440  DPEVAHLGLDKAGVKLNEKTGRIMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLS  498
                  L L+  G+  N + G I V  + QTS  +IYA GD + AP L   +++ GRL +
Sbjct  178  QANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAA  236

Query  499  QRLYNN---SSVQMDYDKVCTTVFTPIEYGCCGLSEE--TSKGRYGEDNIEIYHTNFVPL  553
              ++++   ++ Q++       ++T  E    G +E+  T +G     N  +    F   
Sbjct  237  CDMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGA----NYAVGLAKF---  289

Query  554  EWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQ--AMGLAMRLRFTY  609
               L+    +      +K++ D    +  LG H +G  A E++    + +AM  + TY
Sbjct  290  -SELAKGQMSGDIEGILKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKITY  345

>PPTG_24712
Length=67

 Score = 51.2 bits (121),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 3/62 (5%)

Query  157  YDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQ  216
            YD +VIGGG GG+A ++ AA+FG KV V   V+   +    GLGGTCVN GC+PKK++  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  217  SS  218
            ++
Sbjct  64   TA  65

>HYAP_13613
Length=423

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 59/246 (24%), Positives = 103/246 (42%), Gaps = 33/246 (13%)

Query  142  AEISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQKVCVLDYVKPSPQGTAWGLGG  201
            A ++ST  Q  P+  YDLVVIG G     C+ ++A  G++V ++D            LGG
Sbjct  18   ARLTSTQSQLSPVSSYDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGG  69

Query  202  TCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTI  261
             CV+ G IP K   ++ L     RH    +G  +    KTV + D   ++  V   + + 
Sbjct  70   VCVHTGTIPSKTFREAVLHLSGYRHHGF-YGKSYSM--KTVTIED---ILYRVQRVVSSE  123

Query  262  NFKYKVKLRSKNVKYENFLGSFVDPHTVKL---------------SHPRKGTKQITTRNV  306
                + +L++  V        F   H + +               S+      ++     
Sbjct  124  EDVVRAQLKAARVDVIPGFARFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKF  183

Query  307  VIAVGSRPRE--LTCPGGEYAVSSDDIFWMKEKE-PGKTLVIGASYVALECAGFLKGM-G  362
            ++A G+RP    L    G+  + SD I     ++ P   +V+GA  + +E A  +  + G
Sbjct  184  LVACGTRPAHNPLVPIDGKIVIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMINVVPG  243

Query  363  YEVKVM  368
            + V V+
Sbjct  244  HSVTVV  249

>PITG_19802
Length=185

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 42/158 (27%), Positives = 70/158 (44%), Gaps = 10/158 (6%)

Query  470  STSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGL  529
            S   I+AIGDV+    L   A + G    + +       ++Y  +   ++T  E+   G 
Sbjct  23   SVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGK  81

Query  530  SEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRT-ASNSCYIKVVCDKSRDKFVLGFHYL  588
            +EE  K     + IE Y+    P+    +S  RT A     +KV+ DK  DK +LG H +
Sbjct  82   TEEELKA----EGIE-YNVGKFPM--MANSRARTIAEADGLVKVLADKKTDK-LLGVHII  133

Query  589  GPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
              NAGE++    + +      + +  T   HP  +E+ 
Sbjct  134  AGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  171

>PYIW_27568
Length=128

 Score = 40.0 bits (92),  Expect = 0.007, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 55/120 (46%), Gaps = 9/120 (8%)

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS  567
             ++Y+ +   ++T  E    G +EE  K    E+ +  Y+    P+    +S  R    +
Sbjct  3    HVNYNAIPGVIYTFPEVASVGKTEEQLK----EEGVA-YNVGKFPM--MANSRARAVGEA  55

Query  568  -CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
               +KV+ DK+ DK +LG H +  NAGE++    L M      + +  T   HP  +E+ 
Sbjct  56   DGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHPTLSEAF  114

>SPRG_04231
Length=90

 Score = 38.5 bits (88),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 0/52 (0%)

Query  578  RDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629
            +DK V+G H  G  A E++Q  G+A+++        N V IHP  +E L  +
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  60

>PYU1_G014369
Length=703

 Score = 41.6 bits (96),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 77/172 (45%), Gaps = 23/172 (13%)

Query  235  FDNEGKTVPVFDWKQLVANVDGYIKTIN-FKYKVKLRSKNVKYENFLGSFVDPHTVKLSH  293
            FD        F+  +++   + + +T+  F+ K+KL   NVK    LG  V    +    
Sbjct  403  FDQADAIGGQFNMAKVIPGKEEFYETLRYFEKKLKLTGVNVK----LGQRVSAEDLAAGG  458

Query  294  PRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEP-GKTL-VIGASYVA  351
              K         VVIA G  PR+L  PGG+++     I  +K K P GK + VIGA  + 
Sbjct  459  FDK---------VVIATGVLPRDLKIPGGDHSKVLSYIDVLKHKAPVGKRVAVIGAGGIG  509

Query  352  LECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVP  403
             + + FL  +G        S+ +  F +E    I     V+ G++ +++ VP
Sbjct  510  FDVSEFLTHIGKSA-----SLDVNLFAKEWG--IDTSNSVRGGVQGVKQEVP  554

>HYAP_03065
Length=701

 Score = 40.0 bits (92),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 58/131 (44%), Gaps = 16/131 (12%)

Query  235  FDNEGKTVPVFDWKQLVANVDGYIKTIN-FKYKVKLRSKNVKYENFLGSFVDPHTVKLSH  293
            FD        F+  ++V   + + +T+  F+ ++KLR  NVK    LG     H V+ + 
Sbjct  401  FDQADAIGGQFNMAKIVPGKEEFYETLRYFEKQLKLRGVNVK----LG-----HRVEAAE  451

Query  294  PRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEP--GKTLVIGASYVA  351
               G        VVIA G  PR LT PG ++      I  +K + P   K  +IGA  + 
Sbjct  452  LMSGAFD----KVVIATGVVPRSLTIPGADHPKVLSYIDVLKNEAPVGQKVAIIGAGGIG  507

Query  352  LECAGFLKGMG  362
             + A FL   G
Sbjct  508  FDVAEFLTHEG  518

>PHYSO_507629
Length=703

 Score = 38.9 bits (89),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 9/100 (9%)

Query  306  VVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEP--GKTLVIGASYVALECAGFLKGMGY  363
            VVIA G  PREL  PG ++      I  +K K P   K  VIGA  +  + A F+  +G 
Sbjct  462  VVIATGVLPRELKIPGADHPKVLSYIDVLKNKAPVGKKVAVIGAGGIGFDVAEFITHVGE  521

Query  364  EVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVP  403
                 V +   R +  +M +       V+ G+  I+ ++P
Sbjct  522  STSSSVDA-FAREWGIDMTN------SVRGGVAGIKPSIP  554

>SPRG_17626
Length=148

 Score = 36.6 bits (83),  Expect = 0.14, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 55/120 (46%), Gaps = 9/120 (8%)

Query  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS  567
             ++Y+ +   V+T  E    G +EE  K      N+  Y+    P+    +S  RT   +
Sbjct  23   HVNYNAIPGVVYTFPEVASVGKTEEELKAA----NVA-YNVGKFPM--MANSRARTVGET  75

Query  568  -CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626
              ++K++  K  DK +LG H +  NAGE++    L +    + + +  T   HP  +E+ 
Sbjct  76   DGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEAF  134

>PPTG_08060
Length=725

 Score = 38.5 bits (88),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 71/172 (41%), Gaps = 23/172 (13%)

Query  235  FDNEGKTVPVFDWKQLVANVDGYIKTIN-FKYKVKLRSKNVKYENFLGSFVDPHTVKLSH  293
            FD        F+  + +   + + +T+  F+ ++KL+  NVK    LG  V+   +    
Sbjct  425  FDQADAIGGQFNMAKTIPGKEEFYETLRYFEKQLKLKGVNVK----LGQHVEAADLTTGA  480

Query  294  PRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEP--GKTLVIGASYVA  351
              K         VVIA G  PR L  PG ++      I  +K K P   K  +IGA  + 
Sbjct  481  FDK---------VVIATGVLPRTLKIPGADHPKVLSYIDVLKHKAPVGKKVAIIGAGGIG  531

Query  352  LECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVP  403
             + A FL  +G      V  +  R +  +  +       V+ G+  I+ ++P
Sbjct  532  FDVAEFLSHVGESTSSSV-DVFAREWGIDTTN------SVRGGVAGIKPSIP  576

>PHYRA_74125
Length=4838

 Score = 37.7 bits (86),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query  189   KPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWK  248
             +P P G  W   G  +N   +  +  H  +L+G++ R +SA   W  DNE + + + D++
Sbjct  4054  QPKPFG--WMPTGAWLNAVQLASEKPHYRNLLGDLERSESAWRKWFEDNEPERLAIPDYE  4111

Query  249   QLVANVDGYIKTINFKYKVKLRS  271
              L+ +       +NF   + +RS
Sbjct  4112  ALLFDPRAITANLNFHRLLLVRS  4134

>PHALS_10960
Length=702

 Score = 37.0 bits (84),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 49/226 (22%), Positives = 94/226 (42%), Gaps = 32/226 (14%)

Query  245  FDWKQLVANVDGYIKTIN-FKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITT  303
            F+  +++   + + +T+  F+ ++KL   NVK+    G  VD   +      K       
Sbjct  413  FNMAKIIPGKEEFHETLRYFQKQLKLNGVNVKH----GRRVDAADLTAGDFDK-------  461

Query  304  RNVVIAVGSRPRELTCPGGEY--AVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGM  361
              VV+A G  PR L  PG ++   +S  D+   K K   +  +IGA  +  + A FL  +
Sbjct  462  --VVMASGVLPRPLKIPGADHPMVLSYMDVLKKKSKVGQRVAIIGAGGIGFDVAEFLTHV  519

Query  362  GYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDE  421
            G      V  +  R +  +  +       V+ G+  I+ +VP     +    L+ +   +
Sbjct  520  GESTSSSV-EVFAREWGIDTTN------SVRGGVAGIKSSVPPPAREI---YLMQRKSTK  569

Query  422  KGKTCEEAFNTVLNATGRDPEVAHLG------LDKAGVKLNEKTGR  461
             GK   +    +   + +   V  +G      +D AG+   +K+G+
Sbjct  570  HGKDLGKTTGWIHRLSLKHRNVKMIGGVSYDKVDDAGLHYTDKSGK  615

>HYAP_08068
Length=100

 Score = 34.3 bits (77),  Expect = 0.45, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 34/70 (49%), Gaps = 2/70 (3%)

Query  558  SSETRT-ASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTV  616
            +S  RT A     +KV+ DK  DK +LG H +  NAGE++    + +      + +  T 
Sbjct  3    NSRARTVAEADGMVKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTC  61

Query  617  GIHPMTAESL  626
              HP  +E+ 
Sbjct  62   HAHPTLSEAF  71

>PYVX_14222
Length=5107

 Score = 37.0 bits (84),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query  189   KPS---PQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVF  245
             KPS   P+  AW      +N   + +   H  SL+G++ R ++    W  DNE +  PV 
Sbjct  3969  KPSADQPKPFAWLPTQAWLNAVQLAQDKPHFRSLLGDLERSEALWRRWVDDNEPERAPVP  4028

Query  246   DWKQLVANVDGYIKTINFKYKVKLRS  271
             D++ L+ +  G   +++F   + +R+
Sbjct  4029  DYETLLFDPRGMTASLHFHRLLLVRA  4054

>PHYKE_2744
Length=117

 Score = 33.9 bits (76),  Expect = 0.91, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 22/38 (58%), Gaps = 2/38 (5%)

Query  301  ITTRNVVIAVGSRPRELTC--PGGEYAVSSDDIFWMKE  336
            +   N++IA GSRPR L    P G Y +SSD+   M E
Sbjct  58   VVPTNLIIATGSRPRVLPGLEPDGRYIMSSDEALRMDE  95

>CCI50227
Length=707

 Score = 35.8 bits (81),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query  315  RELTCPGGEYAVSSDD-IFWMKEKEPGKTLVIGASYVALECAGF---LKGMGYEVKVMVR  370
            R  +   GE   S DD I  M+E +PG   V G S  A+E + F   LK  GYEV  MV 
Sbjct  442  RYHSTKSGEEMTSLDDYISRMQENQPGIYYVTGESKKAVENSPFLEKLKKKGYEVIYMVE  501

Query  371  SILLRSFDQEMADKIGEYMEVQSGIKFIRKT  401
            +I     D+    ++ EY     G K I  T
Sbjct  502  AI-----DEYAVQQLKEY----EGKKLISAT  523

>PHYSO_300621
Length=4833

 Score = 35.0 bits (79),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query  189   KPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWK  248
             +P P G  W   G  +N   +  +  H  +L+G++ R +SA   W  DNE + + V D++
Sbjct  4052  QPKPFG--WMPTGAWLNAVQLASEKPHFRNLLGDLERSESAWRKWFEDNEPERLAVPDYE  4109

Query  249   QLVANVDGYIKTINFKYKVKLRS  271
              L+ +       ++F   + +RS
Sbjct  4110  GLLFDPRAITANLHFHRLLLVRS  4132

>PITG_00703
Length=703

 Score = 34.7 bits (78),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query  306  VVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEP--GKTLVIGASYVALECAGFLKGMG  362
            VVIA G  PR L  PG ++      +  +K K P   K  +IGA  +  + A FL  +G
Sbjct  462  VVIATGVLPRALKIPGADHPKVLSYLDVLKNKAPVGNKVAIIGAGGIGFDVAEFLAHVG  520

>PYAP_17256
Length=705

 Score = 34.3 bits (77),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 75/172 (44%), Gaps = 18/172 (10%)

Query  306  VVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEP--GKTLVIGASYVALECAGFLKGMGY  363
            V++A G  PR+L  PG ++      I  +K K P   K  VIGA  +  + + ++   G 
Sbjct  464  VIVATGVLPRDLKIPGADHPKVVSYIDVLKHKVPVGKKVAVIGAGGIGFDVSEYVTHHGK  523

Query  364  EVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKG  423
                   S+ +  F +E    +     V+ GI  ++  +P+S   +    LL +   + G
Sbjct  524  S-----PSLDVNLFAKEWGFDVTN--SVRGGIAGVKPEIPESPREV---YLLQRKSTKHG  573

Query  424  KTCEEAFNTVLNATGRDPEVAHLG------LDKAGVKLNEKTGRIMVKNEQT  469
            K   +    +  A+ +  +V  +G      +D AG+ + +K G+  V +  T
Sbjct  574  KDLGKTTGWIHRASLKARDVKMIGGVKYDKVDDAGLHITDKKGQQKVLDVDT  625

>PHYRA_87328
Length=486

 Score = 34.3 bits (77),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 72/181 (40%), Gaps = 39/181 (22%)

Query  239  GKTVPVFDWKQLVANVDGYIKTIN-----------FKYKVKLRSKNVKYENFLGSFVDPH  287
            G  V +FD  + +       KTI            F+ ++KL+  NVK    LG      
Sbjct  180  GHEVTLFDQAEAIGGQFNMAKTIPGKEEFYETLRYFEKQLKLKGVNVK----LGQ-----  230

Query  288  TVKLSHPRKGTKQITT---RNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEP--GKT  342
                   R G   + +     VVI+ G  PR L  PG ++      I  +K+K P   K 
Sbjct  231  -------RVGVADLASGAFDKVVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKV  283

Query  343  LVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTV  402
             +IGA  +  + A F+  +G        S  + +F +E    I     V+ G+  I+ ++
Sbjct  284  AIIGAGGIGFDVAEFITHVGEST-----SSSVDAFAREWG--IDTTNSVRGGVAGIKSSI  336

Query  403  P  403
            P
Sbjct  337  P  337

>PHYRA_72196
Length=691

 Score = 34.3 bits (77),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 72/181 (40%), Gaps = 39/181 (22%)

Query  239  GKTVPVFDWKQLVANVDGYIKTIN-----------FKYKVKLRSKNVKYENFLGSFVDPH  287
            G  V +FD  + +       KTI            F+ ++KL+  NVK    LG      
Sbjct  397  GHEVTLFDQAEAIGGQFNMAKTIPGKEEFYETLRYFEKQLKLKGVNVK----LGQ-----  447

Query  288  TVKLSHPRKGTKQITT---RNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEP--GKT  342
                   R G   + +     VVI+ G  PR L  PG ++      I  +K+K P   K 
Sbjct  448  -------RVGVADLASGAFDKVVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKV  500

Query  343  LVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTV  402
             +IGA  +  + A F+  +G        S  + +F +E    I     V+ G+  I+ ++
Sbjct  501  AIIGAGGIGFDVAEFITHVGEST-----SSSVDAFAREWG--IDTTNSVRGGVAGIKSSI  553

Query  403  P  403
            P
Sbjct  554  P  554

>PYU1_G000378
Length=1070

 Score = 34.3 bits (77),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 83/170 (49%), Gaps = 7/170 (4%)

Query  343  LVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFIRKTV  402
            LVIG   + LE A  +  +   V+++ R   L S  +++ D   + +  +   KF  + +
Sbjct  160  LVIGGGLLGLEAAKAIHDLQLSVRIVNRGSRLMS--RQLDDAGAKVLHNEIVSKFGIEVL  217

Query  403  PQSISRLENRQLLVKWVD-EKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTGR  461
                ++  +   +V+ VD   G++ ++ F  V  ATG  P    LG D +G+ + ++ G 
Sbjct  218  YHKTTKYIHGTTVVEGVDFTDGESYDDVFMIVF-ATGIKPR-DDLGRD-SGLDVAQRGGG  274

Query  462  IMVKNE-QTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMD  510
            I+V +  +TS  ++YAIG+ V   ++T   +  G  ++  L  N +   D
Sbjct  275  ILVNDLLETSHKDVYAIGECVSHRDVTYGLVAPGYEMADNLAKNFTANGD  324

>PHYKE_6590
Length=1054

 Score = 33.9 bits (76),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 38/166 (23%), Positives = 75/166 (45%), Gaps = 10/166 (6%)

Query  353  ECAGFLKGMGYEVKVMVRSILL--RSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLE  410
            E A  +  +   V+++ R   L  R  D++ A  +   +  + GI  + +   Q I  L 
Sbjct  183  EAAKAVHDLHVSVRIINRGTRLMSRQLDEDGAKVLHNEIVNKFGIDVLYEKSTQGI--LG  240

Query  411  NRQLLVKWVDEKGKTCEEAFNTVLNATGRDP--EVAHLGLDKAGVKLNEKTGRIMVKNEQ  468
             ++  V+ V+       +    ++ ATG  P  E+AH     +G++L ++ G ++    +
Sbjct  241  TKENGVEGVEFTNGETFDDVCMIIFATGIKPRDELAH----SSGLELAKRGGILINDYLE  296

Query  469  TSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKV  514
             STSN+YA+G+ +     T   +  G  ++  L  N +     D+V
Sbjct  297  CSTSNVYALGECISHRNATYGLVAPGYEMADTLAKNLNCSSSTDRV  342

>PYIR_13336
Length=1031

 Score = 33.9 bits (76),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 0/42 (0%)

Query  238   EGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYENF  279
             EGKTV   D KQ++ NVD Y++ +  +Y V L   +   E+F
Sbjct  960   EGKTVYTADRKQVLKNVDDYVEYLLLQYHVALVPGSAFGEDF  1001

>H257_04029
Length=4673

 Score = 33.9 bits (76),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 0/78 (0%)

Query  186   DYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVF  245
             ++    P+  AW  G    NV  + +      +L+ +I R+++    W  DNE + VP+ 
Sbjct  3925  NHASEKPKPFAWLSGPAWTNVQQLCQDKPEFRNLVADIERNEAPWRRWYEDNEPEKVPIP  3984

Query  246   DWKQLVANVDGYIKTINF  263
             D++ L+ + D      +F
Sbjct  3985  DYETLLFHPDAANAKTHF  4002

>PYIW_16666
Length=1078

 Score = 33.5 bits (75),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 78/165 (47%), Gaps = 9/165 (5%)

Query  343  LVIGASYVALECAGFLKGMGYEVKVMVRS--ILLRSFDQEMADKIGEYMEVQSGIKFIRK  400
            LVIG   + LE A  +  +   V+++ R   ++ R  D   A  +   +  + GI+ +  
Sbjct  192  LVIGGGLLGLEAAKAIHDLKVSVRIVNRGSRLMSRQLDDAGAKVLHNEITSKFGIQVLYH  251

Query  401  TVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEKTG  460
               +SI   EN    V++ D  G + ++ F  V  ATG  P    L L  +G+K+  + G
Sbjct  252  KSTKSIHG-ENDVQGVEFTD--GSSLDDVFMIVF-ATGIKPR-DDLAL-ASGLKVVTRGG  305

Query  461  RIMVKN-EQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNN  504
             I V +  +TS + +YAIG+ V   ++T   +  G  ++  L  N
Sbjct  306  GIQVSDFLETSANAVYAIGECVSHRDVTYGLVAPGYEMADSLAKN  350

>PYAR_15823
Length=705

 Score = 32.7 bits (73),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query  306  VVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKEP--GKTLVIGASYVALECAGFLKGMG  362
            VV+A G  PREL  PG ++      I  +K   P   K  V+GA  +  + + F+   G
Sbjct  475  VVVATGVEPRELKIPGADHPKVVSYIDVLKHNAPVGKKVAVVGAGGIGFDVSEFVTHHG  533

>PYU1_G006877
Length=920

 Score = 32.7 bits (73),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 42/116 (36%), Gaps = 2/116 (2%)

Query  66   LLFEDREKFRVWLKASQGDFAVSFGAKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRS  125
            L  E  E+F + L  S   FA+ F     A      P   + NP TF   C  LLL    
Sbjct  56   LPMEAMEQFVLLLSQSSVHFALQFFWIIYAALDENRP-KRNGNPRTF-ARCAQLLLALEQ  113

Query  126  GIAVGRPQGMHTSDEVAEISSTAVQEKPIFDYDLVVIggglgglACSKEAASFGQK  181
                G P     S+ +   S +  +   I   D           ACS EA + G+K
Sbjct  114  CFVHGSPAAKVASELLTRNSISKTEMDEILSADRRFFAAQSSLEACSSEAMAMGEK  169

Lambda      K        H        a         alpha
   0.319    0.135    0.402    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 50416951878

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40