Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_064781475634534517670.0
PPTG_171271475635135114280.0
PITG_184561475635135114150.0
PHYSO_4715231475634834813850.0
PHYRA_811001475634934913810.0
PHYCA_5561621475635135113640.0
PHYKE_83931475632635111187e-153
PYU1_G001735147563423528411e-110
PYIR_13451147563593678292e-108
PYAP_17762147563483648239e-108
PYIW_19971147563483627333e-94
PYVX_18171147562943317014e-90
PYAR_13570147563223236583e-83
CCA18899147563433406342e-79
CCI45123147563013115023e-60
SPRG_06336147563353374732e-55
SDRG_01781147563353334366e-50
H310_09223147563333383712e-40
H257_06294147563583603644e-39
CCI451271609872022042477e-24
PYAR_23286161286071221393e-08
HYAP_086451612815141171323e-07
PHYSO_3617471612815231171305e-07
PHYRA_849161612815411151306e-07
PYIW_17381161289521301296e-07
PYIR_215891612815681361297e-07
CCI39367288520461211271e-06
PHYKE_19901612814991151261e-06
PYU1_G0063471612810951151252e-06
H310_002311612814951081242e-06
PYVX_204381612813461361243e-06
H257_067221612814821151234e-06
PPTG_188981612815591151225e-06
SPRG_0605912510913121081216e-06
PITG_205621612815591151216e-06
SPRG_060581612812581371209e-06
SDRG_1276312510913171081191e-05
CCI447521612815261151191e-05
PYAP_169971612810181281172e-05
H257_067211251091238401162e-05
PHYKE_247914459171531103e-05
PYU1_G00106314459783351153e-05
PPTG_1340114459927561144e-05
PYIR_1530914459937361144e-05
PYAP_1729014459835361144e-05
PYIW_1317214459939351144e-05
H310_002301251091248401145e-05
PITG_1806714459924561135e-05
CCA188751612815141431136e-05
PYIW_21108951125931291137e-05
CCA15513288513411211111e-04
PHYRA_7783414459936551111e-04
PYAR_1991414459788351101e-04
PYVX_1357414459950351101e-04
CCI4122514459981351101e-04
CCA26890614715301101101e-04
PYIR_17453951126191121092e-04
PHALS_0653314459930541092e-04
H257_092701422348841291092e-04
SDRG_127621612813921381092e-04
CCI42457152926906351073e-04
PHYCA_503112152926214341043e-04
CCA1648714459975351073e-04
CCA17102152926884351064e-04
PYIR_183821526711541511055e-04
PHYRA_94409288512701521056e-04
PPTG_193711526711951431020.001
PYAP_186361526710091611010.002
PHYRA_825431526711991431010.002
CCI10928614715301251010.002
PITG_11303931829334980.002
PYU1_G008848152677651511000.002
CCI1048915870977737990.003
PHYSO_24848128851283152990.003
PHALS_0669914313884133990.003
HYAP_061012885984132980.003
H257_098231431365452980.004
PHYSO_544598152671163144980.005
PYAR_15463152671091128970.005
SDRG_00080124544298117950.005
PYVX_18338241774649970.005
PITG_178931431374785960.006
PYVX_13312152671016105970.006
PHALS_04098152671183164960.007
PITG_19213152671201143960.008
PPTG_045531431390485950.008
PHYSO_55616414313765135950.009
PHALS_035401690479950.009
H310_0091295112182133950.009
SPRG_0912814313620129940.010
H257_0309315267975110950.010
SPRG_1190016605110940.011
PYIR_1316828851353152940.011
PYAR_192918506071158940.012
PHYSO_3436291445997730940.012
PHALS_0558728851361139940.012
PYIW_1698715267821110940.012
H257_0336112342869960930.014
SPRG_149557490635140930.015
SDRG_0560811092121127870.015
PHYSO_344112241781349930.016
PPTG_05519241781049930.016
PHALS_03645241783049930.016
SDRG_0140715267815135930.016
PHYCA_506137241781049930.016
PITG_02762241781049930.017
PHYRA_7353514313875137930.017
PYIW_18480241775537920.018
CCA18023152671138126920.019
H310_0484315267968110920.019
SPRG_1702213189210739850.019
HYAP_08026241779837920.019
PHYRA_79281241780937920.019
SDRG_07086128106656138920.020
H310_063781445983735920.020
CCI46235152671155111920.021
PYAP_22646241781537920.022
CCA21715241778237920.022
CCA2186015507878237920.022
PITG_02109185352256910.023
H257_135671445983635910.024
PPTG_1604428851378132910.025
PYAP_2268528851104162910.025
PITG_0331828851343132910.025
PYIW_2194428851317116910.026
PHYRA_73534696861210137910.026
PHYKE_5678241780949910.026
SDRG_088001445988135910.028
PHYCA_504801185339856900.028
H257_03931963969568900.029
SDRG_142861431367030900.031
H257_133467490587121900.033
SPRG_0250211092121125840.034
SPRG_054491445972335900.038
PYIR_1678061471352120900.038
PYU1_G004386241783742900.038
PPTG_14630185339856880.042
SPRG_0089015267883126890.043
H310_1362714313678122890.046
SDRG_140707490630140890.047
PYIR_13120241781437890.048
CCI42349103311110140890.050
H257_051751643067865890.050
PYAP_1673481951314109890.050
SPRG_1631213132226154870.052
PYAR_19883241783337880.055
PYAR_157921109212142830.056
SDRG_05150241778739880.058
H310_09363140947195479880.059
H310_07070963968067880.061
SPRG_08346241779739880.061
CCI434561109212652830.062
HYAP_0445715267120357880.063
H310_046671643068056880.064
SDRG_055678195980122880.065
PYU1_G0007249278718936840.071
PYU1_G0032291681070870.074
PYVX_2334914313924112870.085
CCI43793134791117128870.091
H257_0926910331113572870.092
PHYRA_7713461501267125870.096
PYIW_20891185329156850.098
PYAR_243236147883114860.098
PHALS_063361852511134860.099
PYU1_G00924995112580126860.11
SPRG_060218195983122850.13
H257_06469219447630770.13
PYU1_G01126161471328148850.13
CCI40991241780138850.14
PYAP_161619866188939850.14
HYAP_0640312330103780850.14
CCA191181109212552800.14
PYVX_14593185096450850.14
PHYKE_666215267765196850.15
PYAP_237441109212356790.16
SDRG_1448712342896459850.16
PHYSO_48987281951240125850.17
PYIR_2337215835141536850.17
PHYKE_491118534632740.17
SPRG_0275212342883159840.17
PPTG_1462618501055115840.17
PHALS_080978195106950840.18
PYVX_145276030126956840.18
PHYCA_5394655920914174840.18
PYAP_136951853348122830.18
PHYSO_478611185352256830.19
H310_140199204683116840.19
SPRG_02753185330957830.20
PHYKE_4910185237540830.20
SDRG_14486185330857820.20
PHYKE_7856288534632830.20
PPTG_1898913479121332840.21
SPRG_1587113098310186770.21
H310_05692142234924129830.23
PITG_0210618501015147830.23
SPRG_14312963966165830.23
PYAR_1349181951080114830.23
PITG_115789511213151830.24
H257_07514241781037830.24
H310_07701241781137830.24
PITG_0993081951221130830.24
PHALS_0793013479120032830.25
PYU1_G0122741583587336830.25
PYAP_234788506089730830.26
PPTG_117149511244451830.26
H310_06666863288739830.26
PHYRA_8194413479114932830.27
PHYSO_56174210331108275830.27
PHALS_01010461471657820.28
PYU1_G0128591850118347830.28
HYAP_0930413479114432830.28
PPTG_2100071911012127830.29
SDRG_062881664157820.30
CCA2551013479113933820.31
PYU1_G012870185335250810.31
PYIR_144941681933820.31
PHYRA_837687189273531820.31
PHYRA_770336023137231820.33
PHYKE_734711092122104770.34
PYIW_1461161471346124820.34
CCI4208831991007144820.34
PYAR_170645920816126820.34
PHYRA_830719511230070820.35
H257_02642640397536820.35
PHYRA_7271837973236820.35
PYAP_1956011517337113810.36
PYIW_178181850118851820.36
PYIR_2147316430667147810.36
H310_14473749061341810.37
SDRG_0708510331101055820.37
PYIW_219018506091337810.38
PHYKE_86891033183255810.38
PYAR_1869095112455112820.38
SDRG_021352194430633800.39
SPRG_1153610331108755810.40
PHYSO_28914611092122104760.40
PITG_1366511092122104760.40
H310_01921185334166800.42
PHYCA_51050611092121104760.43
SPRG_082171643068756810.43
SDRG_048711643068756810.44
SDRG_03175640393447810.45
PHALS_06568185338856800.46
PPTG_1963111092122104760.47
PHYSO_5299319511221153810.47
H310_0569110331112565810.48
PHALS_0063192501113128810.48
CCA235728632868120810.48
PITG_0728961501347117810.48
PPTG_0416561501350117810.48
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_06478

Length=345
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHALS_06478                                                           685        0.0   
PPTG_17127                                                            554        0.0   
PITG_18456                                                            549        0.0   
PHYSO_471523                                                          538        0.0   
PHYRA_81100                                                           536        0.0   
PHYCA_556162                                                          530        0.0   
PHYKE_8393                                                            435        7e-153
PYU1_G001735                                                          328        1e-110
PYIR_13451                                                            323        2e-108
PYAP_17762                                                            321        9e-108
PYIW_19971                                                            286        3e-94 
PYVX_18171                                                            274        4e-90 
PYAR_13570                                                            258        3e-83 
CCA18899                                                              248        2e-79 
CCI45123                                                              197        3e-60 
SPRG_06336                                                            186        2e-55 
SDRG_01781                                                            172        6e-50 
H310_09223                                                            147        2e-40 
H257_06294                                                            144        4e-39 
CCI45127                                                              99.8       7e-24 
PYAR_23286                                                            58.2       3e-08 
HYAP_08645                                                            55.5       3e-07 
PHYSO_361747                                                          54.7       5e-07 
PHYRA_84916                                                           54.7       6e-07 
PYIW_17381                                                            54.3       6e-07 
PYIR_21589                                                            54.3       7e-07 
CCI39367                                                              53.5       1e-06 
PHYKE_1990                                                            53.1       1e-06 
PYU1_G006347                                                          52.8       2e-06 
H310_00231                                                            52.4       2e-06 
PYVX_20438                                                            52.4       3e-06 
H257_06722                                                            52.0       4e-06 
PPTG_18898                                                            51.6       5e-06 
SPRG_06059                                                            51.2       6e-06 
PITG_20562                                                            51.2       6e-06 
SPRG_06058                                                            50.8       9e-06 
SDRG_12763                                                            50.4       1e-05 
CCI44752                                                              50.4       1e-05 
PYAP_16997                                                            49.7       2e-05 
H257_06721                                                            49.3       2e-05 
PHYKE_2479                                                            47.0       3e-05 
PYU1_G001063                                                          48.9       3e-05 
PPTG_13401                                                            48.5       4e-05 
PYIR_15309                                                            48.5       4e-05 
PYAP_17290                                                            48.5       4e-05 
PYIW_13172                                                            48.5       4e-05 
H310_00230                                                            48.5       5e-05 
PITG_18067                                                            48.1       5e-05 
CCA18875                                                              48.1       6e-05 
PYIW_21108                                                            48.1       7e-05 
CCA15513                                                              47.4       1e-04 
PHYRA_77834                                                           47.4       1e-04 
PYAR_19914                                                            47.0       1e-04 
PYVX_13574                                                            47.0       1e-04 
CCI41225                                                              47.0       1e-04 
CCA26890                                                              47.0       1e-04 
PYIR_17453                                                            46.6       2e-04 
PHALS_06533                                                           46.6       2e-04 
H257_09270                                                            46.6       2e-04 
SDRG_12762                                                            46.6       2e-04 
CCI42457                                                              45.8       3e-04 
PHYCA_503112                                                          44.7       3e-04 
CCA16487                                                              45.8       3e-04 
CCA17102                                                              45.4       4e-04 
PYIR_18382                                                            45.1       5e-04 
PHYRA_94409                                                           45.1       6e-04 
PPTG_19371                                                            43.9       0.001 
PYAP_18636                                                            43.5       0.002 
PHYRA_82543                                                           43.5       0.002 
CCI10928                                                              43.5       0.002 
PITG_11303                                                            42.4       0.002 
PYU1_G008848                                                          43.1       0.002 
CCI10489                                                              42.7       0.003 
PHYSO_248481                                                          42.7       0.003 
PHALS_06699                                                           42.7       0.003 
HYAP_06101                                                            42.4       0.003 
H257_09823                                                            42.4       0.004 
PHYSO_544598                                                          42.4       0.005 
PYAR_15463                                                            42.0       0.005 
SDRG_00080                                                            41.2       0.005 
PYVX_18338                                                            42.0       0.005 
PITG_17893                                                            41.6       0.006 
PYVX_13312                                                            42.0       0.006 
PHALS_04098                                                           41.6       0.007 
PITG_19213                                                            41.6       0.008 
PPTG_04553                                                            41.2       0.008 
PHYSO_556164                                                          41.2       0.009 
PHALS_03540                                                           41.2       0.009 
H310_00912                                                            41.2       0.009 
SPRG_09128                                                            40.8       0.010 
H257_03093                                                            41.2       0.010 
SPRG_11900                                                            40.8       0.011 
PYIR_13168                                                            40.8       0.011 
PYAR_19291                                                            40.8       0.012 
PHYSO_343629                                                          40.8       0.012 
PHALS_05587                                                           40.8       0.012 
PYIW_16987                                                            40.8       0.012 
H257_03361                                                            40.4       0.014 
SPRG_14955                                                            40.4       0.015 
SDRG_05608                                                            38.1       0.015 
PHYSO_344112                                                          40.4       0.016 
PPTG_05519                                                            40.4       0.016 
PHALS_03645                                                           40.4       0.016 
SDRG_01407                                                            40.4       0.016 
PHYCA_506137                                                          40.4       0.016 
PITG_02762                                                            40.4       0.017 
PHYRA_73535                                                           40.4       0.017 
PYIW_18480                                                            40.0       0.018 
CCA18023                                                              40.0       0.019 
H310_04843                                                            40.0       0.019 
SPRG_17022                                                            37.4       0.019 
HYAP_08026                                                            40.0       0.019 
PHYRA_79281                                                           40.0       0.019 
SDRG_07086                                                            40.0       0.020 
H310_06378                                                            40.0       0.020 
CCI46235                                                              40.0       0.021 
PYAP_22646                                                            40.0       0.022 
CCA21715                                                              40.0       0.022 
CCA21860                                                              40.0       0.022 
PITG_02109                                                            39.7       0.023 
H257_13567                                                            39.7       0.024 
PPTG_16044                                                            39.7       0.025 
PYAP_22685                                                            39.7       0.025 
PITG_03318                                                            39.7       0.025 
PYIW_21944                                                            39.7       0.026 
PHYRA_73534                                                           39.7       0.026 
PHYKE_5678                                                            39.7       0.026 
SDRG_08800                                                            39.7       0.028 
PHYCA_504801                                                          39.3       0.028 
H257_03931                                                            39.3       0.029 
SDRG_14286                                                            39.3       0.031 
H257_13346                                                            39.3       0.033 
SPRG_02502                                                            37.0       0.034 
SPRG_05449                                                            39.3       0.038 
PYIR_16780                                                            39.3       0.038 
PYU1_G004386                                                          39.3       0.038 
PPTG_14630                                                            38.5       0.042 
SPRG_00890                                                            38.9       0.043 
H310_13627                                                            38.9       0.046 
SDRG_14070                                                            38.9       0.047 
PYIR_13120                                                            38.9       0.048 
CCI42349                                                              38.9       0.050 
H257_05175                                                            38.9       0.050 
PYAP_16734                                                            38.9       0.050 
SPRG_16312                                                            38.1       0.052 
PYAR_19883                                                            38.5       0.055 
PYAR_15792                                                            36.6       0.056 
SDRG_05150                                                            38.5       0.058 
H310_09363                                                            38.5       0.059 
H310_07070                                                            38.5       0.061 
SPRG_08346                                                            38.5       0.061 
CCI43456                                                              36.6       0.062 
HYAP_04457                                                            38.5       0.063 
H310_04667                                                            38.5       0.064 
SDRG_05567                                                            38.5       0.065 
PYU1_G000724                                                          37.0       0.071 
PYU1_G003229                                                          38.1       0.074 
PYVX_23349                                                            38.1       0.085 
CCI43793                                                              38.1       0.091 
H257_09269                                                            38.1       0.092 
PHYRA_77134                                                           38.1       0.096 
PYIW_20891                                                            37.4       0.098 
PYAR_24323                                                            37.7       0.098 
PHALS_06336                                                           37.7       0.099 
PYU1_G009249                                                          37.7       0.11  
SPRG_06021                                                            37.4       0.13  
H257_06469                                                            34.3       0.13  
PYU1_G011261                                                          37.4       0.13  
CCI40991                                                              37.4       0.14  
PYAP_16161                                                            37.4       0.14  
HYAP_06403                                                            37.4       0.14  
CCA19118                                                              35.4       0.14  
PYVX_14593                                                            37.4       0.14  
PHYKE_6662                                                            37.4       0.15  
PYAP_23744                                                            35.0       0.16  
SDRG_14487                                                            37.4       0.16  
PHYSO_489872                                                          37.4       0.17  
PYIR_23372                                                            37.4       0.17  
PHYKE_4911                                                            33.1       0.17  
SPRG_02752                                                            37.0       0.17  
PPTG_14626                                                            37.0       0.17  
PHALS_08097                                                           37.0       0.18  
PYVX_14527                                                            37.0       0.18  
PHYCA_539465                                                          37.0       0.18  
PYAP_13695                                                            36.6       0.18  
PHYSO_478611                                                          36.6       0.19  
H310_14019                                                            37.0       0.19  
SPRG_02753                                                            36.6       0.20  
PHYKE_4910                                                            36.6       0.20  
SDRG_14486                                                            36.2       0.20  
PHYKE_7856                                                            36.6       0.20  
PPTG_18989                                                            37.0       0.21  
SPRG_15871                                                            34.3       0.21  
H310_05692                                                            36.6       0.23  
PITG_02106                                                            36.6       0.23  
SPRG_14312                                                            36.6       0.23  
PYAR_13491                                                            36.6       0.23  
PITG_11578                                                            36.6       0.24  
H257_07514                                                            36.6       0.24  
H310_07701                                                            36.6       0.24  
PITG_09930                                                            36.6       0.24  
PHALS_07930                                                           36.6       0.25  
PYU1_G012274                                                          36.6       0.25  
PYAP_23478                                                            36.6       0.26  
PPTG_11714                                                            36.6       0.26  
H310_06666                                                            36.6       0.26  
PHYRA_81944                                                           36.6       0.27  
PHYSO_561742                                                          36.6       0.27  
PHALS_01010                                                           36.2       0.28  
PYU1_G012859                                                          36.6       0.28  
HYAP_09304                                                            36.6       0.28  
PPTG_21000                                                            36.6       0.29  
SDRG_06288                                                            36.2       0.30  
CCA25510                                                              36.2       0.31  
PYU1_G012870                                                          35.8       0.31  
PYIR_14494                                                            36.2       0.31  
PHYRA_83768                                                           36.2       0.31  
PHYRA_77033                                                           36.2       0.33  
PHYKE_7347                                                            34.3       0.34  
PYIW_14611                                                            36.2       0.34  
CCI42088                                                              36.2       0.34  
PYAR_17064                                                            36.2       0.34  
PHYRA_83071                                                           36.2       0.35  
H257_02642                                                            36.2       0.35  
PHYRA_72718                                                           36.2       0.35  
PYAP_19560                                                            35.8       0.36  
PYIW_17818                                                            36.2       0.36  
PYIR_21473                                                            35.8       0.36  
H310_14473                                                            35.8       0.37  
SDRG_07085                                                            36.2       0.37  
PYIW_21901                                                            35.8       0.38  
PHYKE_8689                                                            35.8       0.38  
PYAR_18690                                                            36.2       0.38  
SDRG_02135                                                            35.4       0.39  
SPRG_11536                                                            35.8       0.40  
PHYSO_289146                                                          33.9       0.40  
PITG_13665                                                            33.9       0.40  
H310_01921                                                            35.4       0.42  
PHYCA_510506                                                          33.9       0.43  
SPRG_08217                                                            35.8       0.43  
SDRG_04871                                                            35.8       0.44  
SDRG_03175                                                            35.8       0.45  
PHALS_06568                                                           35.4       0.46  
PPTG_19631                                                            33.9       0.47  
PHYSO_529931                                                          35.8       0.47  
H310_05691                                                            35.8       0.48  
PHALS_00631                                                           35.8       0.48  
CCA23572                                                              35.8       0.48  
PITG_07289                                                            35.8       0.48  
PPTG_04165                                                            35.8       0.48  
PYAP_18434                                                            35.8       0.49  
CCA19033                                                              35.8       0.52  
PHALS_07062                                                           33.5       0.54  
PHYRA_73430                                                           35.0       0.54  
PYAR_23366                                                            35.4       0.55  
H310_04842                                                            35.4       0.57  
H257_01308                                                            35.4       0.57  
SPRG_11537                                                            35.4       0.60  
PYIW_18491                                                            35.4       0.60  
PYAR_25500                                                            35.0       0.61  
PYU1_G008119                                                          33.5       0.61  
HYAP_02360                                                            33.5       0.62  
HYAP_13757                                                            34.7       0.65  
PHYSO_478442                                                          35.0       0.65  
PHYRA_85100                                                           33.5       0.67  
PHYRA_85097                                                           33.5       0.67  
PYVX_15906                                                            33.5       0.69  
H310_06667                                                            35.0       0.69  
PHYCA_504712                                                          34.3       0.71  
PHYSO_506918                                                          35.0       0.71  
PYAR_14615                                                            35.0       0.71  
CCI45895                                                              35.0       0.72  
PHALS_09667                                                           35.0       0.72  
H257_00729                                                            33.1       0.73  
PHYSO_354122                                                          35.0       0.73  
SPRG_00889                                                            35.0       0.74  
PYIR_15118                                                            35.0       0.80  
SDRG_02154                                                            35.0       0.80  
PYU1_G009508                                                          34.7       0.80  
PYIW_26522                                                            33.1       0.81  
H310_01094                                                            33.1       0.82  
PITG_00416                                                            34.7       0.84  
PYIR_15407                                                            33.1       0.84  
PYVX_19982                                                            34.7       0.85  
H257_03363                                                            34.3       0.89  
PPTG_10755                                                            34.7       0.89  
CCA27255                                                              34.7       0.90  
PYAP_24144                                                            34.7       0.90  
PYU1_G007423                                                          34.7       0.91  
SPRG_01860                                                            34.7       0.92  
PYIW_18911                                                            34.7       0.92  
PHALS_03335                                                           34.7       0.93  
SDRG_08236                                                            34.7       0.95  
SDRG_01408                                                            34.7       0.99  
HYAP_02230                                                            34.7       1.00  
PHYCA_529660                                                          34.3       1.0   
SDRG_03531                                                            33.9       1.0   
PYIW_17571                                                            34.7       1.0   
SPRG_04912                                                            33.9       1.1   
SDRG_06927                                                            34.7       1.1   
SPRG_09805                                                            34.7       1.1   
PPTG_16659                                                            34.7       1.1   
PYAP_17850                                                            34.7       1.1   
HYAP_10830                                                            34.7       1.2   
SPRG_01654                                                            34.3       1.2   
PYIR_13555                                                            33.9       1.2   
SPRG_00364                                                            33.9       1.2   
PHYSO_484541                                                          34.3       1.2   
PPTG_02136                                                            34.3       1.3   
PHYRA_78815                                                           34.3       1.3   
PHYSO_284916                                                          34.3       1.3   
PYVX_23432                                                            34.3       1.3   
PHYCA_506274                                                          34.3       1.3   
PYIR_24588                                                            34.3       1.3   
H257_03095                                                            34.3       1.4   
HYAP_08248                                                            34.3       1.4   
PHALS_12503                                                           33.9       1.4   
PHALS_09273                                                           33.9       1.4   
PYIR_16539                                                            34.3       1.5   
PITG_05429                                                            33.9       1.5   
PYAR_24555                                                            33.9       1.5   
SPRG_08834                                                            33.9       1.5   
HYAP_14013                                                            33.9       1.6   
CCA17832                                                              33.9       1.6   
PYAR_26065                                                            33.5       1.6   
PPTG_02592                                                            33.9       1.7   
PHALS_06334                                                           33.9       1.7   
H257_08182                                                            33.9       1.7   
SPRG_15835                                                            33.1       1.8   
PHYKE_1044                                                            33.5       1.8   
PYIW_19613                                                            33.9       1.8   
H257_16221                                                            33.9       1.8   
PYIW_14463                                                            33.1       1.8   
PHYRA_73432                                                           33.9       1.9   
PYAP_16658                                                            33.1       2.0   
SDRG_14771                                                            33.5       2.0   
PPTG_19153                                                            33.9       2.0   
PITG_16799                                                            33.5       2.1   
PITG_11232                                                            33.5       2.1   
PYAP_19753                                                            33.5       2.1   
SDRG_12776                                                            33.5       2.1   
HYAP_13689                                                            33.5       2.1   
HYAP_13267                                                            33.5       2.3   
CCA22367                                                              33.5       2.3   
PHALS_09729                                                           33.5       2.4   
PYIW_23677                                                            31.2       2.4   
PITG_10462                                                            33.5       2.5   
PITG_08640                                                            33.5       2.6   
H310_02133                                                            33.1       2.6   
PPTG_08785                                                            33.1       2.7   
PHYSO_558498                                                          33.1       2.7   
PHYCA_564296                                                          33.1       2.8   
CCI47145                                                              33.1       2.8   
PHYRA_76931                                                           33.1       2.8   
PYU1_G002632                                                          33.1       2.9   
HYAP_08916                                                            32.7       2.9   
SDRG_17208                                                            33.1       2.9   
CCA14529                                                              33.1       2.9   
PYU1_G010818                                                          32.0       2.9   
PYVX_13261                                                            33.1       2.9   
PHYRA_85457                                                           33.1       2.9   
PYVX_13084                                                            33.1       2.9   
PYAP_22195                                                            33.1       3.0   
PHYRA_82040                                                           33.1       3.0   
PPTG_04169                                                            33.1       3.1   
PYAR_16120                                                            33.1       3.2   
PYVX_14287                                                            33.1       3.2   
HYAP_09511                                                            33.1       3.2   
PHALS_06636                                                           33.1       3.3   
CCA24531                                                              32.7       3.3   
PYAR_16228                                                            33.1       3.3   
H257_09028                                                            32.7       3.3   
PYU1_G007013                                                          33.1       3.3   
PYIW_21526                                                            33.1       3.3   
H257_10151                                                            32.7       3.4   
PYU1_G000461                                                          32.3       3.5   
PYIW_19873                                                            32.0       3.5   
PYAR_16674                                                            32.7       3.5   
SDRG_16367                                                            32.3       3.5   
PHYSO_481860                                                          32.7       3.6   
H310_02582                                                            32.7       3.7   
H310_00209                                                            32.7       3.7   
H257_00263                                                            32.7       3.8   
PYVX_16714                                                            32.7       3.8   
PYU1_G006732                                                          32.7       3.8   
PHYKE_2581                                                            32.7       3.9   
H257_06698                                                            32.7       4.0   
PHYKE_5588                                                            32.7       4.0   
SDRG_01838                                                            32.7       4.0   
SPRG_06273                                                            32.7       4.1   
SPRG_09211                                                            32.7       4.2   
PITG_17594                                                            32.7       4.3   
PYIW_15014                                                            32.7       4.3   
CCI45857                                                              32.7       4.3   
PYVX_20600                                                            32.7       4.4   
CCA19097                                                              32.3       4.4   
H257_01309                                                            32.7       4.5   
PYVX_22589                                                            32.7       4.6   
SPRG_02939                                                            32.7       4.6   
HYAP_11295                                                            32.3       4.6   
PHYRA_73431                                                           32.3       4.6   
PITG_07026                                                            32.3       4.7   
PHYCA_504798                                                          32.3       4.8   
PHYRA_77019                                                           32.3       4.9   
H310_01510                                                            32.3       5.0   
PPTG_06823                                                            32.3       5.0   
HYAP_13688                                                            32.3       5.1   
PITG_12699                                                            32.3       5.3   
PHYSO_354120                                                          32.3       5.5   
PPTG_14629                                                            32.0       5.5   
PYAP_15374                                                            32.3       5.6   
PYU1_G012858                                                          32.0       5.7   
H310_01572                                                            32.3       5.7   
PPTG_07075                                                            32.3       5.8   
H310_02933                                                            32.3       5.9   
PYIW_20221                                                            32.0       6.0   
PYVX_16641                                                            32.0       6.0   
PYIR_16046                                                            32.0       6.4   
PYAR_18912                                                            32.0       6.5   
PHALS_05825                                                           31.6       6.5   
PHYKE_9717                                                            32.0       6.5   
PYIW_15053                                                            32.0       6.7   
PHYCA_505441                                                          32.0       6.7   
SDRG_16839                                                            32.0       6.8   
HYAP_07348                                                            32.0       6.9   
SDRG_00756                                                            32.0       6.9   
PYVX_16095                                                            32.0       6.9   
H257_16349                                                            31.6       7.1   
PYIR_22667                                                            32.0       7.2   
PHYSO_349983                                                          32.0       7.4   
PHYSO_485120                                                          30.4       7.4   
PPTG_07800                                                            30.8       7.6   
PHYSO_304784                                                          32.0       7.6   
PYVX_19272                                                            31.6       7.7   
H257_10847                                                            32.0       7.7   
PYIR_23012                                                            32.0       7.7   
PPTG_16174                                                            31.6       7.8   
PITG_21026                                                            31.6       7.9   
PHYKE_4722                                                            31.6       7.9   
PHYRA_84567                                                           31.6       8.0   
PITG_00020                                                            31.6       8.1   
H257_10063                                                            31.6       8.3   
PYIR_15898                                                            31.6       8.5   
PYU1_G008981                                                          31.6       8.9   
PHYRA_79989                                                           31.6       8.9   
PHALS_02739                                                           31.6       9.0   
PYIR_14311                                                            31.6       9.0   
PHYRA_77130                                                           31.6       9.3   
PHYRA_71587                                                           31.6       9.5   
PHYSO_549587                                                          31.6       9.7   
PYAR_18008                                                            30.0       9.9   

>PHALS_06478
Length=345

 Score = 685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/345 (100%), Positives = 345/345 (100%), Gaps = 0/345 (0%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC
Sbjct  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
            HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT
Sbjct  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120

Query  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
            DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS
Sbjct  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180

Query  181  KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
            KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP
Sbjct  181  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240

Query  241  TLHFFSDDTRPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAE  300
            TLHFFSDDTRPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAE
Sbjct  241  TLHFFSDDTRPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAE  300

Query  301  LLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
            LLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF
Sbjct  301  LLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345

>PPTG_17127
Length=351

 Score = 554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/351 (81%), Positives = 306/351 (87%), Gaps = 6/351 (2%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            MNILR+PE G TASGDKA+PTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
            HPP GE + PKGSFYLS+IEPHEYV+GVMGAAD+PFGFKMVGHAP+KG+VELDVFV+T  
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
            DRNKWLEVA NAL  KRQLTRQAIDQSVSPNKK LFGFSV  S QP MSPQKQMQTLA S
Sbjct  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180

Query  181  KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
            K+ LL EALRE+EAAKLVGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  181  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHFFSDDTRPKVPLGDHP------HHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294
            TLH FSDD+RPK   G         H SG +SPSRL PA + + DAG SDL+RLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300

Query  295  LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
            LEVQAE+LN E+ HSSQQIERIEHHL++VT RVEKQTKQA ATLSAGPRLF
Sbjct  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PITG_18456
Length=351

 Score = 549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/351 (80%), Positives = 308/351 (88%), Gaps = 6/351 (2%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
            HPP G+ + PKG FYLS+IEPHEYV+GVMGAAD+PFGFKMVGHAP+KG+VELDVFV+T  
Sbjct  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
            DRNKWLEVA NAL AKRQLTRQAIDQSVSP KK LFGFSV  S QP MSPQKQ+QTL+ S
Sbjct  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180

Query  181  KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
            K+ LL +ALRE+EAAKLVGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHFFSDDTRPKVPLG------DHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294
            TLH FSDD+RPK             H SG +SP+RL PA+EI+ DAGVSDL+RLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300

Query  295  LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
            LEVQAELLN E+G SSQQIERIEHHL++VT RVEKQTKQA ATLSAGPRLF
Sbjct  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHYSO_471523
Length=348

 Score = 538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/348 (79%), Positives = 298/348 (86%), Gaps = 3/348 (1%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLVLDGSNL V+YYESRAAC
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
            HPP GE + PKGSFYLS+IEPHEYV+GVMGAA++PFGFKMVGHAPRKG+VELDVFVET  
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120

Query  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
            DRNKWLEVA NAL AKRQLTRQAIDQSVSPN+K LFGF++  S QP MSPQKQMQTL  S
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180

Query  181  KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
            ++ LL +ALR+IEAAK VGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHFFSDDTRPKVPL--GDHPHHS-GSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEV  297
            TLH FSDD+RPK        P  S  S  P RL PA++   DAGVSDL+RLAQALGELEV
Sbjct  241  TLHLFSDDSRPKASASKASSPQRSQQSGRPPRLPPAMDSINDAGVSDLERLAQALGELEV  300

Query  298  QAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
            QAELLN E+G  +QQIERIEH LS+VT RVEKQTKQA A L +GPRLF
Sbjct  301  QAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348

>PHYRA_81100
Length=349

 Score = 536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/349 (79%), Positives = 301/349 (86%), Gaps = 4/349 (1%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLVL+GSNLQ++YYESRAAC
Sbjct  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
            HPP  E + PKGSFYLS+IEPHEYV+GVMGAA +PFGFKM+GHAP+KG+VELDVFVETQ 
Sbjct  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120

Query  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
            DRNKWLEVA NAL AKRQLTRQAIDQSVS NKK LFGF V  S QP+M+PQKQMQTL  +
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180

Query  181  KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
            K+ LL  ALR+IEAAKLVGREACNEIV QGEKLD IEQDL AIDRDLDFGDKLL RLKSP
Sbjct  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHFFSDDTRPK--VPLGDHPHHSGST--SPSRLIPAIEITRDAGVSDLQRLAQALGELE  296
            TLH FSDD+RPK     G  P  S  +  SPSRL PA+E   DAGVSDL+RLAQALGELE
Sbjct  241  TLHLFSDDSRPKSTASKGHSPQRSQQSGGSPSRLPPAMETINDAGVSDLERLAQALGELE  300

Query  297  VQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
            VQAE+LN E+G S+QQIER+EH LS+VT RVEKQTKQA ATL AGP+LF
Sbjct  301  VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349

>PHYCA_556162
Length=351

 Score = 530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/351 (77%), Positives = 296/351 (84%), Gaps = 6/351 (2%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            MNILR+PE GA  SGDKA+PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQV YYESRAAC
Sbjct  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
            HP  GE++ PKGSFYLS+IEPHEYV+GVMGAA +PFGFKMVGHAP+KG+VELDVFVET  
Sbjct  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120

Query  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
            DRNKWLEVA NAL AKRQLTRQAIDQSVSPNKK LFGFSV  S QP +SPQKQMQTL  +
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180

Query  181  KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
            K+ LL +ALR+IEAAK +GREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHFFSDDTRPKVPLGDHPH------HSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294
            TLH FS+D+RPK       +       SG +SP+RL  A E   D G SDL+RLAQALGE
Sbjct  241  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  300

Query  295  LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
            LE+QAELLN E+GHS+QQI+ IEHHLS VT RVEKQTKQA ATL AGPRLF
Sbjct  301  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351

>PHYKE_8393
Length=326

 Score = 435 bits (1118),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 236/351 (67%), Positives = 265/351 (75%), Gaps = 31/351 (9%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            MNILR+PE GATASGDKA+PTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
            HPP+GE+   KGSFYLSNI PHEYV+GVMGAAD+PFGFKMVGHAPRKG+VELDVFVET +
Sbjct  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95

Query  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
            DRNKWLEVA NAL AKRQ+ RQAIDQSVSP KK +FGF +  S QP++ PQKQ+Q L  +
Sbjct  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHN  155

Query  181  KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
            KE LL EALRE+EAAK+VGREACNEIV QGEKLD +E DL AIDRDLDFGDKLL RLK+P
Sbjct  156  KEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215

Query  241  TLHFFSDDTRPKVPLGDH------PHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294
            TLH FSDDTRPK     +       H S  ++P  L  ++    DA  SDL+RLA ALGE
Sbjct  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGE  275

Query  295  LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
            LE+QAELLN E+G S+QQI RIE  LS+VT RVEKQTKQA ATLSAGPRLF
Sbjct  276  LELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326

>PYU1_G001735
Length=342

 Score = 328 bits (841),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 189/352 (54%), Positives = 240/352 (68%), Gaps = 24/352 (7%)

Query  1    MNILRLPEPGATASG-DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
            MNILR+P+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQV+Y+ESR A
Sbjct  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60

Query  60   CHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQ  119
             H P    T+PKGSFY+S++E HEY IGVMG  ++PFGFK+VGHAP KG++ELD+FVE+ 
Sbjct  61   AHAP---GTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117

Query  120  TDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLAT  179
             D NKWLEV  NAL A ++LTR+ +  S     K +FGF         +SPQ Q++ LA 
Sbjct  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGAS------ISPQLQVKKLAA  167

Query  180  SKEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKS  239
            +KE LL EALREIE AKL+GREA NEIV+QGEKLD +E DL  ++ DLD  DKLL  LKS
Sbjct  168  TKEELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227

Query  240  PTLHFFSDDTRPKVPLGDHPHHSGSTSPSRLIPAI---------EITRDAG-VSDLQRLA  289
            P LH FS+D R K         S S   S     +         +IT   G ++DL+ LA
Sbjct  228  PVLHVFSNDNRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLA  287

Query  290  QALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAG  341
             AL ELE QA L+N+E+  S++QI RIE  L+ V +RV+ QTK+A AT+ AG
Sbjct  288  LALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339

>PYIR_13451
Length=359

 Score = 323 bits (829),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 186/367 (51%), Positives = 240/367 (65%), Gaps = 37/367 (10%)

Query  1    MNILRLPEPGATASG------DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
            MNILR+P+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQVAYY
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  55   ESRAACHPPNGEST----MPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFV  110
            ESR A    +        +PKGSFY+S++E HEY +GVMG  ++PFGFK+VGHAP+KG++
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  111  ELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSP  170
            ELD+FVE+  D NKW+EV  NAL A ++ +R    Q  S   K +FGFS  +      SP
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTT-KTMFGFSASA------SP  173

Query  171  QKQMQTLATSKEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFG  230
            Q Q++ LA +KE LL +ALREIE AKL+GREA NEIV QGEKLD++E DL  ++ DLD  
Sbjct  174  QLQVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233

Query  231  DKLLHRLKSPTLHFFSDDTRPKVPLGDHPHHSGSTSPS----------------RLIPAI  274
            DKLL  +K P LH FS D R K      PH  G++  +                     I
Sbjct  234  DKLLRHMKRPMLHLFSGDERVK----QSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQI  289

Query  275  EITRDAGVSDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQA  334
               R+  +SDL++LA ALGELE QA L+N+E+  S++QI R+E  L+ V +RV+ QTK+A
Sbjct  290  HGQRNDALSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKA  349

Query  335  VATLSAG  341
             AT+ AG
Sbjct  350  NATMKAG  356

>PYAP_17762
Length=348

 Score = 321 bits (823),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 185/364 (51%), Positives = 242/364 (66%), Gaps = 43/364 (12%)

Query  1    MNILRLPEPGATA----------SGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            MNILRLP  GAT+               +PTSCEGYVTKRGHFRKSWRVRFLVL+G++L 
Sbjct  1    MNILRLP-LGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLL  59

Query  51   VAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFV  110
            V+YY+S+           +PKGSFYLS++E HEY +GV+GA ++PFGFKMVGHAPRKG+V
Sbjct  60   VSYYDSKEVARTAGA---VPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYV  116

Query  111  ELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSP  170
            ELD+FVET  D NKWLEV  NAL A ++LTR    ++++P  K LFGFS      P  SP
Sbjct  117  ELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSP  168

Query  171  QKQMQTLATSKEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFG  230
            Q+QM+ +  +KE +L +A+ EIE+AKL+GR AC EI  QGE+LD I Q+L+ ++ DLD+ 
Sbjct  169  QQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYA  228

Query  231  DKLLHRLKSPTLHFFSDDTRPKVPLGDHPHHSGSTSP-SRLIPAI--EITR---------  278
            DKLL  +K+P LH FS D R      D   ++G T P SR  P+   E TR         
Sbjct  229  DKLLRHMKNPGLHMFSSDAR------DRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHD  282

Query  279  ---DAGVSDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAV  335
                A +SD++RLA  LGELE QA LLN E+   + Q+ER+   L+HV ERV+ QT++A 
Sbjct  283  AVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKAN  342

Query  336  ATLS  339
            A+++
Sbjct  343  ASIA  346

>PYIW_19971
Length=348

 Score = 286 bits (733),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 232/362 (64%), Gaps = 38/362 (10%)

Query  1    MNILRLPEPGATAS----GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            MNILR+P+     S    GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ A    
Sbjct  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGG  60

Query  57   RAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFV  116
             +           PKGSF++S++E HEY +GVMG  ++PFGFK+VGHAP+KG++ELD+FV
Sbjct  61   AS--------PATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFV  112

Query  117  ETQTDRNKWLEVACNALKAKRQLTRQ--AIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
            ET  D NKW+EV  NAL A ++ TR   A D S + N   +FGFS        +SPQ Q+
Sbjct  113  ETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKN---MFGFSA------TVSPQLQV  163

Query  175  QTLATSKEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLL  234
            + LA +KE LL +ALREIE AKL+GREA ++I  QG KL++IE DL  ++ DLD G KLL
Sbjct  164  KKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLL  223

Query  235  HRLKSPTLHFFSDDTRPKVPL--------------GDHPHHSGSTSPSRLIPAIEITRDA  280
            + +K P LH FS+D R K                 G HP   GS++ +         +D 
Sbjct  224  NHMKRPMLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDT  283

Query  281  GV-SDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLS  339
             V SDL+RL  ALGELE QA  +N+E+  S++QI R+E  L+ V +RV+ QTK+A AT+ 
Sbjct  284  SVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMK  343

Query  340  AG  341
            AG
Sbjct  344  AG  345

>PYVX_18171
Length=294

 Score = 274 bits (701),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 214/331 (65%), Gaps = 50/331 (15%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +PTSCEGYVTKRGHFRKSWRVR+LVLDG++L+VAY+ES+ A    NG ++  KG FYLS+
Sbjct  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ--NGAAS--KGEFYLSS  65

Query  79   IEPHEYVIGVMGAA---DRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
            I+ H YV G MGA    ++PFGFKMVGHAP+KG+ ELD+FVET  D  KWLEVA NAL++
Sbjct  66   IDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125

Query  136  KRQLTRQAI-DQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreiea  194
               ++R+A  D   S   K LFGFS  +      SPQ+Q++ ++ SK+ LL +ALRE+E 
Sbjct  126  AAAMSRKAAGDGGGSATTKSLFGFSTTT------SPQQQLKAMSVSKDELLKDALRELEG  179

Query  195  aklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVP  254
            AKL+GREAC E+V QGEKLD IE +L  I+ DLD+GDKLL RLKSP LH  + D R + P
Sbjct  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR-RPP  238

Query  255  LGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAELLNSESGHSSQQIE  314
                       SP++ +      R A    L++L                    S+QQI 
Sbjct  239  -----------SPTKTLSNAGDGRAA----LEQL--------------------STQQIA  263

Query  315  RIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
            RIE  L+ V +RV++QTKQA + +  G  +F
Sbjct  264  RIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYAR_13570
Length=322

 Score = 258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 161/323 (50%), Positives = 208/323 (64%), Gaps = 37/323 (11%)

Query  36   SWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRP  95
            SWRVR+LVL+G++L V+Y++S+     P      PKGSFYLS++E HEYV+GV+GA  +P
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGAS---PKGSFYLSSVEKHEYVVGVLGAQKKP  64

Query  96   FGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKL  155
            FGFKMVGHAPRKG+VELD+FVE++ D  KWLEV  +AL A ++LTR  +  + S   K L
Sbjct  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122

Query  156  FGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreieaaklVGREACNEIVNQG-----  210
            FGFS      P  SPQKQ+Q L+ SKE LL +A+ EIE+AKL+GREAC EIV QG     
Sbjct  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176

Query  211  ----------EKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVPLGDHPH  260
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+ FS D R K      P 
Sbjct  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSAS--PA  234

Query  261  HSGSTSPSRLIPAIE--------ITRDAG-VSDLQRLAQALGELEVQAELLNSESGHSSQ  311
            HS   S    + +          + R +G +SD++RLA  LGELE QA LLN E+   + 
Sbjct  235  HSPVKSKQSALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTT  294

Query  312  QIERIEHHLSHVTERVEKQTKQA  334
            Q+ER+   L+H+ ERV+ QTK+A
Sbjct  295  QVERVGDALAHINERVQNQTKKA  317

>CCA18899
Length=343

 Score = 248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/340 (44%), Positives = 208/340 (61%), Gaps = 25/340 (7%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QV+YYES+ +    N     PKGSF L + 
Sbjct  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNA---TPKGSFILQSA  71

Query  80   EPHEYVIGVM---GAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136
            E HEY I  M      ++PFGFKMVGHAP++G++ELDVFV++ +D ++WL+V  N LKA 
Sbjct  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131

Query  137  RQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreieaak  196
            + + R+A    +    K + GFS   +T      ++Q+Q L + K   + EAL++IE AK
Sbjct  132  KCMAREAFMAEMDTT-KSVLGFSYIGTT-----SKQQIQVLKSKKCDYIHEALQQIEMAK  185

Query  197  lVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRP-----  251
              G  AC+EIV+QGE+L  +EQ+LS I  DL+  +KL+  ++ P  +FFS  +RP     
Sbjct  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-RSRPHDRAT  244

Query  252  ------KVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAELLNSE  305
                        HP     T   R +  +        +D+++LA AL +LEVQA+L+NSE
Sbjct  245  ISKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSE  304

Query  306  SGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
            +  S++QI RIE  LS + +R++ QT Q V T S    LF
Sbjct  305  AVKSNEQIARIEGQLSGINDRIQAQTSQ-VITSSGKQNLF  343

>CCI45123
Length=301

 Score = 197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 126/311 (41%), Positives = 186/311 (60%), Gaps = 24/311 (8%)

Query  49   LQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVM---GAADRPFGFKMVGHAP  105
            +QV+YYES+ +    N     PKGSF L N+E HEY I  M      +RPFGFKMVGHAP
Sbjct  1    MQVSYYESKDSYKNRNA---TPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57

Query  106  RKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQ  165
            ++G+VELDVFV++ ++ ++WL+V  N LKA +++ R+A    +    K + GFS   +T 
Sbjct  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTT-KGVLGFSFAGTT-  115

Query  166  PVMSPQKQMQTLATSKEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDR  225
                 ++Q++ L + K   + EAL++IE AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  116  ----SKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171

Query  226  DLDFGDKLLHRLKSPTLHFFSDD--------TRPKVPLGDHPHHSGSTSPSRLIPAIE-I  276
            DL+  +KL+  ++ P  +FFS          ++       H H +G     +    IE +
Sbjct  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231

Query  277  TRDAGV--SDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQA  334
              +  V  +DL++LA AL ELEVQA+L+NSE+  S+ QI RIE  LS + +R++ QT Q 
Sbjct  232  AEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQV  291

Query  335  VATLSAGPRLF  345
            VA+ S    LF
Sbjct  292  VAS-SGKKNLF  301

>SPRG_06336
Length=335

 Score = 186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/337 (36%), Positives = 189/337 (56%), Gaps = 40/337 (12%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
            TSCEGYVTKRGH  KSWR R++VLDG  L+V+YY+S+        +    KGSF L+ IE
Sbjct  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAEIE  67

Query  81   PHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLT  140
             H+Y     G   +P+GFK+VGHAP  G+ E  V+VET  D+ +WLEVA NAL   + +T
Sbjct  68   KHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVT  123

Query  141  RQA-IDQSVSPNKKKLFGFSVPS---STQPVMSPQKQMQTLATSKEGlllealreieaak  196
             QA +DQ  S     L G   PS   ++ PV     Q++ +  +KE LL +A+  +E A+
Sbjct  124  PQASVDQRASA----LLGHRAPSGFLTSAPV-----QLRNVNKTKEELLRKAIVTLEHAR  174

Query  197  lVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDT-------  249
             VG    +E+ +  E LD+ E ++  ++ +LD GD ++ ++ SP  ++FS          
Sbjct  175  TVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTG  234

Query  250  ----------RPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQA  299
                      +P+ P+ + P H  S+ P+    A   T DAG  +L +L++ L  LEV A
Sbjct  235  SPKSKSARSHQPQTPM-NSPTHKKSSGPAS--KAGGATTDAGDDELDQLSKILASLEVHA  291

Query  300  ELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVA  336
              +++E   +++QI+RI+  +    ER+ +Q+ +  A
Sbjct  292  NTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328

>SDRG_01781
Length=335

 Score = 172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 117/333 (35%), Positives = 180/333 (54%), Gaps = 32/333 (10%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
            TSCEGYVTKRGH  KSWR R++VLDG  L+V+Y++S+        +    KGSF L+ IE
Sbjct  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAEIE  67

Query  81   PHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLT  140
             H+Y     G   +P+GFK+VGHAP  G+ E  V+VET  D+ +WLEVA NAL  K    
Sbjct  68   KHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-GKNVAP  124

Query  141  RQAIDQSVSPNKKKLFGFSVPS---STQPVMSPQKQMQTLATSKEGlllealreieaakl  197
            + + DQ  +     L G    S   ++ PV     Q++ +  +KE LL +A+  +E A+ 
Sbjct  125  QASADQRATA----LLGHRAASGFLTSAPV-----QLRNVNKTKEELLRKAIVTLEHART  175

Query  198  VGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVPLG-  256
            VG    +E+ +  E LD+ E ++  +  +LD GD ++ ++ SP  ++FS     K   G 
Sbjct  176  VGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGS  235

Query  257  -------DHPHHSGSTSPSRLIPAIEI------TRDAGVSDLQRLAQALGELEVQAELLN  303
                    H   +   SP+   P+         T DAG  +L +L++ L  LEV A  ++
Sbjct  236  PKSKSARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTIS  295

Query  304  SESGHSSQQIERIEHHLSHVTERVEKQTKQAVA  336
            +E   +++QI+RI+  +    ERV +Q+ +  A
Sbjct  296  TEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328

>H310_09223
Length=333

 Score = 147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/338 (32%), Positives = 169/338 (50%), Gaps = 28/338 (8%)

Query  17   KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
            K   TSCEGYVTKRGH  K+W+ R++VL G  L VAYY+S+   +  NG    PKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE-IYKSNGP---PKGSFVL  62

Query  77   SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136
            S  E  +  +   G + +PFGFK +GH P +G+ E  VFVETQ D+ KWL VA NAL   
Sbjct  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120

Query  137  RQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreieaak  196
              +         SP+ +   G     S   ++S + Q++ +  +   LL +A+ + + A 
Sbjct  121  TYIP--------SPSMESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEAD  172

Query  197  lVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTL----HFFSDDTRPK  252
             +G    +E+  Q E L+  E  + A+ + +D  + L   +K P L    H FS     +
Sbjct  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKR  232

Query  253  VPLGDHPHHSG---STSPSRLIPAIEITR-------DAGVSDLQRLAQALGELEVQAELL  302
               G      G   ST  SR+   +++               L  L++ L +L   A+ +
Sbjct  233  GKRGASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTI  292

Query  303  NSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSA  340
            +  +  +++Q++RI+  ++ V ERV K+ K   + L A
Sbjct  293  SDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330

>H257_06294
Length=358

 Score = 144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 110/360 (31%), Positives = 180/360 (50%), Gaps = 47/360 (13%)

Query  17   KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
            K   TSCEGYVTKRGH  KSW+ R++VL+G  L V+YY+S+   +   G    PKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK-EIYTSKGH---PKGSFVL  62

Query  77   SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136
            S  E  +  +   GA+ +PFGFK +GH P +G+ E  V+VE+Q D+ KWL VA NAL  K
Sbjct  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL-GK  119

Query  137  RQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQK----------------------QM  174
                ++++ Q +    +++ G  +P ++  +  P++                      QM
Sbjct  120  NSSPQKSMSQRI----EEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQM  175

Query  175  QTLATSKEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLL  234
            + +  + + LL +A+ + + A  +G    NE+V Q + L+  E  +  + R +D  + L 
Sbjct  176  KNVKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLG  235

Query  235  HRLKSPTL----HFFSDDTRPKV--------PLGDHPHHSGSTSPSRLIPAIEITRDAGV  282
              LK P L    H F+     K           G     S   S  +L P  +    A  
Sbjct  236  RSLKHPILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQP  295

Query  283  SD--LQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSA  340
             D  L +L++ L +L   A+ ++  +  +++Q++RI+  ++ V +RV+K+ K   A L A
Sbjct  296  EDDQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355

>CCI45127
Length=202

 Score = 99.8 bits (247),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 116/204 (57%), Gaps = 17/204 (8%)

Query  153  KKLFGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreieaaklVGREACNEIVNQGEK  212
            K + GFS   +T      ++Q++ L + K   + EAL++IE AK  G  AC+EIV QGE+
Sbjct  5    KGVLGFSFAGTT-----SKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQ  59

Query  213  LDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDD--------TRPKVPLGDHPHHSGS  264
            L  +EQ+LS I+ DL+  +KL+  ++ P  +FFS          ++       H H +G 
Sbjct  60   LGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI  119

Query  265  TSPSRLIPAIE-ITRDAGV--SDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLS  321
                +    IE +  +  V  +DL++LA AL ELEVQA+L+NSE+  S+ QI RIE  LS
Sbjct  120  LHMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLS  179

Query  322  HVTERVEKQTKQAVATLSAGPRLF  345
             + +R++ QT Q VA+ S    LF
Sbjct  180  GINDRIQSQTTQVVAS-SGKKNLF  202

>PYAR_23286
Length=607

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 60/122 (49%), Gaps = 22/122 (18%)

Query  13   ASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKG  72
            A+ +  +P +C GY+TK+GH RKSW+ R+ VL GS+  V+YY      + P G+   P  
Sbjct  379  ATANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGK---PLA  433

Query  73   SFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNA  132
               + +++  +           PFGF  +        +   V+ + + +R KW+    NA
Sbjct  434  EVVIEDVQRWD---------GEPFGFMFMTSEQ----IPYYVYADNERERTKWM----NA  476

Query  133  LK  134
            L+
Sbjct  477  LR  478

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            CEG++TKRGH   +W++R+ VL G+ L+
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE  221

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 29/43 (67%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            +CEGY+T+RGH   S R  + VL+G++L     Q AY ++++A
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLRHYADQQAYRDNQSA  330

>HYAP_08645
Length=1514

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 56/117 (48%), Gaps = 19/117 (16%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ +L G NL ++YY      +   G    P     + +
Sbjct  304  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGR---PLAEVLVED  358

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
            ++  +           PFGF  + +      V   V+ +   +RNKW+  A N L A
Sbjct  359  VQSWD---------GEPFGFMFMTNEQ----VPYYVYADNDRERNKWMN-ALNKLNA  401

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            SCEGY+TKRGH   S R+ + VL+G++L     Q AY E+++A
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSA  249

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 49/126 (39%), Gaps = 34/126 (27%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+    E ++  +   G  T+ K           
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSGEEKSKKY---GAVTVEK-----------  158

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
               +         F F      P        V+  ++++R++WL           EV+C 
Sbjct  159  ---VATWSGEAHGFMFYTTKQIPYY------VYASSESERSRWLRALKDFMVETEEVSCE  209

Query  132  ALKAKR  137
                KR
Sbjct  210  GYLTKR  215

>PHYSO_361747
Length=1523

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 19/117 (16%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+   P     + +
Sbjct  410  EPVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGK---PLAEVLVED  464

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
            ++  +           PFGF  +        V   V+ +   +RNKW+  A N L A
Sbjct  465  VQKWD---------GEPFGFMFMTTEQ----VPYYVYADNDRERNKWMN-ALNKLNA  507

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 52/126 (41%), Gaps = 34/126 (27%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +      
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTV------  262

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
            E V    G A   F F      P        V+  ++++R++WL           EV+C 
Sbjct  263  EKVATWSGEA-HGFMFYTTKQIP------YYVYASSESERSRWLRVLKEYMVETEEVSCE  315

Query  132  ALKAKR  137
                KR
Sbjct  316  GYLTKR  321

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 29/43 (67%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            SCEGY+TKRGH   S R+ + VL+G++L     Q AY +++ A
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQLA  355

>PHYRA_84916
Length=1541

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 55/115 (48%), Gaps = 19/115 (17%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+   P     + +
Sbjct  401  EPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGK---PLAEVLVED  455

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            ++  +           PFGF  + +      V   V+ +   +RNKW+  A N L
Sbjct  456  VQKWD---------GEPFGFMFMTNEQ----VPYYVYADNDRERNKWMN-ALNKL  496

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  241

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  346

>PYIW_17381
Length=952

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 63/130 (48%), Gaps = 25/130 (19%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ +L G NL +AY+      +   G+   P     + +
Sbjct  402  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGK---PLAEVTVED  456

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
            ++  +           PFGF  +        V   V+ +   +RNKW+    NAL   R+
Sbjct  457  VQKWD---------GEPFGFMFMTSEQ----VPYYVYADNDRERNKWM----NAL---RK  496

Query  139  LTRQAIDQSV  148
            LT  A + +V
Sbjct  497  LTTVAEEPTV  506

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 50/126 (40%), Gaps = 34/126 (27%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            CEG++TKRGH   +W+ R+ VL G+ L+    E +   +          GS  ++ + P 
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFSGEDKGKRY----------GSVTVAKVAPW  260

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                   G A   F F      P        V+  ++ +R+KWL           EV C 
Sbjct  261  S------GEA-HGFMFYTTKQVP------YYVYASSEAERSKWLRALKEFVVEPEEVGCE  307

Query  132  ALKAKR  137
                +R
Sbjct  308  GYLTRR  313

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 5/42 (12%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            CEGY+T+RGH   S R+ + VL+G++L     Q AY E+++A
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSA  347

>PYIR_21589
Length=1568

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 65/136 (48%), Gaps = 26/136 (19%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ +L G NL +AYY      +   G +        L+ 
Sbjct  402  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYYPDYDLANSAKGRA--------LAE  451

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
            +     V  V      PFGF  +        V   V+ +   +RNKW+    NAL   R+
Sbjct  452  VT----VEDVQKWDGEPFGFMFMTSEQ----VPYYVYADNDRERNKWM----NAL---RK  496

Query  139  LTRQAIDQSVSPNKKK  154
            LT  A ++  S  KK+
Sbjct  497  LTTVA-EEPTSLEKKR  511

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 51/126 (40%), Gaps = 34/126 (27%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            CEG++TKRGH   +W+ R+ VL G+ L+    E +   +          GS  ++ + P 
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFAGEDKGKRY----------GSVTVAKVAPW  260

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                   G A   F F      P        V+  ++ +R+KWL           EV+C 
Sbjct  261  S------GEA-HGFMFYTTKQIPYY------VYAASEAERSKWLRALKEFVVEPEEVSCE  307

Query  132  ALKAKR  137
                +R
Sbjct  308  GYLTRR  313

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            SCEGY+T+RGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  305  SCEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRDNQSA  347

>CCI39367
Length=2046

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 31/121 (26%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G++ K+GH  KSWRVRF VL  DG+   +AYY  R       G+  M KG      I+ +
Sbjct  86   GWLRKQGHLWKSWRVRFFVLYTDGT---LAYYRKR-------GDVKM-KGY-----IKLN  129

Query  83   EYVIGVM----GAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
            E +IG+        +R + F++     RKGF  L    +TQ +   W+ V    L++ RQ
Sbjct  130  EGIIGIQYIDAWKTNRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVSV----LRSTRQ  180

Query  139  L  139
            L
Sbjct  181  L  181

>PHYKE_1990
Length=1499

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 54/115 (47%), Gaps = 19/115 (17%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P +C GY+TK+GH RKSW+ R+ +L GS   ++YY      +   G++        L+ 
Sbjct  402  EPVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKA--------LAE  451

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            +     V  V      PFGF  +        V   V+ +   +RNKW+  A N L
Sbjct  452  V----LVEDVQRWDGEPFGFMFMTSEQ----VPYYVYADNDRERNKWMN-ALNKL  497

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 51/126 (40%), Gaps = 34/126 (27%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +      
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVMV------  254

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
            E V    G A   F F      P        V+  ++ +R+KWL           EV+C 
Sbjct  255  EKVATWSGEA-HGFMFYTTKQIPYY------VYASSEAERSKWLRALKEFMVETEEVSCE  307

Query  132  ALKAKR  137
                KR
Sbjct  308  GYLTKR  313

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLRHYADQQAYRDNQSA  347

>PYU1_G006347
Length=1095

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 55/115 (48%), Gaps = 22/115 (19%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ +L G NL ++YY      +   G+   P     + +
Sbjct  391  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGK---PLAEVAVED  445

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            ++  +           PFGF  +        V   V+ +   +RNKW+    NAL
Sbjct  446  VQKWD---------GEPFGFMFMTSEQ----VPYYVYADNDRERNKWM----NAL  483

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 48/126 (38%), Gaps = 34/126 (27%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            CEG++TKRGH   +W+ R+ VL G  L+  Y+           E     GS  ++ + P 
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE--YFSGE--------EKNKKYGSVTVAKVAP-  248

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                         F F      P        V+  ++ +R+KWL           EV+C 
Sbjct  249  ------WSGEAHGFMFYTTKQIP------YYVYAASEAERSKWLRALKEFVVEPEEVSCE  296

Query  132  ALKAKR  137
                +R
Sbjct  297  GYLTRR  302

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            SCEGY+T+RGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASLRHYADQSAYRDNQSA  336

>H310_00231
Length=1495

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 50/108 (46%), Gaps = 18/108 (17%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            QP +C G++TK+GH RKSW+ R+ VL G+ L  AYY    A    N   + P G   +  
Sbjct  348  QPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDAS---NMRHSRPLGEVTVRE  402

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
            +   +           P GF  V +      V   VF + + D+ KWL
Sbjct  403  VSTWD---------GEPGGFMFVTN----DNVPYYVFADNERDQAKWL  437

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            CEGY+TKRGH   S+R+R+ VL G++++
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK  278

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 44/105 (42%), Gaps = 26/105 (25%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK--GSFYLSNIEPH  82
            GY+TKRGH   +W+ RF VL     +++YY           +  M K  G  +L  + P 
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYY----------ADEGMKKKLGEVHLEKVSPW  205

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLE  127
                   G A+   GF           +   V+  T ++R +WLE
Sbjct  206  S------GEAN---GFMFYTSKQ----IAYYVYASTNSERRRWLE  237

>PYVX_20438
Length=1346

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 65/136 (48%), Gaps = 27/136 (20%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P +C GY+TK+GH RKSW+ R+ +L G++  ++Y+      +   G++        L+ 
Sbjct  315  EPVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGKA--------LAE  364

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
            +     V  V      PFGF  +        V   V+ +   +RNKW+    NAL   R+
Sbjct  365  VT----VEDVQRWDGEPFGFMFMTSEQ----VPYYVYADNDRERNKWM----NAL---RK  409

Query  139  LTRQAIDQSVSPNKKK  154
            L   A+D+     KK+
Sbjct  410  L--NAVDEEPEAEKKR  423

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L+  Y+ S
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS  154

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            SCEGY+TKRGH   S R+ + VL G+ L     Q AY E+++A
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA  260

>H257_06722
Length=1482

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 55/115 (48%), Gaps = 20/115 (17%)

Query  13   ASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKG  72
            A+    QP +C G++TK+GH RKSW+ R+ VL G+ L  AYY    A +  +G+   P G
Sbjct  342  ATDKPMQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGK---PLG  396

Query  73   SFYLSNIEPHEYVIGVMGAAD-RPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
                      E  +  + A D  P GF  + +      V   VF +   D+ KWL
Sbjct  397  ----------EVTVREVSAWDGEPSGFMFITN----DSVPYYVFADNDRDQAKWL  437

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
            CEGY+TKRGH   S+R+R+ VL GS ++  YY    A
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGSTIK--YYADETA  285

 Score = 38.5 bits (88),  Expect = 0.068, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 51/119 (43%), Gaps = 28/119 (24%)

Query  13   ASGDKAQPTS--CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMP  70
            AS D + P+     GY+TKRGH   +W+ RF VL     +++YY           +  M 
Sbjct  143  ASMDSSAPSGILASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYY----------ADEGMK  191

Query  71   K--GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLE  127
            K  G  +L  + P        G A+   GF    +      +   V+  T ++R +WL+
Sbjct  192  KKLGEVHLEKVSPWS------GEAN---GFMFYTNKQ----IAYYVYASTNSERRRWLD  237

>PPTG_18898
Length=1559

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 54/115 (47%), Gaps = 22/115 (19%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+   P     + +
Sbjct  404  EPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGK---PLAEVLVED  458

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            ++  +           PFGF  + +      V   V+ +   +R KW+    NAL
Sbjct  459  VQKWD---------GEPFGFMFMTNEQ----VPYYVYADNDRERTKWM----NAL  496

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 51/126 (40%), Gaps = 34/126 (27%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +  + P 
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  262

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                   G A   F F      P        V+  ++ +R++WL           +V+C 
Sbjct  263  S------GEA-HGFMFYTTKQIPYY------VYASSEAERSRWLRALKDFMVETEDVSCE  309

Query  132  ALKAKR  137
                KR
Sbjct  310  GYLTKR  315

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  349

>SPRG_06059
Length=1312

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 48/108 (44%), Gaps = 21/108 (19%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ VL G  L  AYY             +M K S     
Sbjct  222  KPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYYADY---------DSMNKQSLAEVG  270

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
            +E      G        FGF+ +        V   VF E+  +R KW+
Sbjct  271  VEDVALWDG------EQFGFQFITTEQ----VPYYVFAESDRERQKWM  308

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 61/152 (40%), Gaps = 33/152 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK--GSFYLSNIE  80
            C GY+TKRGH   +W+ RF VL    + + YY           + +M K  G  +L  + 
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYY----------ADESMAKKLGQVHLVKVA  60

Query  81   PHEYVIGVM---------GAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----  126
            P EYV             G+ +  FGF M     R  +    V+     +R KWL     
Sbjct  61   PWEYVSATTANSILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWLLALQD  116

Query  127  --EVACNALKAKRQLTRQAIDQSVSPNKKKLF  156
               V  NA   +  LT++    S   ++ K +
Sbjct  117  LYVVTSNATDCEGYLTKRTPGFSFLSSRPKYY  148

>PITG_20562
Length=1559

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 54/115 (47%), Gaps = 22/115 (19%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+   P     + +
Sbjct  405  EPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGK---PLAEVLVED  459

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            ++  +           PFGF  + +      V   V+ +   +R KW+    NAL
Sbjct  460  VQKWD---------GEPFGFMFMTNEQ----VPYYVYADNDRERTKWM----NAL  497

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 51/126 (40%), Gaps = 34/126 (27%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +  + P 
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  263

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                   G A   F F      P        V+  ++ +R++WL           EV+C 
Sbjct  264  S------GEA-HGFMFYTTKQIP------YYVYASSEAERSRWLRALKDFMVETEEVSCE  310

Query  132  ALKAKR  137
                KR
Sbjct  311  GYLTKR  316

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  350

>SPRG_06058
Length=1258

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 64/137 (47%), Gaps = 22/137 (16%)

Query  17   KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
            K  P +C G++TK+GH RKSW+ R+ VL G+ L  +YY    A +   G++        L
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANTRAGKA--------L  192

Query  77   SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136
            S++   +  +G        F F  + + P        VF + + D+ KW+     A+ A 
Sbjct  193  SDVSLKD--VGPWDGEACGFMFTTLENVPYY------VFADNERDQAKWMSALKKAVGAD  244

Query  137  RQLTRQAIDQSVSPNKK  153
              L  + ID+   P KK
Sbjct  245  -TLAIETIDE---PEKK  257

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 2/51 (4%)

Query  9   PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
           PGA      A+P  CEGY+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  33  PGARRLLHCARPVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  81

>SDRG_12763
Length=1317

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 49/108 (45%), Gaps = 21/108 (19%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P SC GY+TK+GH RKSW+ R+ VL G+ L  +YY             +M K S     
Sbjct  220  KPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYYSDY---------DSMNKQSLAEVG  268

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
            +E      G        FGF+ +        V   VF E+  +R KW+
Sbjct  269  VEDVALWDG------EQFGFQFITTEQ----VPYYVFAESDRERQKWM  306

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 60/152 (39%), Gaps = 33/152 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK--GSFYLSNIE  80
            C GY+TKRGH   +W+ RF VL    + + YY           + +M K  G  +L  + 
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYY----------ADDSMVKKLGQVHLVKVA  58

Query  81   PHEYVIGVMGAA---------DRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----  126
            P EY     G +         +  FGF M     R  +    V+     +R +WL     
Sbjct  59   PWEYFSATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQD  114

Query  127  --EVACNALKAKRQLTRQAIDQSVSPNKKKLF  156
               V  NA   +  LT++    S   ++ K +
Sbjct  115  LYVVTSNATDCEGYLTKRTPGFSFLSSRPKYY  146

>CCI44752
Length=1526

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 55/115 (48%), Gaps = 18/115 (16%)

Query  12   TASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
            T + +  +P +C GY+TK+GH RKSW+ R+ +L G+   ++YY+     +   G++    
Sbjct  407  TTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANNAKGKA----  460

Query  72   GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
                L+ ++    V  V       FGF  +        V   V+ + + +R KW+
Sbjct  461  ----LAEVQ----VEDVQKWDGEAFGFMFMTTEQ----VPYYVYADNERERKKWM  503

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 50/125 (40%), Gaps = 34/125 (27%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGY+TKRGH   +W+ RF VL G+ L+  YY S         E T   GS  ++ + P  
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPWS  272

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACNA  132
                  G A   F F      P        V+  ++ ++ KWL           EV C  
Sbjct  273  ------GEA-HGFMFYTTKQIPYY------VYAASEAEKTKWLRALREFYVEPDEVTCEG  319

Query  133  LKAKR  137
               +R
Sbjct  320  YLTRR  324

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            +CEGY+T+RGH   S RV + VL G+ L     Q AY ++ +A
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLRHYADQQAYRDNDSA  358

>PYAP_16997
Length=1018

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 25/128 (20%)

Query  13   ASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKG  72
            A+ +  +P +C GY+TK+GH RKSW+ R+ VL G++  + Y+      +   G++     
Sbjct  392  ATANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSNKGKA-----  444

Query  73   SFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNA  132
               L+ +     V  V      PFGF  +        V   V+ + + +R KW+    NA
Sbjct  445  ---LAEV----IVEDVQRWDGEPFGFMFMTSEQ----VPYYVYADNERERGKWM----NA  489

Query  133  LKAKRQLT  140
            L   R+LT
Sbjct  490  L---RKLT  494

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            +CEG++TKRGH   +W++R+ VL G+ L+
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE  234

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 29/43 (67%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            +CEG++T+RGH   S R  + VL+G++L     Q AY ++++A
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLRHYADQQAYRDNQSA  343

>H257_06721
Length=1238

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query  15   GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
            G   QP +C GY+TK+GH RKSW+ R+ VL GS L  +YY
Sbjct  224  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  261

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 11/63 (17%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK-GSFYLSNIEP  81
           C GY+TKRGH   +W++R+ VL   +  ++YYE          ES   K G  +L+ + P
Sbjct  14  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYED---------ESMAKKLGQVHLAKVAP  63

Query  82  HEY  84
            EY
Sbjct  64  WEY  66

>PHYKE_2479
Length=171

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 7/53 (13%)

Query  5    RLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            R P   +T+S  K      EGYVTKRGH  ++W++RF  L+G NL V+YYE++
Sbjct  62   RPPHSNSTSSRSK-----WEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  107

>PYU1_G001063
Length=783

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  +YYES+ 
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKV  179

>PPTG_13401
Length=927

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 8/56 (14%)

Query  9    PGATASGDKAQPT------SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            P + +SGD A  +        EGYVTKRGH  ++W++RF  L+G NL V+YYE++ 
Sbjct  88   PDSMSSGDNAVESLDLPMVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PYIR_15309
Length=937

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
             EGYVTKRGH  ++W+ RF  L+G+NL  +YYES+ 
Sbjct  147  WEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  180

>PYAP_17290
Length=835

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
             EGYVTKRGH  ++W++RF  L+G+NL  +YYE++ 
Sbjct  152  WEGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKV  185

>PYIW_13172
Length=939

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  +YYES+ 
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  182

>H310_00230
Length=1248

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query  15   GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
            G   QP +C GY+TK+GH RKSW+ R+ VL G+ L  +YY
Sbjct  218  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYY  255

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 35/64 (55%), Gaps = 13/64 (20%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK--GSFYLSNIE  80
           C GY+TKRGH   +W++RF VL   +  ++YYE          + +M K  G  +L+ + 
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYE----------DESMSKKLGQVHLAKVA  60

Query  81  PHEY  84
           P EY
Sbjct  61  PWEY  64

>PITG_18067
Length=924

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 8/56 (14%)

Query  9    PGATASGDKAQPT------SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            P + +SGD A  +        EGYVTKRGH  ++W++RF  L+G NL V+YYE++ 
Sbjct  88   PESMSSGDNAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>CCA18875
Length=1514

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 66/143 (46%), Gaps = 27/143 (19%)

Query  12   TASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
            T + +  +P +C GY+TK+GH RKSW+ R+ +L G+   ++YY+     +   G++    
Sbjct  407  TLTTNVVEPVTCAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANHVKGKA----  460

Query  72   GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACN  131
                L+ ++    V  V       FGF  +        V   V+ + + +R KW      
Sbjct  461  ----LAEVQ----VEDVQKWDGEAFGFMFMTTEQ----VPYYVYADNERERKKW------  502

Query  132  ALKAKRQLTRQAIDQSVSPNKKK  154
             + A R+L+   +D+     KK+
Sbjct  503  -MSALRKLS--TLDEDTETEKKR  522

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 51/125 (41%), Gaps = 34/125 (27%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGY+TKRGH   +W+ RF VL G+ L+  YY S         E T   GS  ++ + P  
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPWS  272

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACNA  132
                  G A   F F      P        V+  ++T++ KWL           EV C  
Sbjct  273  ------GEA-HGFMFYTTKQIPYY------VYAASETEKAKWLRALREFYVEPDEVTCEG  319

Query  133  LKAKR  137
               +R
Sbjct  320  YLTRR  324

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
            +CEGY+T+RGH   S RV + VL G+ L     Q AY ++ +A
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLRHYADQQAYRDNDSA  358

>PYIW_21108
Length=2593

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (50%), Gaps = 8/129 (6%)

Query  6     LPEPGATASGDKAQPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLQVAYYESRAACHPPN  64
             + +   ++ G  A+    EGYV  R HF  + WR RF VL+G+ L + Y +S AA     
Sbjct  2139  ISQSAKSSGGASAKRDQFEGYVRVRHHFLGAIWRERFAVLEGTRL-LLYTDSSAAMDEDR  2197

Query  65    GESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNK  124
               + + K    ++  + H      +G+  R FGF++   A   G++E    V T+ ++ K
Sbjct  2198  ERTALEKHDL-IAVEKWHPTYSANLGSGSR-FGFRVENEA--GGYLECT--VTTEDEQTK  2251

Query  125   WLEVACNAL  133
             WL V  +A+
Sbjct  2252  WLAVVSDAV  2260

 Score = 31.6 bits (70),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 30/69 (43%), Gaps = 4/69 (6%)

Query  6     LPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
             L   G +  G   +    EGY+ KRGH   S R R+ VL   N  + Y+ +      P  
Sbjct  1216  LSATGDSQPGGGLREALMEGYLVKRGHLIPSMRKRYCVL-LKNASLEYFATHEDSRNP--  1272

Query  66    ESTMPKGSF  74
              +  P GSF
Sbjct  1273  -AIRPHGSF  1280

>CCA15513
Length=1341

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 31/121 (26%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G+++K+GH  K WR RF VL  DG+   +AYY  R       G   M KG      I+ +
Sbjct  86   GWLSKQGHLWKGWRSRFFVLYADGT---LAYYRRR-------GNVKM-KGY-----IKLN  129

Query  83   EYVIGV----MGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
            E +IG+    +    R + F++     RKGF  L    +TQ +   W+    N L++ R 
Sbjct  130  EGIIGIQYIDVWKTSRAYSFEI-----RKGFYRLLCHAQTQLEAEVWV----NHLRSARH  180

Query  139  L  139
            L
Sbjct  181  L  181

>PHYRA_77834
Length=936

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 8/55 (15%)

Query  9    PGATASGDKAQPT------SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            P ++ SGD A  +        EGYVTKRGH  ++W++RF  L+G NL V+YYE++
Sbjct  98   PPSSLSGDHAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  150

>PYAR_19914
Length=788

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  +YYE++ 
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKV  178

>PYVX_13574
Length=950

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            EGYVTKRGH  ++W++RF  L+G NL V+YYES+ 
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYESKV  191

>CCI41225
Length=981

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            EGYVTKRGH  ++W++RF  L+G+ L  +YYES+ 
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESKV  172

>CCA26890
Length=1530

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 11/110 (10%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
            GY+ KRG   KS+R R++ L+G+ L  +YY+ + +        T P+GS  L N+     
Sbjct  297  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENVTS---  351

Query  85   VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
             +  + +    +G  +V  +     V      E +++ ++WL+  CNA++
Sbjct  352  -LQPLESKTEKYGIVLVTTSRTWELV-----AENESEYHRWLKELCNAVE  395

>PYIR_17453
Length=2619

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 7/112 (6%)

Query  23    CEGYVTKRGHFR-KSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEP  81
             CEGYV  R HF   +WR RF VL+ + L + Y ++ AA      +  + K    ++  + 
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL-YPDTSAALSEGREQKALEKHDL-IAVKKW  2217

Query  82    HEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
             H      +G     FGF++   A   G++E  V +E +  + KWL    NA+
Sbjct  2218  HPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIEDE--QTKWLAAITNAV  2265

 Score = 33.1 bits (74),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 33/69 (48%), Gaps = 8/69 (12%)

Query  9     PGATASGDKA---QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
             PG   SG +A   +    EGY+ KRGH   S R R+ VL  + L+  Y+ +      P  
Sbjct  1204  PGDDDSGSEAGSNRQILMEGYLVKRGHLIPSMRKRYCVLVKNTLE--YFATHEDSRNP--  1259

Query  66    ESTMPKGSF  74
              +  P GSF
Sbjct  1260  -AIRPHGSF  1267

>PHALS_06533
Length=930

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 8/54 (15%)

Query  11   ATASGDKAQPT------SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
             T  GD+A  +        EGYVTKRGH  ++W++RF  L+G NL V+YYE++ 
Sbjct  92   VTMGGDQAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  143

>H257_09270
Length=884

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 54/129 (42%), Gaps = 8/129 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGY+ KR  + K W   + VL G  L     +  A  HP N  S +  G F  S+    +
Sbjct  86   EGYLMKRSDWLKHWETYYFVLHGRVLYCYLSDEEAKLHPEN--SKIKHGKFTFSDNLILD  143

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
             VI V       F F+       KG  ++ +  +T+  +  W+ +AC+ +     L  Q 
Sbjct  144  EVITVQSRLTYEFVFES-----DKG-KQIHLRAKTEASKQMWMHMACHGIVDTEMLRNQV  197

Query  144  IDQSVSPNK  152
            +    +P +
Sbjct  198  LHMRRTPQR  206

>SDRG_12762
Length=1392

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 62/138 (45%), Gaps = 24/138 (17%)

Query  17   KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
            K  P +C G++TK+GH RKSW+ R+ VL G+ L  +Y+    A +   G++        +
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAANTRLGKAL---SEVSV  408

Query  77   SNIEPHE-YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
             ++ P +  V G M        F  + + P        VF + + D+ KW+     ALK 
Sbjct  409  KDVAPWDGEVCGFM--------FVTLENVPYY------VFADNERDQAKWM----TALKK  450

Query  136  KRQLTRQAIDQSVSPNKK  153
               L    ++    P KK
Sbjct  451  AVGLDAPTLETPDEPEKK  468

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
            P  CEGY+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  255  PVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  292

 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 27/105 (26%), Positives = 43/105 (41%), Gaps = 24/105 (23%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK-GSFYLSNIEPHE  83
            GY+TKRGH   +W+ RF  L  S  +++YY         N E    K G  ++S + P  
Sbjct  164  GYLTKRGHVITNWKTRFFALR-SQGRLSYY---------NDEGMGKKLGEVHVSKVSP--  211

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
                        F F+          +   V+  + T+R +WL+ 
Sbjct  212  -----WSGETNGFMFQTTKQ------ISYYVYASSNTERARWLKA  245

>CCI42457
Length=906

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            EGYV KRGH  ++W++RF  L+G+  +V+YYES+ 
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESKG  162

>PHYCA_503112
Length=214

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            EGYVTKRGH  ++W+ RF  L+G NL V+YYE++
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEG-NL-VSYYENK  148

>CCA16487
Length=975

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            EGYVTKRGH  ++W++RF  L+G+ L  +YYE++ 
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKV  170

>CCA17102
Length=884

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            EGYV KRGH  ++W++RF  L+G+ L  +YYES+ 
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESKG  142

>PYIR_18382
Length=1154

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/151 (26%), Positives = 63/151 (42%), Gaps = 32/151 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L   YY ++         +   +G   +S + P  
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEAR----SARNLRGRMIISKVRPEN  182

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
            Y         +  GF +      KG     +   T+ +++ W+E           + + A
Sbjct  183  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVE-----------MMQAA  219

Query  144  IDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
            ID+ V   K  L G SV   T P+ +   Q+
Sbjct  220  IDEGV---KHSLNGSSVDPETLPIQNSPTQV  247

>PHYRA_94409
Length=1270

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/152 (24%), Positives = 71/152 (47%), Gaps = 23/152 (15%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  113  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  166

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                  +  AD+ + F++      KGF +L  +  +Q +   W+     AL++ R++T  
Sbjct  167  ------VRVADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVA----ALRSVRRVTPP  211

Query  143  AIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
              +  ++  ++K    +V      +    KQ+
Sbjct  212  CYETDLTATEEKAGSNAVTRHLNKIFITDKQI  243

>PPTG_19371
Length=1195

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 61/143 (43%), Gaps = 26/143 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L   YY S+             +G   +S + P  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  124

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK-----AKRQ  138
            Y         +  GF +      +G     +   T+ +++ W+E+   A++     A  +
Sbjct  125  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  172

Query  139  LT---RQAIDQSVSPNKKKLFGF  158
            L+    +A+    SP +  L GF
Sbjct  173  LSMEGMEALQMQTSPTQVDLRGF  195

>PYAP_18636
Length=1009

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 68/161 (42%), Gaps = 33/161 (20%)

Query  13   ASGDKAQPTSC------EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGE  66
            ASG    PT        EGYV K+G +   W  R+LVLDG+ L   YY ++      +G 
Sbjct  86   ASGATDAPTGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEAR--SGR  141

Query  67   STMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
            +   +G   +S + P  Y     G A   F  + +GH          +   T+ +++ W+
Sbjct  142  NL--RGRMIISKVRPENY-----GKAHG-FLLETMGHK------HFHLCCSTELEKDMWV  187

Query  127  EVACNALK--AKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQ  165
            E+   A+    K +L R  I  +   N +       PS TQ
Sbjct  188  EMMQAAIDEGVKHKLERSLISSADVANAQ-------PSPTQ  221

>PHYRA_82543
Length=1199

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/143 (24%), Positives = 60/143 (42%), Gaps = 26/143 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L   YY S+             +G   +S + P  
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  114

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTR--  141
            Y         +  GF +      +G     +   T+ +++ W+E+   A++   + T+  
Sbjct  115  Y--------GKAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQAAIEEGVRHTQSS  162

Query  142  ------QAIDQSVSPNKKKLFGF  158
                  +A+    SP +  L GF
Sbjct  163  MSMEGMEALQMQSSPTQVDLRGF  185

>CCI10928
Length=1530

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/125 (25%), Positives = 60/125 (48%), Gaps = 12/125 (10%)

Query  10   GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTM  69
            GA A   K    +  GY+ KRG   KS+R R++ L G+ L  +YY+ + +        T 
Sbjct  288  GAKAC-QKGTEVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKSREENKTY  344

Query  70   PKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVA  129
             +GS +L ++      +  + +    +G  +V  +        ++ VE + + ++WL+  
Sbjct  345  LRGSIHLESVTS----LQPLESKTEKYGVVLVTTSR-----TWELVVENEIEYHRWLKEL  395

Query  130  CNALK  134
            CNA++
Sbjct  396  CNAVE  400

>PITG_11303
Length=293

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L+  YY S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  245

>PYU1_G008848
Length=765

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 62/151 (41%), Gaps = 32/151 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L   YY ++             +G   +S + P  
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL----RGRMIISKVRPEN  187

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
            Y         +  GF +      KG     +   T+ +++ W+E           + + A
Sbjct  188  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVE-----------MMQAA  224

Query  144  IDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
            ID+ V   K  + G S+ S   PV +   Q+
Sbjct  225  IDEGV---KHSVNGNSMDSDVVPVQNSPTQV  252

>CCI10489
Length=777

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            T  EGY+ KRGH  +SWR RF VL G+ L  +YY S+
Sbjct  104  TDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSK  138

>PHYSO_248481
Length=1283

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 70/152 (46%), Gaps = 23/152 (15%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  92   GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  145

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                  +  AD+ + F++      KGF +L  +  +Q +   W+     AL++ R++   
Sbjct  146  ------IRLADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVA----ALRSVRRVAPP  190

Query  143  AIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
              +  ++  ++K    +V      +    KQ+
Sbjct  191  CYEMDLTATEEKAGSNAVTRHLNKIFITDKQI  222

>PHALS_06699
Length=884

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 56/133 (42%), Gaps = 14/133 (11%)

Query  12   TASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
            T++ D A   S  G++ KRGH  K+W+ R+ VL  S L+   Y S A C    GE  +  
Sbjct  325  TSAFDDAFLDSMSGWLRKRGHVCKNWKDRYFVLHKSVLR---YYSDACCTKLKGEVLLFH  381

Query  72   GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACN  131
                +  ++ H     V G  D  F  + VG         L +  E  +DR  W+    +
Sbjct  382  PQTCVHYVDVH-----VTGGRDASFAIQ-VGSE-----YTLLLQAERLSDRENWMYCIED  430

Query  132  ALKAKRQLTRQAI  144
            AL  +     Q +
Sbjct  431  ALLCRDSYQNQQV  443

>HYAP_06101
Length=984

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 23/132 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  143  GWLTKQGHLWKSWKTRFFVLFADGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  196

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                  +  A++ + F++      KGF +L  +  +Q +   W+     AL++ R++   
Sbjct  197  ------IRVAEKAYAFQI-----EKGFYKLLCYCCSQFEAEIWVA----ALRSVRRVAPP  241

Query  143  AIDQSVSPNKKK  154
              +  ++  ++K
Sbjct  242  CYEMDLTSTEEK  253

>H257_09823
Length=654

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (54%), Gaps = 2/52 (4%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
            G++ K GH RK+W+ RF VLDGS LQ  Y+        P  ++   KG   L
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ--YFTDDVDATTPKSKTHKLKGEVLL  314

>PHYSO_544598
Length=1163

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 34/144 (24%), Positives = 61/144 (42%), Gaps = 27/144 (19%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L   YY S+             +G   +S + P  
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  72

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK------AKR  137
            Y         +  GF +      +G     +   T+ +++ W+E+   A++      A  
Sbjct  73   Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGAHS  120

Query  138  QLT---RQAIDQSVSPNKKKLFGF  158
            +++    +A+    SP +  L GF
Sbjct  121  RVSMEGMEALQMQASPTQVDLRGF  144

>PYAR_15463
Length=1091

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 55/128 (43%), Gaps = 29/128 (23%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L   YY S+      +G +   +G   +S + P  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEAR--SGRNL--RGRMIISKVRPEN  131

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
            Y         +  GF +      KG     +   T+ +++ W+E           + + A
Sbjct  132  Y--------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVE-----------MMQAA  168

Query  144  IDQSVSPN  151
            ID+ V  N
Sbjct  169  IDEGVKHN  176

>SDRG_00080
Length=298

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 53/117 (45%), Gaps = 26/117 (22%)

Query  14   SGDKA--QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
            SG++A   P +  GYV K+G F K+W+ R++VL    L   YY S  A       +T P+
Sbjct  62   SGNEAPSGPPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERA-------TTKPR  112

Query  72   GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRK-GFV-----ELDVFVETQTDR  122
            G F          V G+  A D P G    G   R+  F      E D + +T ++R
Sbjct  113  GFF---------RVTGIAYAPDLPHGLIADGTGTRRLKFTLADNDECDAWYDTLSER  160

>PYVX_18338
Length=746

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query  9    PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            P    S + A  T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  67   PDVHGSIEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  113

>PITG_17893
Length=747

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query  16   DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C    GE  +     +
Sbjct  212  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCAKLKGEVLL-----F  263

Query  76   LSNIEPHEYVIGVMGAADRPFGFKM  100
                  H   + V G  D  F  ++
Sbjct  264  HPQTRVHYVDVHVAGGRDASFAIQV  288

>PYVX_13312
Length=1016

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 48/105 (46%), Gaps = 18/105 (17%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L   YY S+      +G +   +G   LS + P  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAALT--YYNSKDEAR--SGRNL--RGRMQLSRVRPEN  129

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
            Y         +  GF +      +G     +   T+ +++ W+E+
Sbjct  130  Y--------GKAHGFLI----ETRGHKSFHLCCTTELEKDMWVEM  162

>PHALS_04098
Length=1183

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 71/164 (43%), Gaps = 24/164 (15%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            M+ L +    A+ +         EGYV K+G +   W  R+L+LDG+ L   YY S+   
Sbjct  52   MDDLAMNSSVASTTAFMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEA  109

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
                      +G   +  + P  Y         +  GF +   + +    +  +   T+ 
Sbjct  110  RSARNM----RGRMTVYKVRPENY--------GKAHGFLLETQSHK----QFHLCCATEL  153

Query  121  DRNKWLEVACNALK--AKRQLTRQAID----QSVSPNKKKLFGF  158
            +++ W+E+   A++  A+++ +R +++      +SP +  L GF
Sbjct  154  EKDMWVEMMHAAVEEGARQRNSRLSVEGMEILQISPTQVDLRGF  197

>PITG_19213
Length=1201

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 34/143 (24%), Positives = 61/143 (43%), Gaps = 26/143 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L   YY S+             +G   ++ + P  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIINKVRPEN  124

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK-----AKRQ  138
            Y         +  GF +      +G     +   T+ +++ W+E+   A++     A  +
Sbjct  125  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  172

Query  139  LT---RQAIDQSVSPNKKKLFGF  158
            L+    +A+    SP +  L GF
Sbjct  173  LSMEGMEALQLQTSPTQVDLRGF  195

>PPTG_04553
Length=904

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query  16   DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C    GE  +     +
Sbjct  355  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYADSSCTKLKGEVLL-----F  406

Query  76   LSNIEPHEYVIGVMGAADRPFGFKM  100
                  H   + V G  D  F  ++
Sbjct  407  HPQTRVHYVDVHVAGGRDASFAIQV  431

>PHYSO_556164
Length=765

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 55/135 (41%), Gaps = 14/135 (10%)

Query  16   DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C    GE  +     +
Sbjct  214  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCSKLKGEVLL-----F  265

Query  76   LSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
                  H   + V G  D  F  ++    P      L +      DR  W+    +AL  
Sbjct  266  HPQTRVHYVDVHVAGGRDASFAIQV---GPD---YTLLLQAAQLRDRENWMYCIEDALLC  319

Query  136  KRQLTRQAIDQSVSP  150
            +     Q + +   P
Sbjct  320  RDSYHPQGMTEGPEP  334

>PHALS_03540
Length=904

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 8/79 (10%)

Query  4   LRLPEPGATASGDKAQPTSCE--GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH  61
           L+       A+G  A+ + C+  G+  K+G   KSW+ RF VL G  L   Y+E R+   
Sbjct  23  LKATSRNVIAAGRVARSSYCDHSGWGYKQGSIIKSWKRRFFVLKGREL--IYFEERS---  77

Query  62  PPNGESTMPKGSFYLSNIE  80
            P+G+    KG   +S +E
Sbjct  78  -PSGKGIDEKGRLRISGVE  95

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 58/138 (42%), Gaps = 25/138 (18%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P  C G++ K G   K+W+ R+  L G+ L   Y++S               G+   S 
Sbjct  782  EPVVCSGWLRKEGGTVKNWKRRYFTLHGATL--CYFKS-------------DNGALLRSF  826

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
               H     V+    +    ++     RK    L V  ETQ D ++WL+    A+ A++Q
Sbjct  827  TVCH-----VVTLRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAIAAEKQ  877

Query  139  LTRQAIDQSVSPNKKKLF  156
              +Q  D S   N+ + +
Sbjct  878  -KKQNTDSSQWTNELRCW  894

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            CEG++ KRG     W+ R+ +L G  LQ
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>H310_00912
Length=2182

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 65/133 (49%), Gaps = 21/133 (16%)

Query  17    KAQPTS---CEGYV-TKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKG  72
             ++QP+S    EG+V  +R HF  +W+  + VL G  L  A Y++R       G+ T  + 
Sbjct  1787  QSQPSSEIFLEGFVHLRRSHFGAAWKEHYCVLKGPWL--ATYDTREDFATAPGKPTSKRE  1844

Query  73    SFYLSNIEPHEYVIGV-MGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKW---LEV  128
               ++ +     +  GV  G A   F  + +      GFVE   +V+   D+ +W   L+ 
Sbjct  1845  VVFVGD-----WYGGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQT  1893

Query  129   ACNALKAKRQLTR  141
             A ++LKA + +TR
Sbjct  1894  AVSSLKADQLVTR  1906

>SPRG_09128
Length=620

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 14/129 (11%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
            G++ K GH RKSW+ RF VLDGS LQ  YY    +      ++   KG   L + +    
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YYTDDVS----KVKTPKLKGEVLLFHKDT---  318

Query  85   VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAI  144
                +  AD P   +    A   G   L +   ++ DR  W+    +A+  +   +  A+
Sbjct  319  ---TVHYADEPAAGRAFCFAIDAGAYSLLLQAASERDREAWIYAIEDAILCRDSYS--AL  373

Query  145  DQSVSPNKK  153
            D   + +++
Sbjct  374  DDQAADDRR  382

>H257_03093
Length=975

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+LVLDG++L   YY S+          T  +G   ++ + P  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEAR----TGTNLRGRMIITKVLPEN  157

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            Y     G A   F  + +GH          +   T+ +++ W+E+   A+
Sbjct  158  Y-----GKA-HGFLIETMGHK------HFHLCCTTELEKDMWVEMMQAAI  195

>SPRG_11900
Length=605

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 49/110 (45%), Gaps = 23/110 (21%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            +P  C GY+ K+G   K+WR R+  +DG + Q++Y ++  A  PP G             
Sbjct  234  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDADGA--PPKG-------------  277

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
                 +V+ V     RPF   +   + R+    L V   TQ + + WL V
Sbjct  278  ---FGHVVDVCVNTKRPFALYIHLASGRR----LAVAGSTQAEADTWLAV  320

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 7/56 (13%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
            G+V K+G   KSW+ RFLV+ G +  V YY+   + H PN      KGS  L ++
Sbjct  6   SGFVFKQGALIKSWKKRFLVVQGRH--VTYYDR--SVHEPNPRE---KGSLVLVDV  54

>PYIR_13168
Length=1353

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 71/152 (47%), Gaps = 23/152 (15%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G++TK+GH  K+W+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  116  GWLTKQGHMWKTWKTRFFVLYADGT---FAYYKNKGK-KKMQGCLMLNDGIVTVKHVDVR  171

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
            +  IG      +P+ F++      KGF +L  +  +Q +   W+    +AL++ R+    
Sbjct  172  K--IG------KPYVFQV-----EKGFYKLICYCCSQLEAELWV----SALRSARKTPPT  214

Query  143  AIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
              +  ++  ++K    +V      +    KQ+
Sbjct  215  CFEIDLTAPEEKAGASAVTRQLNKIFVTDKQI  246

>PYAR_19291
Length=711

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 3/58 (5%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            +N L L  P A+   D    + C G++ K GH RK+W++R+ VL+ S L+  YY   A
Sbjct  189  LNGLYLDHPTASPFDDTFLDSMC-GWLRKLGHVRKNWKMRYFVLEKSVLR--YYADEA  243

>PHYSO_343629
Length=977

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 22/30 (73%), Gaps = 0/30 (0%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAY  53
            EGYVTKRGH  ++W++RF  L+G+ +   +
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>PHALS_05587
Length=1361

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 28/139 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN--IE  80
            G++ K+GH  KSW+ RF VL  DG+   V YY+        N      KG  +L++  + 
Sbjct  139  GWLKKQGHMWKSWKARFFVLFSDGT---VVYYK--------NKSRKKIKGYMHLNDGVVS  187

Query  81   PHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLT  140
                 I V G A   + F++      KGF  L     +Q D   W+     AL++ R++ 
Sbjct  188  VQHVDIRVAGKA---YVFQI-----EKGFYRLLCHCSSQIDAELWV----TALRSVRKVA  235

Query  141  RQAIDQSVSPNKKKLFGFS  159
                + +++  ++K  GF+
Sbjct  236  PPCFEMNLTAREEKA-GFN  253

>PYIW_16987
Length=821

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (44%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L   YY ++         +   +G   +S + P  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEAR----SARNLRGRMIISKVRPEN  173

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            Y         +  GF +      KG     +   T+ +++ W+E+   A+
Sbjct  174  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  211

>H257_03361
Length=699

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 37/60 (62%), Gaps = 7/60 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
           +G++ K+G    SW+ R+LVL G N  ++Y++ +   +P   E    KGSF L+ ++P++
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPRAKE----KGSFVLAGVQPNK  63

 Score = 32.7 bits (73),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            G++ K+G   +SW+ R+ VL G N  +AY+++
Sbjct  212  GWLDKQGEIVQSWKQRYFVLRGRN--IAYFDT  241

>SPRG_14955
Length=635

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 61/140 (44%), Gaps = 20/140 (14%)

Query  2    NILRLPEPGATASG-DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
             +L   E  A+  G  K +     G + KRGH RK+W  RF VL  ++L+  YY+   + 
Sbjct  4    KVLHPQESSASVGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYKKPRS-  60

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGV--MGAADRPFGFKMVGHAPRKGFV--------  110
              PN  ST      YL        +I V    A  RP+ F  V    R+  V        
Sbjct  61   --PNHSSTWNTDKRYLRGELRLTDLIHVESSSADHRPYCF--VATFVRQANVLWLYHAHS  116

Query  111  ELDVFVETQT--DRNKWLEV  128
             +D +++  +  DR+KW+ +
Sbjct  117  TIDYYIQANSDDDRDKWIRL  136

>SDRG_05608
Length=121

 Score = 38.1 bits (87),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 50/127 (39%), Gaps = 33/127 (26%)

Query  13   ASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG-------  65
            A  D AQP   EG +TKR  + K WR R+ VL G+ L    Y  RA    P+G       
Sbjct  3    AVADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGMIDLSEC  57

Query  66   ----------------ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVGHAPRK  107
                            E   P+ ++Y+   + E  +  IG +G A   F     G     
Sbjct  58   LTVKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---D  114

Query  108  GFVELDV  114
            G+ E DV
Sbjct  115  GYDEEDV  121

>PHYSO_344112
Length=813

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  9    PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            P  +++ +    T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  89   PDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PPTG_05519
Length=810

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  9    PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            P  +++ +    T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  89   PDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHALS_03645
Length=830

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query  9    PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            P  + + D    T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  89   PDLSNAFDDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSK  135

>SDRG_01407
Length=815

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (43%), Gaps = 29/135 (21%)

Query  15   GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSF  74
            G  A     EGYV K+G +   W  R+LVLDG++L   YY ++      +G +   +G  
Sbjct  76   GPPAHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR--SGRNL--RGRM  129

Query  75   YLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
             ++ + P  Y         +  GF +      KG     +   T+ +++ W+E       
Sbjct  130  IITRVLPENY--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVE-------  170

Query  135  AKRQLTRQAIDQSVS  149
                + + AID+ +S
Sbjct  171  ----MMQAAIDEGIS  181

>PHYCA_506137
Length=810

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  9    PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            P  +++ +    T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  89   PDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PITG_02762
Length=810

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  9    PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            P  +++ +    T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  89   PDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYRA_73535
Length=875

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 55/137 (40%), Gaps = 18/137 (13%)

Query  16   DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y +  +C    GE  +     +
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGEVLL-----F  384

Query  76   LSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT--DRNKWLEVACNAL  133
                  H   + V G  D  F  + VG        E  + ++     DR  W+    +AL
Sbjct  385  HPQTRVHYVDVHVAGGRDASFAIQ-VG-------PEYTLLLQAAQLRDRENWMYCIEDAL  436

Query  134  KAKRQLTRQAIDQSVSP  150
              +     Q +     P
Sbjct  437  LCRDSYHPQGMTSGPGP  453

>PYIW_18480
Length=755

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
           T  EGYV K+GH  +SWR R+ +L G+    +YY S+
Sbjct  50  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  84

>CCA18023
Length=1138

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 51/126 (40%), Gaps = 18/126 (14%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L   YY ++             +G   +  + P  
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL----RGKMMIVKVRPEN  178

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
            Y         +  GF +      KG     +   T+ +++ W+E+   A++     +  A
Sbjct  179  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAAPFSSNA  226

Query  144  IDQSVS  149
                VS
Sbjct  227  SHSFVS  232

>H310_04843
Length=968

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+LVLDG++L   YY S+       G++   +G   ++ + P  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEAR--TGKNL--RGRMIITRVLPEN  156

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            Y     G A   F  + +GH          +   T+ +++ W+E+   A+
Sbjct  157  Y-----GKA-HGFLIETMGHK------HFHLCCTTELEKDMWVEMMQAAI  194

>SPRG_17022
Length=107

 Score = 37.4 bits (85),  Expect = 0.019, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+     YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>HYAP_08026
Length=798

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  122

>PHYRA_79281
Length=809

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  134

>SDRG_07086
Length=656

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 56/138 (41%), Gaps = 15/138 (11%)

Query  18   AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLS  77
            A  T  EGY+ KR  + K W   + VL G  L        A   P N  S +  G+F  +
Sbjct  30   AVTTRWEGYLQKRSDWLKQWEAYYFVLHGCALYCYLSADEAKRQPEN--SKIKHGAFSFT  87

Query  78   NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFV--ETQTDRNKWLEVACNALKA  135
            +    ++V+ + G     F F+     P        VF+  +TQ  +  W+ +A   +  
Sbjct  88   SHVILQHVVSIHGHGAFDFIFETSSGKP--------VFLRAKTQAMKTLWMAMAAQGIHD  139

Query  136  KRQLTR---QAIDQSVSP  150
             R  +R     +D ++ P
Sbjct  140  TRIDSRGRVGLVDTTIRP  157

>H310_06378
Length=837

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            EG+V K+GH  ++W+VR+  L+G+ L  +YYE++
Sbjct  58  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  90

>CCI46235
Length=1155

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 18/111 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L   YY ++             +G   +  + P  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL----RGKMMIVKVRPEN  173

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
            Y         +  GF +      KG     +   T+ +++ W+E+   A++
Sbjct  174  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIE  212

>PYAP_22646
Length=815

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            T  EGY+ K+GH  +SWR R+ +L G+    +YY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISK  134

>CCA21715
Length=782

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>CCA21860
Length=782

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>PITG_02109
Length=522

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
            G+V K+G   K+W+ RF+VL G   Q+ YY++ +  +P    +  PKGSF +  +E
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLNP----TVKPKGSFQVITVE  186

>H257_13567
Length=836

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            EG+V K+GH  ++W+VR+  L+G+ L  +YYE++
Sbjct  60  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  92

>PPTG_16044
Length=1378

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 65/132 (49%), Gaps = 23/132 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  192

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
               I V G A   + F++     +KGF +L  +  +Q +   W+     AL++ R++   
Sbjct  193  ---IRVAGKA---YVFQI-----QKGFYKLLCYCCSQFEAELWVA----ALRSVRRVAPP  237

Query  143  AIDQSVSPNKKK  154
              +  ++  ++K
Sbjct  238  CYEMDLTATEEK  249

>PYAP_22685
Length=1104

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 37/162 (23%), Positives = 77/162 (48%), Gaps = 31/162 (19%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G++TK+GH  K+W+ RF VL  DG+   +AYY+++       G+  M KG   L+     
Sbjct  149  GWLTKQGHVWKNWKNRFFVLFHDGT---LAYYKAK-------GKRRM-KGCMKLN-----  192

Query  83   EYVIGV----MGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
            E V+ V    +  + + + F++      KG+  +     +Q +   W+    NAL+  RQ
Sbjct  193  EGVVSVQHVDIRRSTKAYVFQV-----EKGYYRMWCCCCSQLEAELWV----NALRKVRQ  243

Query  139  LTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
             +    +  ++ ++++  G +V      +     ++Q++  +
Sbjct  244  CSPPCFEPLLTVHEEQFGGLAVNRQLNKIFVTDNRIQSMMAA  285

>PITG_03318
Length=1343

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 65/132 (49%), Gaps = 23/132 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  192

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
               I V G A   + F++      KGF +L  +  +Q +   W+     AL++ R+++  
Sbjct  193  ---IRVAGKA---YVFQI-----EKGFYKLLCYCCSQFEAELWVA----ALRSVRRVSPP  237

Query  143  AIDQSVSPNKKK  154
              +  ++  ++K
Sbjct  238  CYEMDLTATEEK  249

>PYIW_21944
Length=1317

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 23/116 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            G++TK+GH  K+W+ RF VL  DG+    AYY++        G+  M +GS  L     +
Sbjct  105  GWLTKQGHMWKTWKTRFFVLYSDGT---FAYYKN-------EGKKRM-QGSLTL-----N  148

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
            + ++ +     R  G   V     KGF +L  +  +Q +   W+    +AL++ R+
Sbjct  149  DGIVSIKHVDIRKVGKSYVIQV-EKGFYKLLCYCCSQNEAELWV----SALRSARK  199

>PHYRA_73534
Length=1210

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 55/137 (40%), Gaps = 18/137 (13%)

Query  16   DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y +  +C    GE  +     +
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGEVLL-----F  384

Query  76   LSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT--DRNKWLEVACNAL  133
                  H   + V G  D  F  + VG        E  + ++     DR  W+    +AL
Sbjct  385  HPQTRVHYVDVHVAGGRDASFAIQ-VG-------PEYTLLLQAAQLRDRENWMYCIEDAL  436

Query  134  KAKRQLTRQAIDQSVSP  150
              +     Q +     P
Sbjct  437  LCRDSYHPQGMTSGPGP  453

>PHYKE_5678
Length=809

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  9    PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            P  +++ +    T  EGY+ K+GH  +SWR R+ VL G  +  +YY S+
Sbjct  88   PDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSG--VTFSYYVSK  134

>SDRG_08800
Length=881

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            EG+V+K+GH  ++W++R+  L+ SNL ++YYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>PHYCA_504801
Length=398

 Score = 39.3 bits (90),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
           G+V K+G   K+W+ RF+VL G   Q+ YY++ A  +P    +T  KGSF +  +E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVNP----TTKAKGSFQVITVE  60

>H257_03931
Length=695

 Score = 39.3 bits (90),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query  15   GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSF  74
             D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S  +      E T P+G  
Sbjct  103  SDFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGTS-----SEETFPRGVI  155

Query  75   YLSNIEPH  82
             LS ++ H
Sbjct  156  SLSGVDVH  163

>SDRG_14286
Length=670

 Score = 39.3 bits (90),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
            G++ K GH RK+W+ RF VLDGS LQ  YY
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YY  304

>H257_13346
Length=587

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 49/121 (40%), Gaps = 27/121 (22%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTM----PKGSFYLSNIE  80
            G + KRGH RK+W +RF VL    L+  YY       PP   ST     P+   YL    
Sbjct  25   GILLKRGHVRKNWLMRFFVLTSGALR--YYRK-----PPGSRSTTWSVDPR---YLRGEL  74

Query  81   PHEYVIGV--------MGAADRPFGFKMVGHAPRKGF-----VELDVFVETQTDRNKWLE  127
            P   +I V         G   R + F +     R  F     V   V   T+ +R+KWL 
Sbjct  75   PLADIIHVESDDSSPQRGQQPRTYRFTITVLRHRILFLLRRPVRFHVQAATEDERDKWLR  134

Query  128  V  128
            +
Sbjct  135  I  135

>SPRG_02502
Length=121

 Score = 37.0 bits (84),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 49/125 (39%), Gaps = 33/125 (26%)

Query  15   GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG---------  65
             D AQP   EG +TKR  + K WR R+ VL G+ L    Y  RA    P+G         
Sbjct  5    ADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGVIDLSECLT  59

Query  66   --------------ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGF  109
                          E   P+ ++Y+   + E  +  IG +G A   F     G     G+
Sbjct  60   VKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---DGY  116

Query  110  VELDV  114
             E DV
Sbjct  117  DEEDV  121

>SPRG_05449
Length=723

 Score = 39.3 bits (90),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            EG+V+K+GH  ++W++R+  L+ SNL ++YYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>PYIR_16780
Length=1352

 Score = 39.3 bits (90),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 62/120 (52%), Gaps = 13/120 (11%)

Query  18   AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH--PPNGESTMPKGSFY  75
             + T   G++ K+G   +S++ R++ L+GS L  +YY+ +   H  P + E    K ++ 
Sbjct  155  VETTFISGFLRKKGETNRSFKRRYMELNGSIL--SYYKKKPEKHGIPLSRED---KKAYE  209

Query  76   LSNIEPHEY-VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
              NI+      +  M +   P+G  +V  A  + +V   +  E++ D ++WL+V C+ +K
Sbjct  210  RGNIDLERVSSLQPMESKSEPYGIHLVTTA--RTWV---IAAESEQDYHRWLKVLCSVVK  264

>PYU1_G004386
Length=837

 Score = 39.3 bits (90),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            D    T  EGY+ K+GH  +SWR R+ +L G+    +YY S+
Sbjct  131  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  170

>PPTG_14630
Length=398

 Score = 38.5 bits (88),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 31/56 (55%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
           G+V K+G   K+W+ RF+VL G   Q+ YY++          +  PKGSF +  +E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDTSKLV-----PTVKPKGSFQVITVE  60

>SPRG_00890
Length=883

 Score = 38.9 bits (89),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 56/126 (44%), Gaps = 29/126 (23%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGYV K+G +   W  R+LVLDG++L   YY ++      +G +   +G   ++ + P  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR--SGRNL--RGRMIITRVLPEN  84

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
            Y         +  GF +      KG     +   T+ +++ W+E           + + A
Sbjct  85   Y--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVE-----------MMQAA  121

Query  144  IDQSVS  149
            ID+ +S
Sbjct  122  IDEGIS  127

>H310_13627
Length=678

 Score = 38.9 bits (89),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 50/122 (41%), Gaps = 8/122 (7%)

Query  16   DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
            D  Q     G++ K+GH  K+W+ RF VLDGS L+  Y+        P   +   KG   
Sbjct  261  DDTQLDRKSGWLYKQGHILKNWKRRFFVLDGSVLR--YFSEDVDATVPKSTTHKLKGEVL  318

Query  76   LSNIEPHEYVIGV-MGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
            L + +   + + + +   D  F     G     G   L +   +  +R  W+    +A+ 
Sbjct  319  LFHKDTTVHYVDIHLSGRDFTFAIDTSG-----GGFSLMLQASSLDEREDWIYAIEDAIL  373

Query  135  AK  136
             +
Sbjct  374  CR  375

>SDRG_14070
Length=630

 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 62/140 (44%), Gaps = 22/140 (16%)

Query  3    ILRLPEPGATASG-DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH  61
            +L   E  A+  G  K +     G + KRGH RK+W  RF VL  ++L+  YY+   + H
Sbjct  5    VLHPQESSASMGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYKKPRSPH  62

Query  62   PP---NGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFV--------  110
                 N +    +G   L+++   E      GA  RP+ F  V    R+  V        
Sbjct  63   ISSTWNTDKRYLRGELRLADLIHVE----SSGADHRPYCF--VATFVRQANVLWLYHAHS  116

Query  111  ELDVFVETQT--DRNKWLEV  128
             +D  ++  +  DR+KW+ +
Sbjct  117  TIDYHIQANSDDDRDKWIRL  136

>PYIR_13120
Length=814

 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            T  EGY+ K+GH  +SWR R+ +L G+    +YY S+
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  138

>CCI42349
Length=1110

 Score = 38.9 bits (89),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 55/140 (39%), Gaps = 20/140 (14%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGY+ KR  + K W   + VL G  L   Y     A H P+ +S +  G  ++       
Sbjct  9    EGYLQKRSDWLKHWETFYFVLKGRYL-YCYLSEEDARHQPD-KSRIKNGKLFV-----FS  61

Query  84   YVIGVMGAAD----RPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQL  139
            + I VM A D     P    M  HA              QT++  +LE   N+  +K+  
Sbjct  62   HRITVMKAWDVEDPLPVNTAMSNHARSTAPNSFSFRFTLQTEKGHYLEFRTNSQASKQMW  121

Query  140  TRQA---------IDQSVSP  150
             + A         +DQS+ P
Sbjct  122  LQFASTAIVEFDRLDQSILP  141

>H257_05175
Length=678

 Score = 38.9 bits (89),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 15/65 (23%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
           EG++TKR  H    W  R+ +L+GSNL+  YY+ R       G+ T P+G++ L+N    
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLTN----  47

Query  83  EYVIG  87
           E V+G
Sbjct  48  ECVVG  52

>PYAP_16734
Length=1314

 Score = 38.9 bits (89),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 27/109 (25%), Positives = 51/109 (47%), Gaps = 17/109 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
            G +TK+G +R++W+ RF +L   +  + YY+S         E     G+  +S+      
Sbjct  181  GTLTKQGSWRRNWKTRFFLLRRDHPSLCYYKSE--------EKLELLGAIAVSS---DTL  229

Query  85   VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            V+        P+ F++     R G   L +  ET+ ++ +W++ AC  L
Sbjct  230  VLDKSAGGHAPYRFQL-----RTGDASLLLEAETRENQQRWMD-ACQEL  272

>SPRG_16312
Length=261

 Score = 38.1 bits (87),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 29/54 (54%), Gaps = 4/54 (7%)

Query  14  SGDKA--QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
           SG++A   P    GYV K+G F K+W+ RF+VL    L   YY S  A   P G
Sbjct  30  SGNEAPPGPPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAMAKPRG  81

>PYAR_19883
Length=833

 Score = 38.5 bits (88),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            T  EGY+ K+GH  ++WR R+ +L G+    +YY S+
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISK  134

>PYAR_15792
Length=121

 Score = 36.6 bits (83),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 24/42 (57%), Gaps = 4/42 (10%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
           EG +TKR  + K WR RF VL G+ L    Y  RAA  P +G
Sbjct  16  EGELTKRSVWLKEWRRRFFVLKGNKL----YFCRAAKEPAHG  53

>SDRG_05150
Length=787

 Score = 38.5 bits (88),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+     YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>H310_09363
Length=1954

 Score = 38.5 bits (88),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 40/79 (51%), Gaps = 4/79 (5%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            M++L L     ++  +K   TSC GY+ KRG    + + R+++L  + L   YY++    
Sbjct  826  MDVLVLDTTNTSSQNNKR--TSCAGYLMKRGEVNVTMQRRYMILQDNEL--VYYKTNPEL  881

Query  61   HPPNGESTMPKGSFYLSNI  79
            +        P+GS +L N+
Sbjct  882  NKGWFGKEKPRGSLHLGNV  900

>H310_07070
Length=680

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (51%), Gaps = 7/67 (10%)

Query  16   DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
            D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S         E T P+G   
Sbjct  114  DFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGTT-----SEETYPRGVIS  166

Query  76   LSNIEPH  82
            LS ++ H
Sbjct  167  LSGVDVH  173

>SPRG_08346
Length=797

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+     YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>CCI43456
Length=126

 Score = 36.6 bits (83),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 29/52 (56%), Gaps = 4/52 (8%)

Query  14  SGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
           S D+ Q  + EG +TKR  + K WR R+ +L G+ L    Y S++    P+G
Sbjct  11  SIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL----YFSKSKNDAPHG  58

>HYAP_04457
Length=1203

 Score = 38.5 bits (88),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (4%)

Query  1   MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
           M+ + +    A+ S         EGYV K+G +   W  R+L+LDG  L   YY S+
Sbjct  39  MDDMLMDSSSASTSAVMTHEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSK  93

>H310_04667
Length=680

 Score = 38.5 bits (88),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 11/56 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
           EG++TKR  H    W  R+ +L+GSNL+  YY+ R       G+ T P+G++ L+N
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLTN  47

>SDRG_05567
Length=980

 Score = 38.5 bits (88),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 54/122 (44%), Gaps = 24/122 (20%)

Query  13   ASGDKAQPTS-------CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
            AS   AQPT+         GY++KRG +RK+W+ R+ +L   +  + Y +S         
Sbjct  118  ASSSVAQPTTFTENDIHMAGYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVG-  176

Query  66   ESTMPKGSFYLSNIEPHEYVI-GVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNK  124
               +P        I P+  VI   +G    PF F++  H PR+    L +   T  +  K
Sbjct  177  --QVP--------ITPNTRVIDNSIGCQKAPFYFEV--HTPRR---VLYLGAGTVQEHRK  221

Query  125  WL  126
            W+
Sbjct  222  WI  223

>PYU1_G000724
Length=189

 Score = 37.0 bits (84),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 5/36 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRA  58
            G++TK+GH  KSW+ RF VL  DG+    AYY+++ 
Sbjct  111  GWLTKQGHMWKSWKTRFFVLFADGT---FAYYKNKG  143

>PYU1_G003229
Length=810

 Score = 38.1 bits (87),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query  13  ASGDKAQPTSCE--GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMP  70
           A G  A+ T C+  G+ +K+G   KSW+ R+ VL G  L   Y+  R+    P+G+    
Sbjct  17  AVGRVAKSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSERS----PSGKGINE  70

Query  71  KGSFYLSNIE  80
           KG   +  +E
Sbjct  71  KGRLKIVGVE  80

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 26/45 (58%), Gaps = 2/45 (4%)

Query  11   ATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYE  55
            AT +      T   G++ K+GH  KSW+ RF V++GS   + Y+E
Sbjct  388  ATVTSGSDSGTRKTGWLNKQGHRMKSWKRRFFVVEGST--ITYFE  430

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 45/112 (40%), Gaps = 24/112 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
            CEG++ KRG    +W+ RF  L+G  LQ  Y +S      P GE +              
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ--YQDSPG--ENPKGEGS--------------  301

Query  83   EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
              V+ +    +  F  ++     R     L V  ++Q   N W++  C  L+
Sbjct  302  --VVDIQLGDEGTFSMEIQLDTGRI----LSVTADSQDQVNMWVDAICTVLE  347

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (7%)

Query  13   ASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            AS D + P  C G++ K G   K+W++R+  L G+ L   Y++S
Sbjct  693  ASLDDSLP-GCSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS  733

>PYVX_23349
Length=924

 Score = 38.1 bits (87),  Expect = 0.085, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 48/112 (43%), Gaps = 14/112 (13%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEP  81
            S  G++ K GH RK+W+ R+ VL+ S L+    ESR+      GE  +     +      
Sbjct  444  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRL---KGEVLL-----FHPATRV  495

Query  82   HEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            H   I + G  D  F  + VG         L +  E  +DR  W+    +AL
Sbjct  496  HYVDIHLSGGRDNTFAIQ-VGSD-----YTLLLQAERLSDRENWMYCIEDAL  541

>CCI43793
Length=1117

 Score = 38.1 bits (87),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 53/128 (41%), Gaps = 26/128 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLS---NIEP  81
            GY+ K+G F KSWR RF +L      +AYY S+       GE ++   S  L    N  P
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKEHL-TKLGEISVDDQSVLLKTPRNGIP  233

Query  82   HEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTD-RNKWLEVACNALKAKRQLT  140
            H +                V HA R     L +F E   D  N W++     ++ +  + 
Sbjct  234  HCFT---------------VKHAART----LIMFTEDGEDIMNTWMDRISRCIRLR--ID  272

Query  141  RQAIDQSV  148
            R AI  ++
Sbjct  273  RNAITNTI  280

>H257_09269
Length=1135

 Score = 38.1 bits (87),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 2/72 (3%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGY+ KR  + K W   + VL G  L     E  A  HP N  S +  G F  S+    +
Sbjct  201  EGYLMKRSDWLKHWETYYFVLHGRVLCCYMSEDNARVHPEN--SRIKDGRFTFSDKVVLD  258

Query  84   YVIGVMGAADRP  95
             VI +    D P
Sbjct  259  KVIDIRTHFDMP  270

>PHYRA_77134
Length=1267

 Score = 38.1 bits (87),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 22/125 (18%)

Query  18   AQPTS-CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH----PPNGESTMPKG  72
            A PT    G + KRG   K+++ R++ LDGS L  AYY  +   H      + +    KG
Sbjct  140  AVPTKLVSGVLRKRGEGFKAFKKRYMELDGSTL--AYYRKKPEKHGIPLSRDEKKGCEKG  197

Query  73   SFYL---SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVA  129
            +  L   S+++P       M     PFGF +V  A  + +V   +  E++ + ++W++  
Sbjct  198  NIDLEKVSSLQP-------MDNKSEPFGFLLVTTA--RTWV---LAAESEVEYHRWIKAL  245

Query  130  CNALK  134
            C  +K
Sbjct  246  CGVVK  250

>PYIW_20891
Length=291

 Score = 37.4 bits (85),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
           G+V K+G   ++W+ RFLVL G   Q+ YY++ A+  P   E    KGSF +  +E
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGK--QLTYYDT-ASLTPKTKE----KGSFQVITVE  57

>PYAR_24323
Length=883

 Score = 37.7 bits (86),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 15/114 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH--PPNGES--TMPKGSFYLSNIE  80
            GY+ KRG   +S++ R++ L+GS L  AYY+ +   +  P + E   +  +G+  L  + 
Sbjct  156  GYLRKRGEHNRSYKRRYMELNGSVL--AYYKKKPEKNGIPLSREDKKSCERGAIDLDRVT  213

Query  81   PHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                 I  + A   PFG  +V            +  E+  D  +WL+  C+ +K
Sbjct  214  S----IQPIDAKSEPFGINLVTTNR-----TWSIAAESDQDYQRWLKSLCSVVK  258

>PHALS_06336
Length=511

 Score = 37.7 bits (86),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 58/134 (43%), Gaps = 38/134 (28%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            ++I+++ E G      +  P +  G+V K G   +SW+ RFLV  G+ L  AYY++    
Sbjct  118  LSIIQIREMG------REDPATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN----  165

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAA------DRPFGFKMVGHAPRKGFVELDV  114
                            ++ E H  ++G + AA      D   G  + G   R    +L +
Sbjct  166  ----------------TDEENHAQLLGALTAAHIERLPDITNGLLIHGTEGR----QLKI  205

Query  115  FVETQTDRNKWLEV  128
            F +T+ + N+  E 
Sbjct  206  FTDTKQECNRCFEA  219

>PYU1_G009249
Length=2580

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 58/126 (46%), Gaps = 18/126 (14%)

Query  25    GYVTKRGHFRKS-WRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI----  79
             GYV  R HF  + WR RF+VL G++   AY    ++    + E    K +    N+    
Sbjct  2101  GYVRVRHHFLGAIWRERFMVLHGTS---AYLYPDSSAATEDDEQLERKKALEKHNLVAIA  2157

Query  80    EPHEYVIGVMGAA---DRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV---ACNAL  133
             + H   +   G+A      +GF++   A   G++E    V T+ ++ +W++    A  AL
Sbjct  2158  KWHPTYVSTFGSAHSSSNRYGFRVENEA--GGYLE--CIVATEQEQTQWMKTISDAVTAL  2213

Query  134   KAKRQL  139
              A  QL
Sbjct  2214  SASSQL  2219

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
             EGY+ KRGH   S R R+ VL      + YY +      P   S  P GSF +  +
Sbjct  1179  EGYLVKRGHLIPSMRKRYCVLLKRGNTLEYYATHEDSRNP---SVAPHGSFRVDTV  1231

>SPRG_06021
Length=983

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 24/122 (20%)

Query  13   ASGDKAQPTS-------CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
            AS    QPT+         GY++KRG +RK+W+ R+ +L   +  + Y +S         
Sbjct  120  ASSSVGQPTTFTENDIHMAGYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVG-  178

Query  66   ESTMPKGSFYLSNIEPHEYVI-GVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNK  124
               +P        I P+  VI   +G    PF F++  H PR+    L +   T  +  K
Sbjct  179  --QVP--------ITPNTRVIDNSIGCQKAPFYFEV--HTPRR---VLYLGASTVQEHRK  223

Query  125  WL  126
            W+
Sbjct  224  WI  225

>H257_06469
Length=76

 Score = 34.3 bits (77),  Expect = 0.13, Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVAY  53
           EGYV K+GH  KSW+ R+  LD S   + Y
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEY  31

>PYU1_G011261
Length=1328

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 35/148 (24%)

Query  3    ILRLPEPGATASGD---KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
            + R+P     +  D     + T   G++ K+G   +S++ R++ L+G+ L  +YY+ +  
Sbjct  144  VARIPANLIISDSDVTSTVESTFISGFLRKKGEKNRSFKRRYMELNGTVL--SYYKKK--  199

Query  60   CHPPNGESTMP----------KGSFYL---SNIEPHEYVIGVMGAADRPFGFKMVGHAPR  106
               P  +S +P          +GS  L   S+++P       M     PFG  +V  A  
Sbjct  200  ---PEKKSGIPLSAAEKKAYERGSIDLDRVSSLQP-------MENKSEPFGIHLVTTA--  247

Query  107  KGFVELDVFVETQTDRNKWLEVACNALK  134
            + +V   +  E+  D  +WL+V C  +K
Sbjct  248  RTWV---IAAESDQDYQRWLKVLCGVVK  272

>CCI40991
Length=801

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 2/38 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGS--NLQVAYYES  56
            T  EGY+ K+GH  +SWR R+ VL G+  +  VA+ +S
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQS  143

>PYAP_16161
Length=889

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
           EGY+ K+G   K W+ R+ V DG  L  +YY SR    P
Sbjct  30  EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSKP  66

>HYAP_06403
Length=1037

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 34/80 (43%), Gaps = 10/80 (13%)

Query  52   AYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVE  111
            A++E  A CH    E   P  S  LS   P E     + AA   FG+K V  AP K  VE
Sbjct  101  AFFEHLAVCHTVMPEKA-PDNSLRLSASSPDEQA---LVAAAACFGYKFVARAPGKAMVE  156

Query  112  LDVFVETQTDRNKWLEVACN  131
                +E         E+ACN
Sbjct  157  YFCCIENPD------EMACN  170

>CCA19118
Length=125

 Score = 35.4 bits (80),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 29/52 (56%), Gaps = 4/52 (8%)

Query  14  SGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
           S ++ Q  + EG +TKR  + K WR R+ +L G+ L    Y S++    P+G
Sbjct  10  STERIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL----YFSKSKNDAPHG  57

>PYVX_14593
Length=964

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query  7    PEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            P+  AT S D  +   C G++ K+G    SW+ R+  L GS L+  YY+S
Sbjct  592  PDALATNSLDGGKLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKS  639

>PHYKE_6662
Length=765

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 39/196 (20%), Positives = 72/196 (37%), Gaps = 33/196 (17%)

Query  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            M  L +    A+           EG+V K+G +   W  R+L+LDG+ L   YY S+   
Sbjct  49   MEDLLMDSSAASTPATITHEVHWEGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEA  106

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
                      +G   +  + P  Y         +  GF +      +G     +   T+ 
Sbjct  107  RSARN----LRGRMIIVKVRPENY--------GKAHGFLI----ETQGHKHFHLCCSTEL  150

Query  121  DRNKWLEVACNALK-----AKRQLTRQAIDQ---SVSPNKKKLFGFS-------VPSSTQ  165
            +++ W+E+   A++         ++ + +D      SP +  L GF        +  S+ 
Sbjct  151  EKDMWVEMMQAAIEEGVRHGPNSMSLEGMDALALQASPTQVDLRGFYFAFRQLLISHSSS  210

Query  166  PVMSPQKQMQTLATSK  181
            P   P+     + TS 
Sbjct  211  PQFFPKLSRDVVLTSN  226

>PYAP_23744
Length=123

 Score = 35.0 bits (79),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (54%), Gaps = 5/56 (9%)

Query  10  GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
           G  ++ D + P   EG +TKR  + K WR R+ VL G+ L    Y  RAA  P +G
Sbjct  3   GDFSNCDLSNPDY-EGELTKRSVWLKEWRRRYFVLKGNKL----YFCRAANEPAHG  53

>SDRG_14487
Length=964

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 7/59 (12%)

Query  22  SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
           + EG++ K+G    +W+ R++VL G +  +AYY+ +   +P   E    KG+F L+ +E
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVSNPRAKE----KGTFTLAAVE  56

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 27/109 (25%), Positives = 41/109 (38%), Gaps = 24/109 (22%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
            G++ K G   KSW+ RF VL G++L   YY+         G                   
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYDRIGGAEKGGGR------------------  172

Query  85   VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            V+ V  + DR        +  R     L+V  +++ +   W   ACN L
Sbjct  173  VVDVSYSYDRRNSLTFTLNNDRI----LNVTADSENEMQTWYSAACNVL  217

>PHYSO_489872
Length=1240

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 57/125 (46%), Gaps = 17/125 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
            G +TK+G +R++W+ RF +L      + Y+ S        GE  +P        I     
Sbjct  154  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELL-GE--IP--------ITEDTI  202

Query  85   VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAI  144
            V+   G    PF F++     R     L +  E++ ++ +W+E AC  L    + ++ ++
Sbjct  203  VLDRSGGGHAPFRFQI-----RTDAQTLLLEAESRENQKRWIE-ACQELADAIRASKYSV  256

Query  145  DQSVS  149
            + S+S
Sbjct  257  NTSLS  261

>PYIR_23372
Length=1415

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            S EGY+ K+    +SW+  + VL+G  +  AYYESR
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESR  355

>PHYKE_4911
Length=46

 Score = 33.1 bits (74),  Expect = 0.17, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
           G+V K+G   K+W+ RF+VL G   Q+ YY++
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT  38

>SPRG_02752
Length=831

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 7/59 (12%)

Query  22  SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
           + EG++ K+G    +W+ R++VL G +  +AYY+ +   +P   E    KG+F L+ +E
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVTNPRAKE----KGTFTLAAVE  56

 Score = 35.0 bits (79),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 27/109 (25%), Positives = 42/109 (39%), Gaps = 24/109 (22%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
            G++ K G   KSW+ RF VL G++L   YY+         G                   
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYDRIGGSEKGGGR------------------  173

Query  85   VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            V+ V  + DR        +  R     L+V  +++++   W   ACN L
Sbjct  174  VVDVSYSYDRRNSLTFTLNNDRI----LNVTADSESEMQTWYNAACNVL  218

>PPTG_14626
Length=1055

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 46/115 (40%), Gaps = 32/115 (28%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLS----N  78
            C G++ K G   KSW+ R+  L GS L  +YY+S              KGS   S    N
Sbjct  714  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKSE-------------KGSLLRSVSVIN  758

Query  79   IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
            +EPH  V           G  +     RK    L V  E+  + NKWL     A+
Sbjct  759  VEPHPSV---------SLGLTVSTVGGRK----LIVQAESNGEFNKWLNAIQEAV  800

>PHALS_08097
Length=1069

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query  7    PEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            P P +T + D    T   G++TK+G +R++W+ RF +L      + Y+ S
Sbjct  129  PVPPSTFTTDDILRT---GFLTKQGSWRRNWKTRFFILRSDCPSLCYFTS  175

>PYVX_14527
Length=1269

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
            G+V K+G   ++W+ RF+VL G   Q+ YY++ A   P    S   KGSF L  +E
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGR--QLTYYDT-ARLTP----SVKAKGSFTLITVE  951

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 50/114 (44%), Gaps = 32/114 (28%)

Query  17   KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
            + +  +  G+V K G   +SW+ RFLV  G++L  AYY++                    
Sbjct  581  RGEQVTYAGWVFKEGSLVRSWKKRFLVAKGADL--AYYKN--------------------  618

Query  77   SNIEPHEYVIGVMGAA------DRPFGFKMVGHAPRKGFVELDVFVETQTDRNK  124
            ++ E H  ++G + AA      D   G  +VG   R     L +F +T+ + +K
Sbjct  619  TDRENHAQLLGALTAARIERLPDITNGMLIVGTEGRL----LKIFTDTKGEADK  668

>PHYCA_539465
Length=914

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 74/174 (43%), Gaps = 30/174 (17%)

Query  2    NILRLPEPGATA--------SGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAY  53
            N+  LPE   TA        + DK  P    G++ KRG   KS + R+  L  SN  ++Y
Sbjct  376  NVQLLPEGAKTAKLMKQNSDNADKGGPILFSGWLRKRGRMVKSTKRRWFEL--SNGTLSY  433

Query  54   YESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELD  113
            +      HP  G     KGS  +S        +  +   +R   F++   + R  F+  D
Sbjct  434  F-----AHPQGGSR---KGSIDVSRARVSS--VDTLKTGER-HSFQICTPS-RNLFLHAD  481

Query  114  VFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPV  167
                TQ +R+ WL  A  ++     +T Q       P+K+ +  FS+P+S   +
Sbjct  482  ----TQEERSLWL-AALGSVGESSAITAQ---NGAMPSKQDVNDFSMPTSASEI  527

>PYAP_13695
Length=348

 Score = 36.6 bits (83),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (43%), Gaps = 20/122 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
            G++ K+G   K+W+ RF+VL G   Q+ YY++     P   E    KGSF          
Sbjct  12   GWIYKQGSLVKNWKRRFMVLRGK--QLTYYDTE-RISPRVKE----KGSF---------Q  55

Query  85   VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAI  144
            VI V  ++D   G  + G   R     L ++ ++  + N W     +A          A+
Sbjct  56   VITVELSSDIQNGLIVHGRGGRV----LKLYTDSTDNTNGWYHAIMDATNNTGGGGGSAV  111

Query  145  DQ  146
            D+
Sbjct  112  DR  113

>PHYSO_478611
Length=522

 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
            G+V K+G   K+W+ RF+VL G   Q+ YY++ A   P    +   KGSF +  +E
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVDP----TVKAKGSFQVITVE  189

>H310_14019
Length=683

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 50/116 (43%), Gaps = 24/116 (21%)

Query  17   KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
            +A   S EG++ KRG   K+W+ R+  L+G  L+  Y E         G    PKG    
Sbjct  166  RASMRSFEGWLLKRGQRVKNWKRRYFTLNGQELK--YME---------GPGAKPKG----  210

Query  77   SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNA  132
                 +  V+GV    + P+    +   P +    LDV  E+  ++  W++   +A
Sbjct  211  -----YGMVVGVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWMQRILDA  257

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query  10   GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
            G  +S D A  T+CEG++ K+G   K+W+ R+  L G  L     +S  A
Sbjct  333  GIQSSLDTA--TTCEGWLYKQGSLVKNWKKRWFTLLGEVLSYRDMQSSVA  380

>SPRG_02753
Length=309

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (58%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
           +G+V K+G   +SW+ R++VL   N Q++Y+++          ST  KGSF +  IE
Sbjct  7   QGWVFKQGSLVRSWKKRYMVL--KNKQLSYFDTENVT-----ASTKAKGSFAVITIE  56

>PHYKE_4910
Length=375

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query  17   KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            +  P +  G+V K G   +SW+ RFLV  G+ L  AYY++
Sbjct  122  RTDPVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  159

>SDRG_14486
Length=308

 Score = 36.2 bits (82),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (58%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
           +G+V K+G   +SW+ R++VL   N Q++Y+++          ST  KGSF +  IE
Sbjct  7   QGWVFKQGSLVRSWKKRYMVL--KNKQLSYFDTENVT-----ASTKAKGSFAVITIE  56

>PHYKE_7856
Length=346

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYY  54
           G++TK+GH  KSW+ RF VL  DG+  +   +
Sbjct  63  GWLTKQGHMWKSWKTRFFVLFSDGTQFEAELW  94

>PPTG_18989
Length=1213

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  219

>SPRG_15871
Length=101

 Score = 34.3 bits (77),  Expect = 0.21, Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 5/86 (6%)

Query  8   EPGATASGDK---AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPN  64
           E   TAS D    A  T  EGY+ KR  + K W   + VL G  L        A   P N
Sbjct  16  ETTITASVDTPAVAVTTRWEGYLQKRSDWLKQWEAYYFVLHGCALYCYLSADEAKRQPEN  75

Query  65  GESTMPKGSFYLSNIEPHEYVIGVMG  90
             S +  G+F  ++    ++V+ + G
Sbjct  76  --SKIKHGAFSFTSHVVLQHVVSIHG  99

>H310_05692
Length=924

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 52/129 (40%), Gaps = 8/129 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGY+ KR  + K W   + VL G  L     E  A  HP +  S +  G F +S+    +
Sbjct  84   EGYLMKRSDWLKHWDTYYFVLHGRVLYCYLSEEEAKVHPES--SKIKHGKFSISDSLILD  141

Query  84   YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
             V  V       F F+           ++ +  +T+  +  W+ +A + +        QA
Sbjct  142  EVFSVRSRHHYEFIFE------NDQGKQIYLRAKTEASKQMWMHMASHGIVDNYTDHDQA  195

Query  144  IDQSVSPNK  152
            ++   +P +
Sbjct  196  LNMRRAPQR  204

>PITG_02106
Length=1015

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 62/147 (42%), Gaps = 41/147 (28%)

Query  7    PEPGATAS-----GDK--AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
            PE  A +S     GD+  A    C G++ K G   KSW+ R+  L GS L  +YY+S   
Sbjct  653  PEYDAISSSSSEQGDQEAAAAQGCVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKSE--  708

Query  60   CHPPNGESTMPKGSFYLS----NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVF  115
                       KGS   S    +IEPH  V           G  +  H+ RK  ++ D  
Sbjct  709  -----------KGSLLRSVSVVSIEPHPTV---------SLGLVVSTHSGRKLIMQAD--  746

Query  116  VETQTDRNKWLEVACNALKA--KRQLT  140
              +  + ++WL     A+    +R+LT
Sbjct  747  --SNEEFDRWLSAIQGAVAGENERKLT  771

>SPRG_14312
Length=661

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 33/65 (51%), Gaps = 7/65 (11%)

Query  16   DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
            D   P S  G + K+ +  K+W+ RF+VL G +L   YY S AA      E + PKG   
Sbjct  104  DFYAPLSRSGVLVKQANHLKNWKKRFMVLRGQSL--FYYVSGAA-----SEDSYPKGLIS  156

Query  76   LSNIE  80
            L  +E
Sbjct  157  LVGVE  161

>PYAR_13491
Length=1080

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (43%), Gaps = 28/114 (25%)

Query  27   VTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH-----PPNGESTMPKGSFYLSNIEP  81
            +TK+G +R++W+ RF +L      ++YY+S          P  G+S +   S        
Sbjct  2    LTKQGSWRRNWKTRFFILRSDYPSLSYYKSEEKLELLGSVPITGDSLVLDKS--------  53

Query  82   HEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRN--KWLEVACNAL  133
                    G    PF F++     R   V   + +ET+T  N  +W++ AC  L
Sbjct  54   -------AGGGHAPFRFQL-----RTDAVGAALLLETETRDNQQRWMD-ACQEL  94

>PITG_11578
Length=2131

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (55%), Gaps = 1/51 (2%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSF  74
             EGY+ KRGH   S R R+ VL G+ L   Y     + +P  G +T P G+F
Sbjct  952   EGYLMKRGHKIPSMRKRYCVLIGNEL-TYYVTHDDSKNPGGGATTNPLGNF  1001

>H257_07514
Length=810

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
           T  EGYV K+GH  ++WR R+ +L G+     YY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>H310_07701
Length=811

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
           T  EGYV K+GH  ++WR R+ +L G+     YY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>PITG_09930
Length=1221

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 31/130 (24%), Positives = 55/130 (42%), Gaps = 27/130 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
            G +TK+G +R++W+ RF +L      + Y+ S                   L  I   E 
Sbjct  153  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLE-------------LLGEIPVTED  199

Query  85   VIGVMGAADRPFGFKMVGHAPRKGFVELDVFV-----ETQTDRNKWLEVACNALKAKRQL  139
             I      DR  G    GHAP +  +  D        E++ ++ +W++ +C  L    + 
Sbjct  200  TI----VLDRSGG----GHAPFRFQIRTDAHTLLLEAESRENQKRWID-SCQELADAIRA  250

Query  140  TRQAIDQSVS  149
            ++ A++ SVS
Sbjct  251  SKFAVNNSVS  260

>PHALS_07930
Length=1200

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  215

>PYU1_G012274
Length=873

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            S EGY+ K+    +SW+  + VL+G  +  AYYESR
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESR  343

>PYAP_23478
Length=897

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
            G++ K GH RK+W++R+ VLD S L+  YY
Sbjct  380  GWLRKLGHVRKNWKLRYFVLDKSVLR--YY  407

>PPTG_11714
Length=2444

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (55%), Gaps = 1/51 (2%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSF  74
             EGY+ KRGH   S R R+ VL G+ L   Y     + +P  G +T P G+F
Sbjct  1143  EGYLMKRGHKIPSMRKRYCVLIGNEL-TYYVTHDDSKNPGGGATTNPLGNF  1192

 Score = 33.9 bits (76),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (3%)

Query  13    ASGDKAQPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLQV  51
             A  D    T  +GY+  R H   S WR RF+VL+GS L V
Sbjct  2013  AGNDNTDTTQTKGYLRVRHHNLGSIWRERFVVLEGSTLTV  2052

>H310_06666
Length=887

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 2/39 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
           EGY+ K+G   K W+ R+ V DG +L  +YY S+    P
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKLEKKP  60

>PHYRA_81944
Length=1149

 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  154

>PHYSO_561742
Length=1082

 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 32/75 (43%), Gaps = 3/75 (4%)

Query  4    LRLPEPGATAS-GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
            L  P PGA A   D       EGY+ KR  + K W   + VL G +L    Y S      
Sbjct  42   LATPTPGARAVPNDVPLRFHWEGYLQKRSDWLKHWETYYFVLRGRSLYC--YLSEEDARR  99

Query  63   PNGESTMPKGSFYLS  77
             N +S + KG F  S
Sbjct  100  QNAKSKIKKGKFGFS  114

>PHALS_01010
Length=716

 Score = 36.2 bits (82),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 30/57 (53%), Gaps = 8/57 (14%)

Query  4    LRLPEPGATASGDKAQPTSCEGYVTKRGH--------FRKSWRVRFLVLDGSNLQVA  52
            ++LPE     +  + + T  +GY+ K+G          RK+W+ R+ +L GSNL  A
Sbjct  569  VQLPEQKVIEAAQEKEVTELQGYLIKQGGGGNVLNPLRRKNWKQRYFILTGSNLIYA  625

>PYU1_G012859
Length=1183

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (60%), Gaps = 4/47 (9%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
            +P    G++ K+GH  +SW+ R+ VL G +LQ  Y+E+     PP G
Sbjct  491  KPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN--IDKPPRG  533

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  18   AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            A   +CEG++ K+GH  K W+ R+  L+   L+
Sbjct  354  ASSQTCEGWLLKQGHKSKRWKRRYFTLNNDMLE  386

 Score = 33.5 bits (75),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (5%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
            +G++ K G   K+W+ RF+VL G+ L  +YY       PP G
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADETPSSPPLG  236

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 26/119 (22%), Positives = 52/119 (44%), Gaps = 24/119 (20%)

Query  18   AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLS  77
            A  ++C G++ K+G   K+W+ R+  L G+ L+    E+ +              SF +S
Sbjct  806  ADQSNCHGWLNKQGGTIKTWKRRYFSLHGTTLRYFKRETGSMLR-----------SFTIS  854

Query  78   NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136
            ++E    V           G +++  + RK    L +  E++ D  +WL     ++ A+
Sbjct  855  HVEKQPQV---------ALGLEVMTTSGRK----LMLTAESKEDYGRWLRALQASISAE  900

>HYAP_09304
Length=1144

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            GY+ K+G F KSWR RF +L      ++YY S
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  156

>PPTG_21000
Length=1012

 Score = 36.6 bits (83),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 55/127 (43%), Gaps = 26/127 (20%)

Query  12   TASGDKAQ--------PTSCEGYVTKR---GHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
            T++ DKAQ        P    GY+ KR     +  SWR  F VL G+ L+  +Y S+   
Sbjct  32   TSARDKAQALTHAQHPPRLFGGYLRKRYSSSMYMGSWR--FCVLQGARLR--WYRSKECA  87

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
                   T  +G  ++ +IEP +   G    A  P  F +   + +     L    ETQ 
Sbjct  88   E----TDTQLRGEVWVQSIEPWD---GRTALATYPHAFAVRTTSKKL----LLCTAETQR  136

Query  121  DRNKWLE  127
            DR+ WL+
Sbjct  137  DRDLWLQ  143

>SDRG_06288
Length=641

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 32/57 (56%), Gaps = 7/57 (12%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
             G+V K+G   KSW+ RFLV+ G +  V+YY+   + H P+      KGS  L ++
Sbjct  5   WSGFVFKQGSLIKSWKKRFLVVQGRH--VSYYDR--SVHEPDPRE---KGSLVLGDV  54

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
            +P  C G + K+G   K+WR R+  +DG + Q++Y  S A   PP G
Sbjct  258  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSY--SDAETEPPKG  301

>CCA25510
Length=1139

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            GY+ K+G F KSWR R+ +L      +AYY S+
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSK  229

>PYU1_G012870
Length=352

 Score = 35.8 bits (81),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 7/50 (14%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSF  74
           G+V K+G   ++W+ RF+VL G   Q+ YY++ A+  P   E    KGSF
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGK--QLTYYDT-ASISPKTKE----KGSF  49

>PYIR_14494
Length=819

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  18   AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
            A+   CEG++ KRG    +W+ RF  L+G  LQ
Sbjct  260  AETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ  292

 Score = 32.7 bits (73),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            C G++ K G   K+W++R+  L+G+ L  +Y++S
Sbjct  716  CSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  747

 Score = 32.7 bits (73),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (52%), Gaps = 6/56 (11%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
           G+ +K+G   KSW+ R+ VL G  L   Y+  R+    P+G+    KG   +  +E
Sbjct  32  GWASKQGSIIKSWKRRYFVLKGREL--IYFAERS----PSGKGIDEKGRLKIVAVE  81

>PHYRA_83768
Length=735

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGA  91
            +PP  E  +P G  +L NI PH Y IG+MGA
Sbjct  619  NPPATE--IPSGYKWLYNITPHRYTIGIMGA  647

>PHYRA_77033
Length=1372

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  61    HPPNGESTMPKGSFYLSNIEPHEYVIGVMGA  91
             +PP  E  +P G  +L NI PH Y IG+MGA
Sbjct  1256  NPPATE--IPSGYKWLYNITPHRYTIGIMGA  1284

>PHYKE_7347
Length=122

 Score = 34.3 bits (77),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 39/104 (38%), Gaps = 29/104 (28%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG------------------  65
            EG +TKR  + K WR R+ VL G+ L    Y  RA   P +G                  
Sbjct  16   EGALTKRSVWLKEWRKRYFVLKGNKL----YFCRAQGEPAHGLIDLADCLTVKSAEEKTN  71

Query  66   -----ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVG  102
                 E   P  +FY+   N +  +  IG +G A   F     G
Sbjct  72   KRFCFEVATPDSTFYMYAENEKQKDEWIGAIGRAIVKFSSSFTG  115

>PYIW_14611
Length=1346

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 58/124 (47%), Gaps = 21/124 (17%)

Query  18   AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY----ESRAACHPPNGESTMPKGS  73
             + T   G++ K+G   +S++ R++ L+GS L  +YY    E R        +    +G+
Sbjct  149  VETTFISGFLRKKGEKNRSFKRRYMELNGSVL--SYYKKKPEKRGIPLSREDKKAYERGN  206

Query  74   FYL---SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVAC  130
              L   S+++P       M A    +G  +V  A  + +V   +  E+  D N+WL+V C
Sbjct  207  IDLDRVSSLQP-------MEAKGELYGIHLVTTA--RTWV---IAAESDQDYNRWLKVLC  254

Query  131  NALK  134
              +K
Sbjct  255  GVVK  258

>CCI42088
Length=1007

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 56/144 (39%), Gaps = 47/144 (33%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH---PPNGESTMP---------K  71
            +G++ KRGH +K+W+ RF  ++   LQ  + E+R       P NG    P         K
Sbjct  666  DGFLWKRGHLKKNWKKRFFRVENGQLQY-FTENRKLMKGAIPLNGTVVSPGMTCCPDGRK  724

Query  72   GSFYLSNI--------------EPHEYV---------IGVMGAADRPFGFKMV----GHA  104
              F +SN+              E HE++          G     + P GF +V       
Sbjct  725  NYFVISNMSHTKELHLNAETEAEMHEWIEALQRAQCGFGRQKTIEEPTGFALVVKRAEEI  784

Query  105  PRKGFV-------ELDVFVETQTD  121
            P   F        E+D+ +E +T+
Sbjct  785  PMISFYATYSKSSEIDIVMERKTE  808

>PYAR_17064
Length=816

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 56/126 (44%), Gaps = 22/126 (17%)

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            QP    G++ KRG   KS + R+  L  + L  +YY      HP  G     KGS  ++N
Sbjct  312  QPIVFSGWLRKRGQMFKSTKRRWFELSSTTL--SYYS-----HPEGG---TKKGSLEVAN  361

Query  79   --IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136
              I P    +  +   +R   F  + H  ++   EL V  ++Q +R+ W+    +   A 
Sbjct  362  ARISP----LDTLNTGER---FSFLVHTTQR---ELIVHADSQEERSLWVASLSSTEDAL  411

Query  137  RQLTRQ  142
              +TR+
Sbjct  412  VDVTRE  417

>PHYRA_83071
Length=2300

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query  12    TASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ--VAYYESRAACHPPNGESTM  69
             T  G   +    EGY+ KRGH   S R R+ VL G+ L   V + +S+   +P  G +T 
Sbjct  1120  TTEGPVNEAILVEGYLMKRGHKIPSMRKRYCVLLGNELSYFVTHDDSK---NPGGGATTA  1176

Query  70    PKGSFYLSNI  79
             P G F ++ +
Sbjct  1177  PLGKFRVAVV  1186

 Score = 31.6 bits (70),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query  12    TASGDKAQPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLQVAYYESRAA  59
             +++G  +     EG +  R H   S WR RF+VL+GS L + Y E+R A
Sbjct  2046  SSAGTVSNVARTEGQLQVRHHNLGSIWRARFVVLEGSKLSI-YSENREA  2093

>H257_02642
Length=975

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYE  55
           P   EGY+ KRG +   W    +VLDG  L+V+YY+
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYD  60

>PHYRA_72718
Length=732

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 3/36 (8%)

Query  25   GYVTKRG-HFRKSWRVRFLVLDGSNLQVAYYESRAA  59
            G + KRG  +RK W++RF+ LDG   Q+AYYE   A
Sbjct  94   GSLEKRGFRWRKKWKLRFVELDGR--QLAYYEDTGA  127

>PYAP_19560
Length=337

 Score = 35.8 bits (81),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 50/113 (44%), Gaps = 18/113 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGEST--MP-KGSFYLSNIEP  81
            G++ K+G   K+W+ RF +L+GS L   YY          G     MP KG   +++ + 
Sbjct  89   GWLWKKGASFKTWKKRFFLLNGSTL--TYYTQSCVVATEVGTRCFDMPAKGGLRVASADF  146

Query  82   HEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
             +         +  FG ++V  + R  FV+       +T R KWL V   A K
Sbjct  147  TD---------ETSFGIRIVSSSGRVLFVQ----AGDRTSRIKWLGVLQEASK  186

>PYIW_17818
Length=1188

 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (59%), Gaps = 2/51 (4%)

Query  6    LPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            + EP   A    A+P    G++ K+G   KSW+ R+ VL+G +LQ  Y+++
Sbjct  486  VAEPVEAAPAIVAEPEIKYGWLLKQGSLIKSWKRRYFVLEGDSLQ--YFDN  534

 Score = 34.7 bits (78),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query  7    PEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
            P P   A+     P  C G++ K G   K+W+ R+  L G+ L+  Y++S
Sbjct  814  PTPDDVATEQPLTPGGCSGWLNKEGGTIKTWKRRYFSLHGTTLR--YFKS  861

>PYIR_21473
Length=667

 Score = 35.8 bits (81),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (45%), Gaps = 20/147 (14%)

Query  24   EGYVTKR-GHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI---  79
            EG++TKR  H    W  R+ VLDG+  Q+ YY  R     P G   +  G   +SN+   
Sbjct  2    EGWLTKRRDHMNLIWLERYFVLDGN--QMRYYRKRGDP-APRGTYVLTDGCL-VSNVFNS  57

Query  80   -EPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
             E H +  G +      F  +  G    K    LD+  +T+ +  +W +   NA+++ R+
Sbjct  58   EEKHRH-HGPVWMFRITFAVE-AGEKSYKKDRFLDLGAKTEENAREWKKAIENAVRSLRE  115

Query  139  LT----RQAIDQSVSPNKKKLFGFSVP  161
            L     +   D ++ P +     +SVP
Sbjct  116  LVLHQRKMKTDAAIYPTQ-----YSVP  137

>H310_14473
Length=613

 Score = 35.8 bits (81),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 21/41 (51%), Gaps = 7/41 (17%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
           G + KRGH RK+W  RF VL    L+  YY       PP G
Sbjct  27  GILLKRGHLRKNWLTRFFVLTSGALR--YYRK-----PPGG  60

>SDRG_07085
Length=1010

 Score = 36.2 bits (82),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 2/55 (4%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            EGY+ KR  + K W   + VL G  L     E  A  HP N  S +  G F  S+
Sbjct  119  EGYLMKRSDWLKHWETYYFVLHGRVLCCYLSEDDARLHPEN--SKIKDGRFTFSD  171

>PYIW_21901
Length=913

 Score = 35.8 bits (81),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 0/37 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
            S  G++ K GH RK+W+ R+ VLD S L+    ES A
Sbjct  423  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLA  459

>PHYKE_8689
Length=832

 Score = 35.8 bits (81),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (4%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            EGY+ KR  + K W   + VL GS+L    Y S       N +S + KG F  S+
Sbjct  75   EGYLQKRSDWLKHWETYYFVLRGSSLYC--YLSEEDARRQNAKSKIKKGRFGFSD  127

>PYAR_18690
Length=2455

 Score = 36.2 bits (82),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 47/112 (42%), Gaps = 11/112 (10%)

Query  2     NILRLPEP----GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
             ++L  PEP     A  S  +      EGY+ KRGH   S R R+ VL  + L   YY ++
Sbjct  1112  SLLPAPEPVDEISAVESSHETSSILMEGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQ  1169

Query  58    AACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGF  109
                   N +++ P GSF +  +       G        FG ++  H  +  F
Sbjct  1170  EDSR--NSDTSQPLGSFRVEIVSDWH---GKTAMQTYEFGMELETHDGKTFF  1216

>SDRG_02135
Length=306

 Score = 35.4 bits (80),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
           EGY+ K+GH  K+WR R+  L  ++L  AYY+S
Sbjct  2   EGYLLKQGHVVKNWRRRYFRLVDASL--AYYDS  32

>SPRG_11536
Length=1087

 Score = 35.8 bits (81),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 2/55 (4%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
            EGY+ KR  + K W   + VL G  L     E  A  HP N  S +  G F  S+
Sbjct  181  EGYLMKRSDWLKHWETYYFVLHGRVLCCYLSEDDARLHPEN--SKIKDGRFTFSD  233

>PHYSO_289146
Length=122

 Score = 33.9 bits (76),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 39/104 (38%), Gaps = 29/104 (28%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG------------------  65
            EG +TKR  + K WR R+ VL G+ L    Y  RA   P +G                  
Sbjct  16   EGELTKRSVWLKEWRKRYFVLKGNKL----YFCRAQGEPAHGLIDLADCLTVKSAEEKTN  71

Query  66   -----ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVG  102
                 E   P  +FY+   N +  +  IG +G A   F     G
Sbjct  72   KRFCFEVATPDSTFYMYAENEKQKDEWIGAIGRAIVKFSSSFTG  115

>PITG_13665
Length=122

 Score = 33.9 bits (76),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 39/104 (38%), Gaps = 29/104 (28%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG------------------  65
            EG +TKR  + K WR R+ VL G+ L    Y  RA   P +G                  
Sbjct  16   EGELTKRSVWLKEWRKRYFVLKGNKL----YFCRAQGEPAHGLIDLADCLTVKSAEEKTN  71

Query  66   -----ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVG  102
                 E   P  +FY+   N +  +  IG +G A   F     G
Sbjct  72   KRFCFEVATPDSTFYMYAENEKQKDEWIGAIGRAIVKFSSSFTG  115

>H310_01921
Length=341

 Score = 35.4 bits (80),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (55%), Gaps = 8/66 (12%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE-PHE  83
           G+V K+G   KSW+ R++VL   N Q+ Y+ES        G S   KGSF +  +E  H+
Sbjct  24  GWVYKQGSMIKSWKKRYMVL--KNKQLTYFES----EKVEGNSK-AKGSFQVITVEIAHD  76

Query  84  YVIGVM  89
              G++
Sbjct  77  IKNGLL  82

>PHYCA_510506
Length=121

 Score = 33.9 bits (76),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 39/104 (38%), Gaps = 29/104 (28%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG------------------  65
            EG +TKR  + K WR R+ VL G+ L    Y  RA   P +G                  
Sbjct  16   EGELTKRSVWLKEWRKRYFVLKGNKL----YFCRAQGEPAHGLIDLADCLTVKSAEEKTN  71

Query  66   -----ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVG  102
                 E   P  +FY+   N +  +  IG +G A   F     G
Sbjct  72   KRFCFEVATPDSTFYMYAENEKQKDEWIGAIGRAIVKFSSSFTG  115

>SPRG_08217
Length=687

 Score = 35.8 bits (81),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 31/56 (55%), Gaps = 11/56 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
           EG++TKR  H    W  R+ +LDG+NL+  YY+ R            P+G++ L++
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKRG--------DPAPRGAYVLTD  47

>SDRG_04871
Length=687

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 31/56 (55%), Gaps = 11/56 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
           EG++TKR  H    W  R+ +LDG+NL+  YY+ R            P+G++ L++
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKRG--------DPAPRGAYVLTD  47

>SDRG_03175
Length=934

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query  9   PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYE  55
           P AT    +A P   EGY+ KRG +   W   ++VL G +L  AY++
Sbjct  11  PSATDRHLQALPLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--AYFD  55

>PHALS_06568
Length=388

 Score = 35.4 bits (80),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 30/56 (54%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
           G+V K+G   KSW+ R++VL G   Q+ YY++         +   PKGS  +  +E
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGR--QLTYYDTAKV-----DQKVKPKGSCQVITVE  60

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  14   SGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGE  66
            S D ++  +  G++ K G   KSWR RF VL G++L     E   A    +G+
Sbjct  142  SEDGSEQVTHSGWLKKEGARVKSWRRRFFVLRGNSLSYFNSEDTGAIAKGSGD  194

>PPTG_19631
Length=122

 Score = 33.9 bits (76),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 39/104 (38%), Gaps = 29/104 (28%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG------------------  65
            EG +TKR  + K WR R+ VL G+ L    Y  RA   P +G                  
Sbjct  16   EGELTKRSVWLKEWRKRYFVLKGNKL----YFCRAQGEPAHGLIDLADCLTVKSAEEKTN  71

Query  66   -----ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVG  102
                 E   P  +FY+   N +  +  IG +G A   F     G
Sbjct  72   KRFCFEVATPDSTFYMYAENEKQKDEWIGAIGRAIVKFSSSFTG  115

>PHYSO_529931
Length=2211

 Score = 35.8 bits (81),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQ--VAYYESRAACHPPNGESTMPKGSF  74
             EGY+ KRGH   S R R+ VL G+ L   V + +S+   +P  G +T P G+F
Sbjct  989   EGYLMKRGHKIPSMRKRYCVLVGNELSYFVTHDDSK---NPGGGATTNPLGNF  1038

>H310_05691
Length=1125

 Score = 35.8 bits (81),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 29/65 (45%), Gaps = 2/65 (3%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
            EGY+ KR  + K W   + VL G  L     E  A  HP N  S +  G F  S+    +
Sbjct  192  EGYLMKRSDWLKHWETYYFVLHGRVLCCYLSEDDARLHPEN--SRIKDGRFTFSDKVVLD  249

Query  84   YVIGV  88
             VI +
Sbjct  250  KVIDI  254

>PHALS_00631
Length=1113

 Score = 35.8 bits (81),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (45%), Gaps = 27/128 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
            G + +R     +W+ R  VL+ S LQ   Y SR      N +  +P        + PH  
Sbjct  52   GKLMRRDRRLFTWKWRDFVLERSRLQ---YFSRKG----NRKGDIP--------LTPHTP  96

Query  85   VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAI  144
            +   M    +PFGF +  +       +L +   T+ +R++W++V C+   A       ++
Sbjct  97   ITIRMCNEPKPFGFLLFIND-----TKLTLAAATERERHRWIDVFCDVFHA-------SV  144

Query  145  DQSVSPNK  152
            +Q+ + NK
Sbjct  145  EQTPADNK  152

>CCA23572
Length=868

 Score = 35.8 bits (81),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 50/120 (42%), Gaps = 15/120 (13%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGES----TMPKGSFYLSNI  79
            EGY+ K+G   K W+ R+ V DG  L  +YY +     P    S    T+  G    +  
Sbjct  3    EGYLQKKGQRLKGWKQRWFVCDGRTL--SYYITSKDRRPNAIISLDGCTVQDGGMSETWQ  60

Query  80   EPHEY-------VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVE-TQTDRNKWLEVACN  131
             P  Y       V+  + + D P     + H  RK   +L      TQTD+   L V+C+
Sbjct  61   SPRIYLTDRATGVLYCLSSEDAPVVIDWL-HVLRKAVAQLSTETHTTQTDKRIPLPVSCD  119

>PITG_07289
Length=1347

 Score = 35.8 bits (81),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 56/117 (48%), Gaps = 21/117 (18%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH----PPNGESTMPKGSFYL---S  77
            G + KRG   K+++ R++ LDGS L  AYY+ +   H      + +    +G   L   S
Sbjct  162  GILRKRGEGIKAFKKRYMELDGSVL--AYYKKKPEKHGIPLSRDEKKAYERGCIDLDKVS  219

Query  78   NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
            +++P       M     P+GF +V  A R   +  D    ++T+ ++W++  C  +K
Sbjct  220  SLQP-------MDNKSEPYGFLLVTTA-RTWVLAAD----SETEYHRWIKALCGVVK  264

>PPTG_04165
Length=1350

 Score = 35.8 bits (81),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 56/117 (48%), Gaps = 21/117 (18%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH----PPNGESTMPKGSFYL---S  77
            G + KRG   K+++ R++ LDGS L  AYY+ +   H      + +    +G   L   S
Sbjct  162  GILRKRGEGIKAFKKRYMELDGSVL--AYYKKKPEKHGIPLSRDEKKAYERGCIDLDRVS  219

Query  78   NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
            +++P       M     P+GF +V  A R   +  D    ++T+ ++W++  C  +K
Sbjct  220  SLQP-------MDNKSEPYGFLLVTTA-RTWVLAAD----SETEYHRWIKALCGVVK  264

Lambda      K        H        a         alpha
   0.316    0.132    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22557298065

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40