Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_06480534611591598472e-117
PPTG_1712314753201733243e-37
PHYCA_53732344966200743201e-36
PHYKE_839053461130713071e-35
PHYRA_8110553461201733086e-35
PITG_1845214753856743289e-35
PYVX_1817344966500712624e-26
HYAP_0709653461251732412e-24
PHYSO_35340153461146401732e-15
PYU1_G00173993203266591732e-14
PYU1_G00173853461226571712e-14
PYIW_1878893203244571398e-10
PHYKE_838914752204531273e-08
PHYCA_12942514752204531249e-08
PPTG_1712156876202531249e-08
PHYRA_8110614752202531231e-07
PHYSO_47782056876202561221e-07
PHYCA_51140956876204531212e-07
PHYKE_838856876205541202e-07
PPTG_1004821314190531203e-07
PYVX_1817656876201531203e-07
PYU1_G00174014752206591193e-07
PHYSO_28408614752204531194e-07
PYIW_1879185404194641194e-07
PPTG_1712214752204531194e-07
PHYCA_10255045705268531205e-07
PHYRA_8110756876202531177e-07
PPTG_1526423128194531168e-07
PPTG_1736623913194531168e-07
PYU1_G00174456876213591178e-07
PYU1_G00174293204213591179e-07
PYU1_G00174185404199811161e-06
PHYKE_344623128199531152e-06
PYIR_2508985404262591152e-06
PITG_1981815643147611122e-06
PHYRA_8286423128193531124e-06
PHYSO_53642460691197651114e-06
PHYSO_50703158653197651114e-06
PYIW_187905687686591056e-06
PHYRA_8563110979228541116e-06
PPTG_1063552856199531107e-06
PHYCA_1436852856219541107e-06
PYIR_2662614752212591107e-06
PHYCA_10262472013195541099e-06
PHYCA_1436910979248531072e-05
PHYSO_34159910979185531062e-05
PPTG_1063610979246541072e-05
PITG_1352010979171531053e-05
PHYRA_8419072013206541053e-05
PPTG_1064345705250531055e-05
PPTG_1063472013208541045e-05
PHYKE_8104771358654986e-05
PITG_1845014752203531029e-05
PYVX_181795346114753991e-04
PHYCA_10285224206195531001e-04
PYVX_181748540420453992e-04
PYIR_265468660523962993e-04
PHYKE_77181097922054983e-04
PYIW_187929320412559954e-04
PHYSO_2466764570518753974e-04
PHALS_004981097919962974e-04
PHALS_032843094118852965e-04
PHYSO_4999782312817453965e-04
PHYSO_5015758207717453965e-04
PYVX_181751475214753938e-04
PHYSO_3403695267620060840.019
PPTG_08820866225055800.092
PYAP_222789320428996790.12
PHYSO_3415965285623133780.13
PYAR_240969320322760770.18
PYAP_222798540422359740.43
PHYSO_3433765323717265720.77
PHYSO_5279086006417434710.88
PITG_10499866232357711.5
PYAP_222739320326862692.0
PYU1_G0011814981694240693.0
SDRG_00451342670854674.7
H310_08273254197652674.8
SPRG_08646659962745675.6
H257_1927314767214360647.1
PHYRA_861517283617046647.7
PYIW_1801094940156145667.8
PHYRA_879417410615746639.3
PHYKE_91854457628158649.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_06480

Length=159
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHALS_06480                                                           330        2e-117
PPTG_17123                                                            129        3e-37 
PHYCA_537323                                                          127        1e-36 
PHYKE_8390                                                            122        1e-35 
PHYRA_81105                                                           123        6e-35 
PITG_18452                                                            130        9e-35 
PYVX_18173                                                            105        4e-26 
HYAP_07096                                                            97.4       2e-24 
PHYSO_353401                                                          71.2       2e-15 
PYU1_G001739                                                          71.2       2e-14 
PYU1_G001738                                                          70.5       2e-14 
PYIW_18788                                                            58.2       8e-10 
PHYKE_8389                                                            53.5       3e-08 
PHYCA_129425                                                          52.4       9e-08 
PPTG_17121                                                            52.4       9e-08 
PHYRA_81106                                                           52.0       1e-07 
PHYSO_477820                                                          51.6       1e-07 
PHYCA_511409                                                          51.2       2e-07 
PHYKE_8388                                                            50.8       2e-07 
PPTG_10048                                                            50.8       3e-07 
PYVX_18176                                                            50.8       3e-07 
PYU1_G001740                                                          50.4       3e-07 
PHYSO_284086                                                          50.4       4e-07 
PYIW_18791                                                            50.4       4e-07 
PPTG_17122                                                            50.4       4e-07 
PHYCA_102550                                                          50.8       5e-07 
PHYRA_81107                                                           49.7       7e-07 
PPTG_15264                                                            49.3       8e-07 
PPTG_17366                                                            49.3       8e-07 
PYU1_G001744                                                          49.7       8e-07 
PYU1_G001742                                                          49.7       9e-07 
PYU1_G001741                                                          49.3       1e-06 
PHYKE_3446                                                            48.9       2e-06 
PYIR_25089                                                            48.9       2e-06 
PITG_19818                                                            47.8       2e-06 
PHYRA_82864                                                           47.8       4e-06 
PHYSO_536424                                                          47.4       4e-06 
PHYSO_507031                                                          47.4       4e-06 
PYIW_18790                                                            45.1       6e-06 
PHYRA_85631                                                           47.4       6e-06 
PPTG_10635                                                            47.0       7e-06 
PHYCA_14368                                                           47.0       7e-06 
PYIR_26626                                                            47.0       7e-06 
PHYCA_102624                                                          46.6       9e-06 
PHYCA_14369                                                           45.8       2e-05 
PHYSO_341599                                                          45.4       2e-05 
PPTG_10636                                                            45.8       2e-05 
PITG_13520                                                            45.1       3e-05 
PHYRA_84190                                                           45.1       3e-05 
PPTG_10643                                                            45.1       5e-05 
PPTG_10634                                                            44.7       5e-05 
PHYKE_8104                                                            42.4       6e-05 
PITG_18450                                                            43.9       9e-05 
PYVX_18179                                                            42.7       1e-04 
PHYCA_102852                                                          43.1       1e-04 
PYVX_18174                                                            42.7       2e-04 
PYIR_26546                                                            42.7       3e-04 
PHYKE_7718                                                            42.4       3e-04 
PYIW_18792                                                            41.2       4e-04 
PHYSO_246676                                                          42.0       4e-04 
PHALS_00498                                                           42.0       4e-04 
PHALS_03284                                                           41.6       5e-04 
PHYSO_499978                                                          41.6       5e-04 
PHYSO_501575                                                          41.6       5e-04 
PYVX_18175                                                            40.4       8e-04 
PHYSO_340369                                                          37.0       0.019 
PPTG_08820                                                            35.4       0.092 
PYAP_22278                                                            35.0       0.12  
PHYSO_341596                                                          34.7       0.13  
PYAR_24096                                                            34.3       0.18  
PYAP_22279                                                            33.1       0.43  
PHYSO_343376                                                          32.3       0.77  
PHYSO_527908                                                          32.0       0.88  
PITG_10499                                                            32.0       1.5   
PYAP_22273                                                            31.2       2.0   
PYU1_G001181                                                          31.2       3.0   
SDRG_00451                                                            30.4       4.7   
H310_08273                                                            30.4       4.8   
SPRG_08646                                                            30.4       5.6   
H257_19273                                                            29.3       7.1   
PHYRA_86151                                                           29.3       7.7   
PYIW_18010                                                            30.0       7.8   
PHYRA_87941                                                           28.9       9.3   
PHYKE_9185                                                            29.3       9.5   

>PHALS_06480
Length=159

 Score = 330 bits (847),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)

Query  1    MDSAKCTCVLLLLFGQLFDCIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLE  60
            MDSAKCTCVLLLLFGQLFDCIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLE
Sbjct  1    MDSAKCTCVLLLLFGQLFDCIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLE  60

Query  61   EQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKAIRWMVLARSTTACVGIHVSLCGTGLE  120
            EQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKAIRWMVLARSTTACVGIHVSLCGTGLE
Sbjct  61   EQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKAIRWMVLARSTTACVGIHVSLCGTGLE  120

Query  121  SSTSKGFIHGKSTKTASTSVIKALVSRKETRSRTSVNTQ  159
            SSTSKGFIHGKSTKTASTSVIKALVSRKETRSRTSVNTQ
Sbjct  121  SSTSKGFIHGKSTKTASTSVIKALVSRKETRSRTSVNTQ  159

>PPTG_17123
Length=201

 Score = 129 bits (324),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 0/73 (0%)

Query  21  IYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYN  80
           I G RRL+AGLGEGQVVL+P PF+VVDGLDFQGMALAYL+EQG+NTSIE QSWM+ H Y 
Sbjct  23  IAGQRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYT  82

Query  81  SLRAMLDDDMLYK  93
           SLRAMLDD+ LYK
Sbjct  83  SLRAMLDDESLYK  95

>PHYCA_537323
Length=200

 Score = 127 bits (320),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)

Query  20  CIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAY  79
           C+ G RRL+AGLGEGQVV +P PF++VDGLDFQGMALAYL+EQG+NTSIE QSWM+ H Y
Sbjct  21  CVTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGY  80

Query  80  NSLRAMLDDDMLYK  93
            SLRAMLDD+ LY+
Sbjct  81  TSLRAMLDDESLYQ  94

>PHYKE_8390
Length=130

 Score = 122 bits (307),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)

Query  23  GYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSL  82
           G RRL+A LGEGQ+VL P PF++VDGLDFQGMALAYL+EQG+NTSIE Q WM  H Y+SL
Sbjct  19  GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78

Query  83  RAMLDDDMLYK  93
           RAMLDD+ LYK
Sbjct  79  RAMLDDEALYK  89

>PHYRA_81105
Length=201

 Score = 123 bits (308),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 0/73 (0%)

Query  21  IYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYN  80
           I G RRL+AGLGEGQ+VL+P PF++VDGLDFQGMALAYL+EQG+NTSIE Q WM+ H Y 
Sbjct  23  IAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYA  82

Query  81  SLRAMLDDDMLYK  93
           SLR+MLDD+ LY+
Sbjct  83  SLRSMLDDESLYQ  95

>PITG_18452
Length=856

 Score = 130 bits (328),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)

Query  20   CIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAY  79
            C+ G RRL+AGLGEGQ+VL+P PF+VVDGLDFQGMALAYL+EQGINTSIE QSWM+   Y
Sbjct  677  CVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGY  736

Query  80   NSLRAMLDDDMLYK  93
            +SLRAMLDD+ LYK
Sbjct  737  SSLRAMLDDESLYK  750

>PYVX_18173
Length=500

 Score = 105 bits (262),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 60/71 (85%), Gaps = 0/71 (0%)

Query  22  YGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNS  81
           +  RRL++GLGEGQVVLYP PF+VVDG+D++G  +AYLE+QG++T+IE Q+W+ +  Y +
Sbjct  25  FAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYAT  84

Query  82  LRAMLDDDMLY  92
           LRA++DDD LY
Sbjct  85  LRALMDDDGLY  95

 Score = 53.5 bits (127),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)

Query  35   QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLY  92
            Q+V+ PAP Y V+G D +   LA+LE Q  +T+ +   ++  + ++SLRA +DDD LY
Sbjct  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293

>HYAP_07096
Length=251

 Score = 97.4 bits (241),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 1/73 (1%)

Query  20   CIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAY  79
            C+ G +RL + L EGQVVLYP+P ++VD    QG ALAYL+EQGI+TSIE QSW ++H Y
Sbjct  72   CVTG-QRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGY  130

Query  80   NSLRAMLDDDMLY  92
             SLRAMLDD  LY
Sbjct  131  VSLRAMLDDQSLY  143

>PHYSO_353401
Length=146

 Score = 71.2 bits (173),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)

Query  54  MALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           MALAYL+EQG+NTSIE QSWM++H Y SLRAMLDD+ LYK
Sbjct  1   MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYK  40

>PYU1_G001739
Length=266

 Score = 71.2 bits (173),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 0/59 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           Q++++P PF++VDG D Q   LA+LE QG+NTS +V  +MK   Y +LRA++DD+ LY+
Sbjct  25  QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYE  83

>PYU1_G001738
Length=226

 Score = 70.5 bits (171),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)

Query  37  VLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           VLYP PFY+VDG + Q   +A+LEEQGI TS +V  +MK   Y +LRAMLDD  LY 
Sbjct  25  VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81

>PYIW_18788
Length=244

 Score = 58.2 bits (139),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 2/57 (4%)

Query  37  VLYPAPFYVVDGLDFQGMA-LAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLY  92
           V YP PF+++DG D++  A +A LE+Q + TS +V  ++K   Y SLRAMLDD+ LY
Sbjct  30  VTYPEPFFLLDG-DYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLY  85

>PHYKE_8389
Length=204

 Score = 53.5 bits (127),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL PAP Y  D  D +   LA+LE QG  T  +  +W +++ Y +LRA +D
Sbjct  28  QVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMD  80

>PHYCA_129425
Length=204

 Score = 52.4 bits (124),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL PAP Y  D  D +   LA+LE QG  T  +   W + + Y +LRA +D
Sbjct  29  QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD  81

>PPTG_17121
Length=202

 Score = 52.4 bits (124),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL  AP Y  D  D +   LA+LE+QG  T  +  +W KD+ Y+SLRA  D
Sbjct  26  QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFND  78

>PHYRA_81106
Length=202

 Score = 52.0 bits (123),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL PAP Y  D  D +   LA+LE QG  T  +  +W + + Y +LRA +D
Sbjct  29  QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMD  81

>PHYSO_477820
Length=202

 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 32/56 (57%), Gaps = 0/56 (0%)

Query  32  GEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           G  QVVL PAP Y  D    +   LA+LE+QG  T  +  +W  D+ Y+SLRA  D
Sbjct  23  GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFND  78

>PHYCA_511409
Length=204

 Score = 51.2 bits (121),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL PAP Y  D    +   LA+LE+QG  T  +  +W +D+ Y+SLRA  D
Sbjct  28  QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFND  80

>PHYKE_8388
Length=205

 Score = 50.8 bits (120),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 0/54 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
           QVVL P+P Y  D    +   LA+LE+QG +T  +  +W  D+ Y SLRA  DD
Sbjct  29  QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDD  82

>PPTG_10048
Length=190

 Score = 50.8 bits (120),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL+PAP ++ D  D Q   LA+LE QG  T  + +SW   + Y +LR  ++
Sbjct  26  QVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFME  78

>PYVX_18176
Length=201

 Score = 50.8 bits (120),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q V+ PAP +  D  D     LA+LE+QG +T  +  +W  D+ Y+SLRA +D
Sbjct  26  QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMD  78

>PYU1_G001740
Length=206

 Score = 50.4 bits (119),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 33/59 (56%), Gaps = 0/59 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           Q+V+ P P + V   D +   LA+LE QG  T+ +  ++ K   Y SLRA +DD   YK
Sbjct  29  QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYK  87

>PHYSO_284086
Length=204

 Score = 50.4 bits (119),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL PAP Y  D    +   LA+LE QG  T  +  +W +D  Y +LRA +D
Sbjct  29  QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMD  81

>PYIW_18791
Length=194

 Score = 50.4 bits (119),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (55%), Gaps = 0/64 (0%)

Query  30  GLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDD  89
           G    Q V  P P + V         L++LE+ G+ TS  V  +MKD  Y++LRA++DD 
Sbjct  18  GADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDS  77

Query  90  MLYK  93
            LYK
Sbjct  78  KLYK  81

>PPTG_17122
Length=204

 Score = 50.4 bits (119),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL PAP Y  D  D +   LA+LE QG  T  +   W +++ Y +LR  +D
Sbjct  29  QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD  81

>PHYCA_102550
Length=268

 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL PAP +  D  D Q   LA+LE QG  T  +  +W  ++ Y SLR  +D
Sbjct  29  QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMD  81

>PHYRA_81107
Length=202

 Score = 49.7 bits (117),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL PAP Y  D    +   LA+LE+QG +T  +  +W +++ Y+SLRA  D
Sbjct  26  QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDD  78

>PPTG_15264
Length=194

 Score = 49.3 bits (116),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  D  D +   LA+LE QG  T  +  +W +D+ Y +LR  +D
Sbjct  26  QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD  78

>PPTG_17366
Length=194

 Score = 49.3 bits (116),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  D  D +   LA+LE QG  T  +  +W +D+ Y +LR  +D
Sbjct  26  QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD  78

>PYU1_G001744
Length=213

 Score = 49.7 bits (117),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 32/59 (54%), Gaps = 0/59 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           Q V+ PAP + V     Q   LA+LE QG  T+ +  ++ K   Y SLRA +DD   YK
Sbjct  29  QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYK  87

>PYU1_G001742
Length=213

 Score = 49.7 bits (117),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 33/59 (56%), Gaps = 0/59 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           Q V+ PAP + V     Q   LA+LE QG  T+++  ++ K   Y +LRA +DD   YK
Sbjct  29  QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYK  87

>PYU1_G001741
Length=199

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 39/81 (48%), Gaps = 4/81 (5%)

Query  12  LLFGQLFDCIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQ  71
           L+FG L      Y   +A     Q V+ PAP + V     Q   LA+LE QG  T+ +  
Sbjct  9   LVFGALVSSATLYNTADAH----QYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFN  64

Query  72  SWMKDHAYNSLRAMLDDDMLY  92
           ++ K   Y +LRA +DD   Y
Sbjct  65  AYYKAKGYKTLRAFMDDKKAY  85

>PHYKE_3446
Length=199

 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 31/53 (58%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  D  + +   LA+LE QG  T  +  +W +D+ Y +LRA +D
Sbjct  29  QIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMD  81

>PYIR_25089
Length=262

 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 32/59 (54%), Gaps = 0/59 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           Q V+ PAP + V     Q   LA+LE QG  T+ +  ++ K   Y +LRA +DD   YK
Sbjct  29  QYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAYK  87

>PITG_19818
Length=147

 Score = 47.8 bits (112),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 0/61 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKA  94
           Q+VL P P +     D +   LA+LE QG     + ++W  ++ Y SLR  +D   L++ 
Sbjct  27  QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFRR  86

Query  95  I  95
           +
Sbjct  87  V  87

>PHYRA_82864
Length=193

 Score = 47.8 bits (112),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL P P +  D  D +   LA+LE QG  T  +  +W +D+ Y +LR  +D
Sbjct  29  QVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMD  81

>PHYSO_536424
Length=197

 Score = 47.4 bits (111),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 34/65 (52%), Gaps = 0/65 (0%)

Query  23  GYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSL  82
            +RR    +   Q+VL P P +  +  + +   LA+LE +G  T  +  +W K++ Y SL
Sbjct  12  NWRRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSL  71

Query  83  RAMLD  87
           R  +D
Sbjct  72  RDFMD  76

>PHYSO_507031
Length=197

 Score = 47.4 bits (111),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 34/65 (52%), Gaps = 0/65 (0%)

Query  23  GYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSL  82
            +RR    +   Q+VL P P +  +  + +   LA+LE +G  T  +  +W K++ Y SL
Sbjct  12  NWRRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSL  71

Query  83  RAMLD  87
           R  +D
Sbjct  72  RDFMD  76

>PYIW_18790
Length=86

 Score = 45.1 bits (105),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 32/59 (54%), Gaps = 0/59 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           + VL P P + V     Q   LA+LE QG  T+ + +++ +D  Y +LR  +DD   YK
Sbjct  3   RYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYK  61

>PHYRA_85631
Length=228

 Score = 47.4 bits (111),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
           QVVL P P +  D  D +   LA+LE +G  T  +  SW  ++ Y SLR  +D+
Sbjct  29  QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN  82

>PPTG_10635
Length=199

 Score = 47.0 bits (110),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  +  D +   LA+LE QG  T  + +SW  ++ Y SLR  +D
Sbjct  12  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMD  64

>PHYCA_14368
Length=219

 Score = 47.0 bits (110),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
           Q+VL P P +  +  D +   LA+LE QG  T  +  SW  ++ Y SLR  +D+
Sbjct  29  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDN  82

>PYIR_26626
Length=212

 Score = 47.0 bits (110),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 0/59 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           Q V+ PAP +     +     LA+LE QG  T+ +   ++K   Y +LRA +DD   YK
Sbjct  29  QSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYK  87

>PHYCA_102624
Length=195

 Score = 46.6 bits (109),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
           QVVL P P +  D  D Q   L +LE  G  T  +  +W K++ Y SLR  +D+
Sbjct  29  QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN  82

>PHYCA_14369
Length=248

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  +  D +   LA+LE QG  T  +  +W  ++ Y SLR  +D
Sbjct  29  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMD  81

>PHYSO_341599
Length=185

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  +  + +   LA+LE QG  T  +  +W K++ Y SLR  +D
Sbjct  12  QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMD  64

>PPTG_10636
Length=246

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
           Q+VL P P +  +  D +   LA+LE QG  T  +  SW  ++ Y SLR  +D+
Sbjct  29  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN  82

>PITG_13520
Length=171

 Score = 45.1 bits (105),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +     D +   LA+LE QG  T  + ++W  ++ Y SLR  +D
Sbjct  29  QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMD  81

>PHYRA_84190
Length=206

 Score = 45.1 bits (105),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
           Q+VL P P +  D  D +   LA+LE +G  T  +  +W  ++ Y SLR  +D+
Sbjct  12  QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN  65

>PPTG_10643
Length=250

 Score = 45.1 bits (105),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  +  D +   LA+LE QG     +  +W K++ Y SLR  +D
Sbjct  29  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMD  81

>PPTG_10634
Length=208

 Score = 44.7 bits (104),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
           Q+VL P P +  +  + +   LA+LE +G  T  +  +W K++ Y SLR  LD+
Sbjct  29  QIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDN  82

>PHYKE_8104
Length=86

 Score = 42.4 bits (98),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
           Q+VL P P +  +  D +   LA+LE +G     + ++W +++ Y SLR  +D+
Sbjct  29  QIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDN  82

>PITG_18450
Length=203

 Score = 43.9 bits (102),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVVL P+P Y  D  D +   L +LE QG  T  +   W +++ Y +LR  ++
Sbjct  29  QVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME  81

>PYVX_18179
Length=147

 Score = 42.7 bits (99),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q V+ P P +  +  D     LA+LE+QG  T  +  SW   + Y++LRA +D
Sbjct  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81

>PHYCA_102852
Length=195

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  +  D +   LA+LE +G  T  +  +W  ++ Y SLR  +D
Sbjct  29  QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMD  81

>PYVX_18174
Length=204

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q V+ P P +     D     LA+LE+QG  T  +  +W + + Y +LRA +D
Sbjct  29  QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMD  81

>PYIR_26546
Length=239

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 1/62 (2%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQ-GINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           Q+V+ P P + ++G   Q   +AYLE Q G + + +   ++    + ++R  +D+D LY+
Sbjct  29  QMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKLYR  88

Query  94  AI  95
            +
Sbjct  89  PV  90

>PHYKE_7718
Length=220

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
           Q+VL P P +  D  D +   LA+LE +G     +  +W  ++ Y SLR  +D+
Sbjct  33  QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN  86

>PYIW_18792
Length=125

 Score = 41.2 bits (95),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 29/59 (49%), Gaps = 0/59 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           Q V  PAP + V     Q   LA+LE QG   + +  ++ K   Y +LR  +DD   YK
Sbjct  25  QYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYK  83

>PHYSO_246676
Length=187

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  +    +   LA+LE QG  T  +  +W K++ Y +LR  +D
Sbjct  12  QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMD  64

>PHALS_00498
Length=199

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 0/62 (0%)

Query  27  LEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAML  86
           L   +   Q+VL P P +  +  D +   LA+LE Q   T+ + Q++ K + + +LR  +
Sbjct  21  LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  80

Query  87  DD  88
           D+
Sbjct  81  DN  82

>PHALS_03284
Length=188

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 29/52 (56%), Gaps = 0/52 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAML  86
           Q++L P P +  +  D +   LA+LE Q   TS +   ++K + YNSLR  L
Sbjct  15  QIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFL  66

>PHYSO_499978
Length=174

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  +  + +   LA+LE QG  T  + + W   + Y +LR  +D
Sbjct  29  QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD  81

>PHYSO_501575
Length=174

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q+VL P P +  +  + +   LA+LE QG  T  + + W   + Y +LR  +D
Sbjct  29  QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD  81

>PYVX_18175
Length=147

 Score = 40.4 bits (93),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q V+ P P +     D     LA+LE QG  T  +  +W + + Y +LR+ +D
Sbjct  29  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81

>PHYSO_340369
Length=200

 Score = 37.0 bits (84),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query  34  GQVVLYPAPFYVVDG--LDFQ---GMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
            QVV  PAP +       D Q    M LAY E+QG NTS     W   + + +LR  +D+
Sbjct  25  NQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDN  84

>PPTG_08820
Length=250

 Score = 35.4 bits (80),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (4%)

Query  35  QVVLYPAPFYV--VDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           Q++L P P +   ++  D +   LA+LE QG     +   W     Y +LR  +D
Sbjct  29  QLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMD  83

>PYAP_22278
Length=289

 Score = 35.0 bits (79),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 40/96 (42%), Gaps = 3/96 (3%)

Query  35   QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK-  93
            Q V  PAP +  +  +     LA+LE QG+    ++  +++     +LR  +D+   YK 
Sbjct  26   QRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKI  85

Query  94   AIRWMVLARSTTACVGIHVSLCGTGLESSTSKGFIH  129
              R        T   G    +   G+  ST  G+ H
Sbjct  86   EARGASFECGYTNPNGARQPIPKNGMMRST--GYTH  119

>PHYSO_341596
Length=231

 Score = 34.7 bits (78),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (55%), Gaps = 0/33 (0%)

Query  55  ALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
            LA+LE QG  T  +  SW   + Y SLR  +D
Sbjct  41  PLAFLENQGFETQEDFASWRDKNGYKSLRDFMD  73

>PYAR_24096
Length=227

 Score = 34.3 bits (77),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (47%), Gaps = 0/60 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKA  94
           Q V  P   Y V   +      A LE+QG  T+ +  +++K + Y +LR  +D    YK 
Sbjct  28  QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87

>PYAP_22279
Length=223

 Score = 33.1 bits (74),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 1/59 (2%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93
           Q +  PAP    D  +     LA+LE QG+  + ++  +++     +LR  +D+   YK
Sbjct  23  QRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

>PHYSO_343376
Length=172

 Score = 32.3 bits (72),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 3/65 (5%)

Query  26  RLEAGLGEGQVVLYPAPF---YVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSL  82
           R +A L   +  L   P    +  +  + +   LA+LE QG  T  + ++W   + Y +L
Sbjct  15  RKQASLAAVRAALRGRPVAAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTL  74

Query  83  RAMLD  87
           R  +D
Sbjct  75  RDFMD  79

>PHYSO_527908
Length=174

 Score = 32.0 bits (71),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)

Query  55  ALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDD  88
            LA+LE QG  T      +M D+ Y SLR  +D+
Sbjct  48  PLAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDN  81

>PITG_10499
Length=323

 Score = 32.0 bits (71),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/57 (25%), Positives = 25/57 (44%), Gaps = 4/57 (7%)

Query  31  LGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           +G+ + +  P     ++  D +   LA+LE QG     +   W   + Y  LR  +D
Sbjct  1   MGQPEPIWKPG----INDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMD  53

>PYAP_22273
Length=268

 Score = 31.2 bits (69),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 0/62 (0%)

Query  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKA  94
           Q V +P   Y +          A LE QG  T+ +  +++  + Y +LR  +D    YKA
Sbjct  27  QRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKA  86

Query  95  IR  96
            +
Sbjct  87  NK  88

>PYU1_G001181
Length=942

 Score = 31.2 bits (69),  Expect = 3.0, Method: Composition-based stats.
 Identities = 17/40 (43%), Positives = 20/40 (50%), Gaps = 0/40 (0%)

Query  59   LEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKAIRWM  98
            LE  GI  + E    M D  YNS+ A   DDM+  A  WM
Sbjct  423  LEAHGIVVNDENAETMYDGFYNSVVAATGDDMVRDAKNWM  462

>SDRG_00451
Length=708

 Score = 30.4 bits (67),  Expect = 4.7, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 6/54 (11%)

Query  47   DGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAML-----DDDMLYKAI  95
            +G   + MA+  LE+ G +    VQS+M DH ++ ++A+L     DDD+L + I
Sbjct  478  EGKVLKKMAIESLEDLG-DCLDNVQSYMLDHRFHDMKALLPSPPDDDDVLNEWI  530

>H310_08273
Length=976

 Score = 30.4 bits (67),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 28/52 (54%), Gaps = 4/52 (8%)

Query  25   RRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKD  76
            RR +A +   + VLYP   +VV     + MA A+++  GI T+++     KD
Sbjct  215  RRYKANMEVSRAVLYPLSHFVV----LKDMAHAFVDLNGIPTALQCLKMHKD  262

>SPRG_08646
Length=627

 Score = 30.4 bits (67),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 22/45 (49%), Gaps = 1/45 (2%)

Query  40   PAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRA  84
            P P   V   +   MAL  LEE G++     QS +   AYNSL A
Sbjct  278  PKPLVPVGAANINKMALIKLEELGMDKEAVTQS-VATQAYNSLSA  321

>H257_19273
Length=143

 Score = 29.3 bits (64),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (47%), Gaps = 4/60 (7%)

Query  100  LARSTTACVGIHVSLCGTGLESSTSKGFIHGKSTKTASTSVIKALVSRKETRSRTSVNTQ  159
            + R+T A +  H+SL    LE  T  G +  +  + A+    K    R ET+ R  +N Q
Sbjct  72   IQRTTFALMNFHLSLMPLRLEDETFYGMVLARYERMANEKKRK----RAETQRRYHLNRQ  127

>PHYRA_86151
Length=170

 Score = 29.3 bits (64),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query  42  PFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           P   VD +  Q + L++LE++G  T      +  D+ Y SLR  LD
Sbjct  17  PVTNVDAI--QLVILSFLEKEGFETQENFMQFQVDNGYTSLRDFLD  60

>PYIW_18010
Length=1561

 Score = 30.0 bits (66),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 5/45 (11%)

Query  7     TCVLLLLFGQLFDCIYGYRRLE-----AGLGEGQVVLYPAPFYVV  46
             T V   LF   F  +YG+ + E      G G G+V+ YP P +++
Sbjct  1429  TLVFYYLFMAFFCTLYGWTKTEFYETENGYGAGRVLFYPEPSHLM  1473

>PHYRA_87941
Length=157

 Score = 28.9 bits (63),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query  42  PFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           P   VD +  Q + L++LE++G  T      +  D+ Y SLR  LD
Sbjct  4   PVTNVDAI--QLVILSFLEKEGFETQENFMQFQVDNGYTSLRDFLD  47

>PHYKE_9185
Length=281

 Score = 29.3 bits (64),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (47%), Gaps = 5/58 (9%)

Query  35  QVVLYPAPFYVVDGLDFQGM-----ALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87
           QVV  P+P +       +        L++LE++GI T      +  D+ Y SLR  +D
Sbjct  26  QVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDFMD  83

Lambda      K        H        a         alpha
   0.321    0.134    0.396    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5390221635

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40