Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_06479147551361367251e-99
PHYCA_11834147551341336131e-82
PHYSO_321155147551361366081e-81
PPTG_17126147551361366053e-81
PITG_18455147551321305905e-79
PHYRA_95903147551341335768e-77
PHYKE_8392147551381385707e-76
HYAP_07103147551641645042e-65
PYVX_18180147551351304362e-55
PYAP_17747147551341344032e-50
PYU1_G001736147551231253473e-42
PYIW_19970147551301223381e-40
CCA17542147551201213335e-40
CCI44820147551231253241e-38
PYIR_13454147551291273042e-35
SDRG_01782147551231222851e-32
H257_06293147551231232797e-32
H310_09224147551231232736e-31
SPRG_06335147551231222702e-30
PITG_1373911147105621126e-07
PHYSO_31501711147109621083e-06
PPTG_0925211147105621073e-06
PHYKE_584111147121601066e-06
HYAP_0849911147108661049e-06
HYAP_0850065260172661042e-05
PHALS_1156411147107621003e-05
PHYRA_816751114710662961e-04
PHYCA_5353801114710862933e-04
PYVX_208541114710458933e-04
CCA175211114710454915e-04
CCI442321114710589917e-04
PYAP_2284611147104102909e-04
PYAR_232071114711260900.001
PYIW_147431114710560890.001
PYIR_151861114710960900.001
PYU1_G0059631114710360890.001
H310_07567111479854830.008
SDRG_149121114710561820.012
SPRG_128831114710561820.013
PHYRA_8260711574185473830.028
PHYRA_751931416310465790.030
H257_07358111479854790.033
PYIW_142931416310457760.088
PYAP_248671340314770730.31
SPRG_1173112822943181720.71
CCA240562362427061730.72
PHYCA_5404611416310466680.93
PYAR_212891340311871681.4
PYU1_G0005451192611580671.8
PYIR_182231416310570662.0
H257_116807939116119662.3
PHYRA_82886128896100064682.4
PYVX_18358141636254632.6
PYVX_151505606474645682.9
PHALS_00343295789253643.1
PHYSO_5143231416310466643.7
PPTG_156551416311266643.7
PITG_1417511499284956664.6
PITG_177011416310466634.8
PHALS_087661416310339635.0
SDRG_0686812822954881656.2
PHALS_1024416792156763648.3
PYAR_21749141639248619.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_06479

Length=136
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHALS_06479                                                           283        1e-99
PHYCA_11834                                                           240        1e-82
PHYSO_321155                                                          238        1e-81
PPTG_17126                                                            237        3e-81
PITG_18455                                                            231        5e-79
PHYRA_95903                                                           226        8e-77
PHYKE_8392                                                            224        7e-76
HYAP_07103                                                            198        2e-65
PYVX_18180                                                            172        2e-55
PYAP_17747                                                            159        2e-50
PYU1_G001736                                                          138        3e-42
PYIW_19970                                                            134        1e-40
CCA17542                                                              132        5e-40
CCI44820                                                              129        1e-38
PYIR_13454                                                            121        2e-35
SDRG_01782                                                            114        1e-32
H257_06293                                                            112        7e-32
H310_09224                                                            109        6e-31
SPRG_06335                                                            108        2e-30
PITG_13739                                                            47.8       6e-07
PHYSO_315017                                                          46.2       3e-06
PPTG_09252                                                            45.8       3e-06
PHYKE_5841                                                            45.4       6e-06
HYAP_08499                                                            44.7       9e-06
HYAP_08500                                                            44.7       2e-05
PHALS_11564                                                           43.1       3e-05
PHYRA_81675                                                           41.6       1e-04
PHYCA_535380                                                          40.4       3e-04
PYVX_20854                                                            40.4       3e-04
CCA17521                                                              39.7       5e-04
CCI44232                                                              39.7       7e-04
PYAP_22846                                                            39.3       9e-04
PYAR_23207                                                            39.3       0.001
PYIW_14743                                                            38.9       0.001
PYIR_15186                                                            39.3       0.001
PYU1_G005963                                                          38.9       0.001
H310_07567                                                            36.6       0.008
SDRG_14912                                                            36.2       0.012
SPRG_12883                                                            36.2       0.013
PHYRA_82607                                                           36.6       0.028
PHYRA_75193                                                           35.0       0.030
H257_07358                                                            35.0       0.033
PYIW_14293                                                            33.9       0.088
PYAP_24867                                                            32.7       0.31 
SPRG_11731                                                            32.3       0.71 
CCA24056                                                              32.7       0.72 
PHYCA_540461                                                          30.8       0.93 
PYAR_21289                                                            30.8       1.4  
PYU1_G000545                                                          30.4       1.8  
PYIR_18223                                                            30.0       2.0  
H257_11680                                                            30.0       2.3  
PHYRA_82886                                                           30.8       2.4  
PYVX_18358                                                            28.9       2.6  
PYVX_15150                                                            30.8       2.9  
PHALS_00343                                                           29.3       3.1  
PHYSO_514323                                                          29.3       3.7  
PPTG_15655                                                            29.3       3.7  
PITG_14175                                                            30.0       4.6  
PITG_17701                                                            28.9       4.8  
PHALS_08766                                                           28.9       5.0  
SDRG_06868                                                            29.6       6.2  
PHALS_10244                                                           29.3       8.3  
PYAR_21749                                                            28.1       9.5  

>PHALS_06479
Length=136

 Score = 283 bits (725),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)

Query  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60
            MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS
Sbjct  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60

Query  61   LSYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLR  120
            LSYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLR
Sbjct  61   LSYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLR  120

Query  121  RQYFMDRKSGPPRPIF  136
            RQYFMDRKSGPPRPIF
Sbjct  121  RQYFMDRKSGPPRPIF  136

>PHYCA_11834
Length=134

 Score = 240 bits (613),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 122/133 (92%), Gaps = 0/133 (0%)

Query  4    ATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSY  63
            A RELRPLYKKLLRLAQ+LP+ KRQ+SIDQIRREFR HEDLTDPKEVS+ +QRAQSSL Y
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61

Query  64   LKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQY  123
            LKI+TPR ESNTGVQRFIYR+G+RVNA + E KG ENARWKTQDMEAG KRHHQLLRRQY
Sbjct  62   LKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQY  121

Query  124  FMDRKSGPPRPIF  136
            FMDRKSGPPRPIF
Sbjct  122  FMDRKSGPPRPIF  134

>PHYSO_321155
Length=136

 Score = 238 bits (608),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 123/136 (90%), Gaps = 0/136 (0%)

Query  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60
            M+ A RELRPLYKKLLRLAQ+LP+ KR+ S+DQIRREFR H DLTDP+ VS  IQRAQSS
Sbjct  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60

Query  61   LSYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLR  120
            LSYLKI+TPR ESNTGVQRFIYRNGQRVNAA+FE KG ENAR+KTQD+EAG KRHHQLLR
Sbjct  61   LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLR  120

Query  121  RQYFMDRKSGPPRPIF  136
            RQYFMDRKSGPPRPIF
Sbjct  121  RQYFMDRKSGPPRPIF  136

>PPTG_17126
Length=136

 Score = 237 bits (605),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)

Query  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60
            M+ A RELRPLYKKLLRLAQ+LP+ KRQSSIDQIRR+FR H DLTDP+EVS  IQRAQSS
Sbjct  1    MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60

Query  61   LSYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLR  120
            LSYLKI+TPR ESN GVQR+IYRNGQRVNA +FE+KG ENARWKTQDME G +RHHQLLR
Sbjct  61   LSYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLR  120

Query  121  RQYFMDRKSGPPRPIF  136
            RQYF+DRKSGPPRPIF
Sbjct  121  RQYFLDRKSGPPRPIF  136

>PITG_18455
Length=132

 Score = 231 bits (590),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)

Query  7    ELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKI  66
            ELRPLYKKLLRLAQ+LP+ KRQSSIDQIRR+FR H D TDPKEVS  IQRAQSSLSYLKI
Sbjct  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62

Query  67   ITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMD  126
            +TPR ESNTGVQR+IYRNGQRVNAA+FE+KG ENARWK QDME G KRHHQLL+RQYFM+
Sbjct  63   VTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMN  122

Query  127  RKSGPPRPIF  136
            RKSGPPRPIF
Sbjct  123  RKSGPPRPIF  132

>PHYRA_95903
Length=134

 Score = 226 bits (576),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)

Query  4    ATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSY  63
            A RELRPLYKKLLRLAQ+LP+ KRQ S+DQIRREFR HE+LTDPKEVS  IQRAQSSL Y
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61

Query  64   LKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQY  123
            LKI+TPR ESN G+QR+IYRNGQRVNA + E  G ENAR+KTQD+E G KRHHQLLRRQ+
Sbjct  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121

Query  124  FMDRKSGPPRPIF  136
            FMDRKSGPPRPIF
Sbjct  122  FMDRKSGPPRPIF  134

>PHYKE_8392
Length=138

 Score = 224 bits (570),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 122/138 (88%), Gaps = 2/138 (1%)

Query  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60
            M+ A RELRPLYKKLLR+AQ LP+ KR  S+ QIRREFR H DL+DPKEVS+ +Q AQSS
Sbjct  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSS  60

Query  61   LSYLKIITPR--TESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQL  118
            LSYLKI+TPR  TESN+GVQR+IYRNGQRVNAA+ E+KG ENAR+KTQDMEAG KRHHQL
Sbjct  61   LSYLKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120

Query  119  LRRQYFMDRKSGPPRPIF  136
            +RRQ+FMDRKSGPPRP+F
Sbjct  121  MRRQHFMDRKSGPPRPMF  138

>HYAP_07103
Length=164

 Score = 198 bits (504),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 118/164 (72%), Gaps = 35/164 (21%)

Query  8    LRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKII  67
            +RPLYKKLLRLAQ+LP+ KRQ S+DQIRREFR H DLTDPKEVS  +QRAQSS+ +LKI+
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  68   TPRTES-----------------------------------NTGVQRFIYRNGQRVNAAD  92
            TPR ES                                   +TG+QRF+YR+G+R++AA+
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  93   FEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMDRKSGPPRPIF  136
             +KKG ENAR+KTQD+EAG KRHHQLLRRQ+FMDRKSGPPRPIF
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PYVX_18180
Length=135

 Score = 172 bits (436),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 102/130 (78%), Gaps = 0/130 (0%)

Query  7    ELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKI  66
            ELRPLYKKLLRLAQ+LP+ KR S++ QIR EFR H ++TD  EV++ +QRAQS L YLKI
Sbjct  6    ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKI  65

Query  67   ITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMD  126
            +TPR  S +GV+R+IYRNGQRV+A   E  G + AR+KT DME   KRHHQLLRRQ+FMD
Sbjct  66   VTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMD  125

Query  127  RKSGPPRPIF  136
            R   PPRPIF
Sbjct  126  RGVAPPRPIF  135

>PYAP_17747
Length=134

 Score = 159 bits (403),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 104/134 (78%), Gaps = 2/134 (1%)

Query  4    ATRELRPLYKKLLRLAQNLP-QSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLS  62
            AT ELRPLYK+LLRLA++LP + KR++++ QIR EFR  +D  DPKEV+  +QRAQ+ + 
Sbjct  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61

Query  63   YLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQ  122
            YLKI+TPR+ ++ GV+ F+Y NG+RV+++D + +  E AR+KT D E   +RH+QLLRRQ
Sbjct  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRRQ  120

Query  123  YFMDRKSGPPRPIF  136
            +FMDR   PP+PIF
Sbjct  121  HFMDRGVAPPKPIF  134

>PYU1_G001736
Length=123

 Score = 138 bits (347),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 3/125 (2%)

Query  4    ATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSY  63
            A+ +LRP+YKKLL+LAQ LP  KRQ++++QIRREFR H    DPKE++  + RAQSS+ Y
Sbjct  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61

Query  64   LKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQY  123
            LKI+TPR  S+ GV+ ++Y  G+RV A        + AR+KT D  A  +RH QLLRRQ+
Sbjct  62   LKIVTPRATSDAGVKNYVYIKGKRVEA---AGAAEDGARYKTADYNAQMQRHVQLLRRQH  118

Query  124  FMDRK  128
            FMDRK
Sbjct  119  FMDRK  123

>PYIW_19970
Length=130

 Score = 134 bits (338),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 91/122 (75%), Gaps = 3/122 (2%)

Query  7    ELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKI  66
            +LRP+YKKLL+LA+ LP+ KR+++  QIR EFR  ++L+DPKE++  + RAQSS+SYLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  67   ITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMD  126
            +TPR  S+ GV+ +IY+NGQRV AA   + G   A+++  D      RH +LLRRQ+FMD
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHFMD  128

Query  127  RK  128
            RK
Sbjct  129  RK  130

>CCA17542
Length=120

 Score = 132 bits (333),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 92/121 (76%), Gaps = 3/121 (2%)

Query  7    ELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKI  66
            + R +YK+L+RLA++LP  K+ +++  IR EFR H D++DP ++S+ ++RAQS++ YLKI
Sbjct  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62

Query  67   ITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMD  126
            +TP   S++GV+RF++++G+R+       K +E AR+K QD+  G KRHHQLLRRQ+FMD
Sbjct  63   VTPHKRSDSGVKRFMFKDGERIEE---NLKASERARFKVQDIGEGLKRHHQLLRRQHFMD  119

Query  127  R  127
            R
Sbjct  120  R  120

>CCI44820
Length=123

 Score = 129 bits (324),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 91/125 (73%), Gaps = 3/125 (2%)

Query  3    NATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLS  62
             A  E R ++KK+++LA++LP  K+  ++  IR EFR H D+ DP ++++ ++RAQS++ 
Sbjct  2    TAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIG  61

Query  63   YLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQ  122
            YLKI+TP   S++GV+ F+Y++G+R+  +    +  E A++K QDME G KRH+QL+RRQ
Sbjct  62   YLKIVTPHKRSDSGVKHFVYKDGERIEKS---LQAGEKAKFKVQDMEEGLKRHNQLIRRQ  118

Query  123  YFMDR  127
            YFMDR
Sbjct  119  YFMDR  123

>PYIR_13454
Length=129

 Score = 121 bits (304),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query  2    SNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSL  61
            + A  +LRP+YKKLL+LA+ LP+ KR +++ QIR EFR  +D++DPKE++  + RAQSS+
Sbjct  6    AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65

Query  62   SYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRR  121
             YLKI+TPR  S+ GV+ +IY+NGQRV A    + G   A++   D  A  +RH +LLRR
Sbjct  66   GYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNAQMQRHQKLLRR  122

Query  122  QYFMDRK  128
            Q+FMDRK
Sbjct  123  QHFMDRK  129

>SDRG_01782
Length=123

 Score = 114 bits (285),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 85/122 (70%), Gaps = 4/122 (3%)

Query  8    LRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKII  67
            +R  YKKLL+LA+++PQ +R  +++++R EFR HE    P+E+ + +++AQS +SYLKI+
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIV  64

Query  68   TP-RTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMD  126
            TP ++ S+T    F+Y+NGQR++  +      ++A  KT D  A   +H QL+RRQ+FMD
Sbjct  65   TPKKSSSSTQGSHFVYKNGQRIDGREL---SADSATIKTHDYNAMMTKHVQLVRRQHFMD  121

Query  127  RK  128
            RK
Sbjct  122  RK  123

>H257_06293
Length=123

 Score = 112 bits (279),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 86/123 (70%), Gaps = 2/123 (2%)

Query  6    RELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLK  65
            + +R  YKKL++LAQ+LP  ++ +++D+IR +FR    ++  +E+ + + +AQS +SYLK
Sbjct  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62

Query  66   IITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFM  125
            I+TP+    +G QRFIY++G+R+++   +  GN     KT D+ A  +RH +L+RRQ+FM
Sbjct  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRT--IKTTDVNAMMERHVKLIRRQHFM  120

Query  126  DRK  128
            DRK
Sbjct  121  DRK  123

>H310_09224
Length=123

 Score = 109 bits (273),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 84/123 (68%), Gaps = 2/123 (2%)

Query  6    RELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLK  65
            + +R  YKKL++LAQ+LP  ++  ++D++R EFR H  +T   ++ + + +AQS +SYLK
Sbjct  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62

Query  66   IITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFM  125
            I+TP+    T  QR+IY++G+R++    ++  + NA  KT D  A  +RH +L+RRQ+FM
Sbjct  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFM  120

Query  126  DRK  128
            DRK
Sbjct  121  DRK  123

>SPRG_06335
Length=123

 Score = 108 bits (270),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 82/122 (67%), Gaps = 4/122 (3%)

Query  8    LRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKII  67
            +R  YKKLL+LA+++PQ +R  +++++R EFR H     P+E+ + +++AQS +SYLKI+
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIV  64

Query  68   TPRTESNTG-VQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMD  126
            TP+   + G    F+Y+NGQR++  +      ++A  KT D  A   +H QL+RRQ+FMD
Sbjct  65   TPKKSPSPGQGNHFVYKNGQRIDGREL---SADSATIKTADYNAMMTKHVQLVRRQHFMD  121

Query  127  RK  128
            RK
Sbjct  122  RK  123

>PITG_13739
Length=105

 Score = 47.8 bits (112),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%), Gaps = 0/62 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           TRE+  +Y+++L+LAQ  P  KR+S I  I+ EF  ++DLTD +++ E +   ++ ++ L
Sbjct  4   TREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGITEL  63

Query  65  KI  66
            +
Sbjct  64  SM  65

>PHYSO_315017
Length=109

 Score = 46.2 bits (108),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 40/62 (65%), Gaps = 0/62 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           T+E+  +Y+++L+LAQ  P  KR+S I  I+ EF  ++DLTD +++ E +   ++ +  L
Sbjct  4   TKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGIKEL  63

Query  65  KI  66
            +
Sbjct  64  SM  65

>PPTG_09252
Length=105

 Score = 45.8 bits (107),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 41/62 (66%), Gaps = 0/62 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           T+E+  LY+++L+LAQ  P  KR+S I  I+ EF  +++LTD +++ E +   ++ ++ L
Sbjct  4   TKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITEL  63

Query  65  KI  66
            +
Sbjct  64  SM  65

>PHYKE_5841
Length=121

 Score = 45.4 bits (106),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (62%), Gaps = 0/60 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
            +E+  +Y+++L+LAQ  P  KR S I  I+ EF  H+ LTD +++ E +  A++ +  L
Sbjct  4   VKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGIKEL  63

>HYAP_08499
Length=108

 Score = 44.7 bits (104),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%), Gaps = 1/66 (2%)

Query  1   MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60
           M+ A   LR +Y+++L+LAQ  P  KRQS I  I+ EFR + +L+D ++V + +   Q+ 
Sbjct  1   MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAG  59

Query  61  LSYLKI  66
           +  L +
Sbjct  60  IKELSM  65

>HYAP_08500
Length=172

 Score = 44.7 bits (104),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%), Gaps = 1/66 (2%)

Query  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60
            M+ A   LR +Y+++L+LAQ  P  KRQS I  I+ EFR + +L+D ++V + +   Q+ 
Sbjct  65   MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAG  123

Query  61   LSYLKI  66
            +  L +
Sbjct  124  IKELSM  129

>PHALS_11564
Length=107

 Score = 43.1 bits (100),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 39/62 (63%), Gaps = 0/62 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           T+++  +Y++LL+LAQ+ P  KR++ I  I+ EF  +  +TD +++ E +  A + +  L
Sbjct  4   TKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKEL  63

Query  65  KI  66
            +
Sbjct  64  SM  65

>PHYRA_81675
Length=106

 Score = 41.6 bits (96),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 0/62 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           T+E+  +Y+++L+LAQ  P  KR S I  I+ EF  ++ LTD +++ E +   ++ +  L
Sbjct  4   TKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGIKEL  63

Query  65  KI  66
            +
Sbjct  64  SM  65

>PHYCA_535380
Length=108

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 37/62 (60%), Gaps = 0/62 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           T+E+  +Y+++L+LA   P  KR+S I  I+ EF  ++ LTD + + E +   ++ +  L
Sbjct  4   TKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGIKEL  63

Query  65  KI  66
            +
Sbjct  64  SM  65

>PYVX_20854
Length=104

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 0/58 (0%)

Query  7   ELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           E+  LY+++L+LAQ  P  KR S +  I+ EF  ++ L+D ++V E I  A++ +  L
Sbjct  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>CCA17521
Length=104

 Score = 39.7 bits (91),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  11  LYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           LY+++LRLA+  P  KR + I+ IR EFR   D+T    +   I  A + +  L
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKEL  62

>CCI44232
Length=105

 Score = 39.7 bits (91),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 8/89 (9%)

Query  11  LYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKI---I  67
           LY+++LRLA+  P  KR + ++ IR EFR   ++  P  + + I  A + +  L +   +
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKELMMYANL  68

Query  68  TPRTESNTGVQRFIYRNGQRVNAADFEKK  96
            P  E+N  V+  I R  ++  AAD ++K
Sbjct  69  NP-VEANWTVE--IGRPSEK--AADIDQK  92

>PYAP_22846
Length=104

 Score = 39.3 bits (90),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 4/102 (4%)

Query  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60
            M++  + LR LY+ +L+LA+  P  KR + I  I+ EF   +  TD + +   I  AQ+ 
Sbjct  1    MADKQKVLR-LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAG  59

Query  61   LSYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENAR  102
            +  L +      S+T    +    G+ V+    +  G+ N +
Sbjct  60   IKELSMYATLNPSSTA---WTVGVGREVSPEATQAAGDTNTK  98

>PYAR_23207
Length=112

 Score = 39.3 bits (90),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 0/60 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           +RE+  LY+++L+LA+  P  KR + ++ I+ EF   + LTD   +   I  AQ+ +  L
Sbjct  7   SREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

>PYIW_14743
Length=105

 Score = 38.9 bits (89),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 36/60 (60%), Gaps = 0/60 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
            +E+  LY+++L+LA   P  KR + I +I+ EF  ++ LTD  ++ + +Q A+  +  L
Sbjct  4   AKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQGIVEL  63

>PYIR_15186
Length=109

 Score = 39.3 bits (90),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 0/60 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
            +E+  +Y+++L+LA   P  KR + I +I+ EF  ++ LTD  ++ + +Q A+  +  L
Sbjct  4   AKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQGIVEL  63

>PYU1_G005963
Length=103

 Score = 38.9 bits (89),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 34/60 (57%), Gaps = 0/60 (0%)

Query  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
            +E+  +Y+++L+LA   P  KR + I  I+ EFR ++ LTD   +   +Q A+  +  L
Sbjct  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63

>H310_07567
Length=98

 Score = 36.6 bits (83),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 0/54 (0%)

Query  11  LYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           +Y+++L+LA+  P  KR   ++ I+ EF  ++ LTDP ++ E +  A   +  L
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGIQQL  63

>SDRG_14912
Length=105

 Score = 36.2 bits (82),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 0/61 (0%)

Query  4   ATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSY  63
           A R +  +Y+++L+LAQ  P  K+   +  I+ EF  +  LTD  ++ E I  A   +  
Sbjct  2   AGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQ  61

Query  64  L  64
           L
Sbjct  62  L  62

>SPRG_12883
Length=105

 Score = 36.2 bits (82),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 0/61 (0%)

Query  4   ATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSY  63
           A R +  +Y+++L+LAQ  P  K+   +  I+ EF  +  LTD  ++ E I  A   +  
Sbjct  2   AGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQ  61

Query  64  L  64
           L
Sbjct  62  L  62

>PHYRA_82607
Length=1854

 Score = 36.6 bits (83),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (51%), Gaps = 9/73 (12%)

Query  71   TESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYK--------RHHQLLRRQ  122
            T +  GV   ++R G +     F   GN    +++++ E G +        RH Q++ R+
Sbjct  49   TATEFGVDYEVFRTGPKFQGVKFLPLGNHFVLFRSREQEHGIRQGFFINVERHAQVIVRE  108

Query  123  YFMDRKS-GPPRP  134
            + M+++  GPPRP
Sbjct  109  WSMEKEELGPPRP  121

>PHYRA_75193
Length=104

 Score = 35.0 bits (79),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 3/65 (5%)

Query  5   TRELRPLYKKLLRLAQNLP-QSKRQSSI-DQIRREFRCHEDLTDPKEVSEFIQRAQSSLS  62
           TR    LY+  +RLAQ++   SK+  +I D +RREF    D TDP++V      A   LS
Sbjct  8   TRTTIQLYRDCMRLAQHIGGNSKKGQAIKDLVRREFAKGRDETDPEKVEALKANAIRGLS  67

Query  63  -YLKI  66
            YL +
Sbjct  68  NYLML  72

>H257_07358
Length=98

 Score = 35.0 bits (79),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  11  LYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64
           +Y+++L+LA   P  K++  +  I+ EF  ++ LTDP ++ E I  A   +  L
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGIQQL  63

>PYIW_14293
Length=104

 Score = 33.9 bits (76),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 3/57 (5%)

Query  11  LYKKLLRLAQNLP-QSKRQSSI-DQIRREFRCHEDLTDPKEVSEFIQRAQSSLS-YL  64
           LY+  +RLA+++   SK+ S+I D IRREF    D TDP+++      A   LS YL
Sbjct  13  LYRDCMRLAKHIGGTSKKGSAIKDLIRREFEKARDETDPEKIEALKTNAIRGLSNYL  69

>PYAP_24867
Length=147

 Score = 32.7 bits (73),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query  12  YKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKIITPRT  71
           Y + LR+ Q L +  R+    QIR  F  +  + D K+V +FI++ +  L +   ++   
Sbjct  26  YHEFLRITQPLAEDTRRDVRQQIRAAFDMYRHVEDEKQVMQFIRQGREQLKH---VSDLV  82

Query  72  ESNTGVQRFI  81
           +S    QR +
Sbjct  83  DSAVARQRVV  92

>SPRG_11731
Length=431

 Score = 32.3 bits (72),  Expect = 0.71, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query  2    SNATRELRPLYKKLLRLAQNLPQ---SKRQSSIDQIRRE-FRCHEDLTDPKEVSEFIQRA  57
            S A +  RPL K  L L   L Q    KR ++   ++ E FR H  L DP  VS +I   
Sbjct  294  SKAEKRKRPLPKGFLELLDKLLQIDPKKRFNAEQALQSEYFRSHPHLQDPATVSTWIPTI  353

Query  58   QSSLSYLKIITPRTESNTGVQ  78
             S+ S  ++ T + +  +G Q
Sbjct  354  TSA-SCHEMATRKAKKESGAQ  373

>CCA24056
Length=4270

 Score = 32.7 bits (73),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 27/61 (44%), Gaps = 4/61 (7%)

Query  60    SLSYLKIITPRTESNTGVQRFI----YRNGQRVNAADFEKKGNENARWKTQDMEAGYKRH  115
             S+  L ++ P+ ES   V   +    YR G R++A        +N R K+ D E     H
Sbjct  2039  SMEQLSMVVPKQESKDSVDEILGPVRYREGSRLDATQVPNDAKQNWRSKSTDAEKDPAFH  2098

Query  116   H  116
             H
Sbjct  2099  H  2099

>PHYCA_540461
Length=104

 Score = 30.8 bits (68),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  4   ATRELRPLYKKLLRLAQNLP-QSKRQSSI-DQIRREFRCHEDLTDPKEVSEFIQRAQSSL  61
            TR    LY+  LRLA+++   SK+  +I D +RREF      TDP+++      A   L
Sbjct  7   VTRTTIQLYRDCLRLAKHIGGNSKKGQAIKDLVRREFDKGRSETDPEKIEALKANAVRGL  66

Query  62  S-YLKI  66
           S YL +
Sbjct  67  SNYLML  72

>PYAR_21289
Length=118

 Score = 30.8 bits (68),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/71 (24%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query  12  YKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKIITPRT  71
           YK+  R+ Q L  + R+   +QIR  +  +  + D K+V+ F+++ +  L +   ++   
Sbjct  27  YKEFWRITQPLDDATRRDVREQIRAGYELYRHVDDEKQVALFLRQGREQLKH---VSDLV  83

Query  72  ESNTGVQRFIY  82
           +S    QR ++
Sbjct  84  DSAVARQRVVH  94

>PYU1_G000545
Length=115

 Score = 30.4 bits (67),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 18/80 (23%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query  1   MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREF-RCHEDLTDPKEVSEFIQRAQS  59
           M++  +++  LY++LLR+A+  P+    + +    RE  R   D T   ++++F+Q  + 
Sbjct  1   MASTKQQVLQLYRELLRVARAFPERSMGAKLQYNTRELIRLRRDETSATKIAQFLQEGRD  60

Query  60  SLSYLKIITPRTESNTGVQR  79
           +L   +++       T + R
Sbjct  61  TLRMYQLLQEEPSVLTAITR  80

>PYIR_18223
Length=105

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 39/70 (56%), Gaps = 6/70 (9%)

Query  1   MSNATRELRP---LYKKLLRLAQNLP-QSKRQSSIDQ-IRREFRCHEDLTDPKEVSEFIQ  55
           MS +T+  R    LY+  +RLA+++  +SK+  +I   +RREF    D TDP+++     
Sbjct  1   MSGSTKVSRTSLQLYRDCMRLAKHIGGKSKKGIAIKSLVRREFEKARDETDPEKIEALKT  60

Query  56  RAQSSLS-YL  64
            A   LS YL
Sbjct  61  NAIRGLSNYL  70

>H257_11680
Length=116

 Score = 30.0 bits (66),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 52/119 (44%), Gaps = 18/119 (15%)

Query  1    MSNATRELRPLYKKLLRLAQNL--PQSKRQSSIDQIRREFRCHEDLTDPKEVSEFI----  54
            MS+A+     LY+++LR+A+    P+ +R     + RR+F  +  L    EV   I    
Sbjct  1    MSSASSRALALYRRILRVARTWEGPEKERLYIKQEARRQFEGNRQLRRMDEVENAILQGE  60

Query  55   QRAQSSLSYLKIITPR--------TESNTGVQRFIYRNGQRVNAADFEKKGNENA-RWK  104
            QR +  L Y KI  PR           +   QR    N  +      EKK + NA +WK
Sbjct  61   QRLEVGLHY-KIPYPRPMYADPGTVGGDNNFQR--QSNRHKAKGGQLEKKSSLNAFKWK  116

>PHYRA_82886
Length=1000

 Score = 30.8 bits (68),  Expect = 2.4, Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query  11   LYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKIITPR  70
             +K++LR      + KR+  I Q R+++   E      E SEF+++ QSS++ L+     
Sbjct  488  FFKEVLR------ECKRRKLISQRRKDYWKSEAFKVNVENSEFVRKIQSSIAQLENRVSV  541

Query  71   TESN  74
            TE N
Sbjct  542  TERN  545

>PYVX_18358
Length=62

 Score = 28.9 bits (63),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (4%)

Query  11  LYKKLLRLAQNLP-QSKRQSSI-DQIRREFRCHEDLTDPKEVSEFIQRAQSSLS  62
           LY+  LRLA+++  +SK+  +I + +RREF      TDP+++      A   LS
Sbjct  1   LYRDCLRLAKHIGGKSKKGEAIRELVRREFEKGRAETDPEKIEALKANAIRGLS  54

>PYVX_15150
Length=746

 Score = 30.8 bits (68),  Expect = 2.9, Method: Composition-based stats.
 Identities = 13/45 (29%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query  38   FRCHEDLTDPKEVSEFIQ--RAQSSLSYLKIITPRTESNTGVQRF  80
            FR   D ++   V   ++  R+  SL YL ++ PR + +  ++RF
Sbjct  614  FRSEADTSESGRVEGILEMLRSNCSLQYLSLVMPREQHDASLERF  658

>PHALS_00343
Length=92

 Score = 29.3 bits (64),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 0/53 (0%)

Query  22  LPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKIITPRTESN  74
           L  + RQ S+    + F CH  +   KE+   +   Q ++ +L   TPR   N
Sbjct  37  LKDAGRQESLMSNNKGFGCHLYVQGTKEICTELTLVQCNVGFLATPTPRMRIN  89

>PHYSO_514323
Length=104

 Score = 29.3 bits (64),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  4   ATRELRPLYKKLLRLAQNLP-QSKRQSSIDQ-IRREFRCHEDLTDPKEVSEFIQRAQSSL  61
            TR    LY+  +RLA+++   SK+  +I + +RREF      TDP+++      A   L
Sbjct  7   VTRTTIQLYRDCMRLAKHIGGNSKKGQAIKELVRREFEKGRSETDPEKIEALKANAVRGL  66

Query  62  S-YLKI  66
           S YL +
Sbjct  67  SNYLML  72

>PPTG_15655
Length=112

 Score = 29.3 bits (64),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  4   ATRELRPLYKKLLRLAQNLP-QSKRQSSIDQ-IRREFRCHEDLTDPKEVSEFIQRAQSSL  61
            TR    LY+  LRLA+++   SK+  +I + +RREF      TDP+++      A   L
Sbjct  15  VTRTTIQLYRDCLRLAKHIGGNSKKGQAIKELVRREFDKGRSETDPEKIEALKANAVRGL  74

Query  62  S-YLKI  66
           S YL +
Sbjct  75  SNYLML  80

>PITG_14175
Length=2849

 Score = 30.0 bits (66),  Expect = 4.6, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 33/56 (59%), Gaps = 1/56 (2%)

Query  46   DPKEVSEFIQRAQSSLSYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENA  101
            + K+ +E +Q+ + S++  KI+  R+ S TG+ ++  RN + ++ AD      ENA
Sbjct  449  EKKDRNEKLQKLEKSMTLNKILKLRSRS-TGLAKYYRRNQKELSLADHTAIVQENA  503

>PITG_17701
Length=104

 Score = 28.9 bits (63),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  4   ATRELRPLYKKLLRLAQNLP-QSKRQSSI-DQIRREFRCHEDLTDPKEVSEFIQRAQSSL  61
            TR    LY+  LRLA+++   SK+  +I + +RREF      TDP+++      A   L
Sbjct  7   VTRTTIQLYRDCLRLAKHIGGNSKKGQAIRELVRREFDKGRSETDPEKIEALKANAVRGL  66

Query  62  S-YLKI  66
           S YL +
Sbjct  67  SNYLML  72

>PHALS_08766
Length=103

 Score = 28.9 bits (63),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  2   SNATRELRPLYKKLLRLAQNL-PQSKRQSSI-DQIRREF  38
           S  TR  + LY+  LRLA+++   SK+  +I D IRREF
Sbjct  4   SQVTRSTKQLYRDCLRLAKHIGGNSKKGQAIKDLIRREF  42

>SDRG_06868
Length=548

 Score = 29.6 bits (65),  Expect = 6.2, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query  2    SNATRELRPLYKKLLRLAQNLPQ---SKRQSSIDQIRRE-FRCHEDLTDPKEVSEFIQRA  57
            S A +  RPL K  L L   L Q    KR ++   ++ E FR H  L DP  VS +I   
Sbjct  292  SKAEKRKRPLPKGFLELLDKLLQIDPKKRFNAEQALQSEYFRSHPYLQDPATVSTWIPTI  351

Query  58   QSSLSYLKIITPRTESNTGVQ  78
             S+ S  ++ T + +  +G Q
Sbjct  352  TSA-SCHEMATRKAKKESGAQ  371

>PHALS_10244
Length=1567

 Score = 29.3 bits (64),  Expect = 8.3, Method: Composition-based stats.
 Identities = 20/63 (32%), Positives = 30/63 (48%), Gaps = 15/63 (24%)

Query  15   LLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEV----------SEFIQRAQSSLSYL  64
            LLRLAQ+L +   +S++D+I    R     +DPK              F +R  +  SYL
Sbjct  618  LLRLAQHLAEQDDESAVDKIHLVLR-----SDPKNARYWVILAHIYQHFGKRVSAQRSYL  672

Query  65   KII  67
            + I
Sbjct  673  RAI  675

>PYAR_21749
Length=92

 Score = 28.1 bits (61),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query  5   TRELRPLYKKLLRLAQNLPQS--KRQSSIDQIRREFRCHEDLTDPKEV  50
           TR    LY+  +RLA+++  +  K Q+  D IRREF      TDP+++
Sbjct  8   TRTSIQLYRDCMRLAKHIGGTSKKGQAIRDLIRREFDKGRSETDPEKI  55

Lambda      K        H        a         alpha
   0.319    0.133    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3387843954

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40