Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_06477147571166116660160.0
PPTG_17128147571177118439010.0
PHYSO_321157147571180117438430.0
PITG_18457147571170117537970.0
PHYRA_95901147571075116036180.0
PYIR_13453147571186121826690.0
PHYCA_344751475769272526330.0
PYIW_1879314757997102524330.0
PYAP_17746147571169115823740.0
PYU1_G0017341475780081122260.0
SDRG_01764147571092114519600.0
H257_06305147571099117118450.0
H310_09212147571113116718310.0
SPRG_063541475788490016790.0
CCA18898147571147116014630.0
CCI45122147571105115813913e-172
PHYKE_8394147574282228201e-97
PYAR_13581147577303036781e-74
PHYSO_3042604891820285910.052
H257_06641705055266930.064
SDRG_02078705050750784.3
SDRG_01714139881233121784.8
H257_01880595134630765.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_06477

Length=1166
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHALS_06477                                                           2321       0.0   
PPTG_17128                                                            1507       0.0   
PHYSO_321157                                                          1484       0.0   
PITG_18457                                                            1467       0.0   
PHYRA_95901                                                           1398       0.0   
PYIR_13453                                                            1032       0.0   
PHYCA_34475                                                           1018       0.0   
PYIW_18793                                                            941        0.0   
PYAP_17746                                                            919        0.0   
PYU1_G001734                                                          862        0.0   
SDRG_01764                                                            759        0.0   
H257_06305                                                            715        0.0   
H310_09212                                                            709        0.0   
SPRG_06354                                                            651        0.0   
CCA18898                                                              568        0.0   
CCI45122                                                              540        3e-172
PHYKE_8394                                                            320        1e-97 
PYAR_13581                                                            265        1e-74 
PHYSO_304260                                                          39.7       0.052 
H257_06641                                                            40.4       0.064 
SDRG_02078                                                            34.7       4.3   
SDRG_01714                                                            34.7       4.8   
H257_01880                                                            33.9       5.4   

>PHALS_06477
Length=1166

 Score = 2321 bits (6016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1166/1166 (100%), Positives = 1166/1166 (100%), Gaps = 0/1166 (0%)

Query  1     MSVRVDTCCSAKAVGMEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPK  60
             MSVRVDTCCSAKAVGMEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPK
Sbjct  1     MSVRVDTCCSAKAVGMEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPK  60

Query  61    RHSSVITNAEVQAFHALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVA  120
             RHSSVITNAEVQAFHALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVA
Sbjct  61    RHSSVITNAEVQAFHALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVA  120

Query  121   APSPIKHRRGDSRADEFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG  180
             APSPIKHRRGDSRADEFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG
Sbjct  121   APSPIKHRRGDSRADEFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG  180

Query  181   ARRVRKKTTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAG  240
             ARRVRKKTTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAG
Sbjct  181   ARRVRKKTTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAG  240

Query  241   PNGKSNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKP  300
             PNGKSNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKP
Sbjct  241   PNGKSNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKP  300

Query  301   NHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFedqedeeg  360
             NHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFEDQEDEEG
Sbjct  301   NHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFEDQEDEEG  360

Query  361   sddsdiikdegFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVV  420
             SDDSDIIKDEGFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVV
Sbjct  361   SDDSDIIKDEGFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVV  420

Query  421   HDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVM  480
             HDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVM
Sbjct  421   HDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVM  480

Query  481   SVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCT  540
             SVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCT
Sbjct  481   SVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCT  540

Query  541   ALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQ  600
             ALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQ
Sbjct  541   ALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQ  600

Query  601   QNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQA  660
             QNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQA
Sbjct  601   QNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQA  660

Query  661   ARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPS  720
             ARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPS
Sbjct  661   ARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPS  720

Query  721   QALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDP  780
             QALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDP
Sbjct  721   QALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDP  780

Query  781   LGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIH  840
             LGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIH
Sbjct  781   LGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIH  840

Query  841   TELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVL  900
             TELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVL
Sbjct  841   TELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVL  900

Query  901   TTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNA  960
             TTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNA
Sbjct  901   TTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNA  960

Query  961   AVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDA  1020
             AVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDA
Sbjct  961   AVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDA  1020

Query  1021  MDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGT  1080
             MDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGT
Sbjct  1021  MDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGT  1080

Query  1081  LFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSVLGNFAD  1140
             LFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSVLGNFAD
Sbjct  1081  LFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSVLGNFAD  1140

Query  1141  VLSTVRASTGGGSSNRLGQVHRMLKL  1166
             VLSTVRASTGGGSSNRLGQVHRMLKL
Sbjct  1141  VLSTVRASTGGGSSNRLGQVHRMLKL  1166

>PPTG_17128
Length=1177

 Score = 1507 bits (3901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/1184 (68%), Positives = 920/1184 (78%), Gaps = 47/1184 (4%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
             MEKVQQ  HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RHS+++T AEVQAF+
Sbjct  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  76    ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRRGDSRAD  135
             A+LQQTE+ELR+KAELVLNG++NSSN+  N+Q Q    LPAV+VAA    KHR G + A+
Sbjct  61    AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG---ARRVRKKTTQHY  192
             +     ++D +S  MEFFR+QFRN+ VEIRQSLM SPE W+R  G    R +RKKTTQH 
Sbjct  121   K---PRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHC  177

Query  193   RLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCA  252
             RLLP VNK DPS P P+LREEDA  G+LNLVTRGFLPAYADLTPAFAGPNG SNGS G  
Sbjct  178   RLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGI  237

Query  253   LKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDF------------------------  288
             +K RAT IYDRS+++ R TP   S G+NLA LKFD                         
Sbjct  238   MKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLMPPESTTR  297

Query  289   -RTSSTPSSAPKPNHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENN  347
              R+    S+   PN    V+ S P +  + +  + S+      S  VAA  NQ ED++NN
Sbjct  298   RRSVRKSSAVQGPNR---VTMSFPKSG-NKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNN  353

Query  348   CTHSFedqedeegsddsdiikdegFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAI  407
                  +D   +E  ++ +  KDE    ++L  NV KIR YN+L+DAYSLHQ LI+KGR +
Sbjct  354   RGRFSDDDVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTM  413

Query  408   RDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRR  467
             RDTPEF SFRRV  +LWGSVEE LRALEA+L QYFVPLA+VDGQRL+ALA T QP+FS+R
Sbjct  414   RDTPEFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKR  473

Query  468   ELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAI  527
             ELLSCIVN++Q+MSVLRRPGQRY GRDRK RAATT+QAC RMW+V  RY +SR+S+INA 
Sbjct  474   ELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINAT  533

Query  528   KIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLG  587
             KIQ A+RAYS  TALK RLRE+R EK  KWE RM   KSQWSQIAARRR+VVHVPS+SL 
Sbjct  534   KIQLAWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLD  593

Query  588   EHSRLNAENFAVQQNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPAD  647
             EH RL+AENFAVQQNLQLTR+CA ALD  VDLLVYVSP+ELTADV QYF KLLQL G  D
Sbjct  594   EHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVD  653

Query  648   SRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLA  707
             S PRVKFV+PEQ+ RFPAHFSLSSL+LYSP+CLRRIRHYT G EAYLVMGLPG EDQRLA
Sbjct  654   SGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLA  713

Query  708   ITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHI  767
             I LDLPILGA P+QALPLLTRSGGKRLLI+AD+NVP GTYELYDEHE+  ALAKLA+AH+
Sbjct  714   IALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHM  773

Query  768   DQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFE  827
             DQ KWLIKLDYDPLGVGEAVVDLS++QAMREL REKRTPEYWRQPG RDAAA + L E E
Sbjct  774   DQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELE  833

Query  828   RPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASME------EPTYLRA  881
             RPG LARL  P+H+E++PTWR+Y  A+GHFGCVIEAVPPTA AAS E      EP Y+RA
Sbjct  834   RPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRA  893

Query  882   NIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETN  941
             N+FVDP+G+VH+TSTQNVL T  GGL+RK+  F FPQT APH AIKGACNA GK L ETN
Sbjct  894   NLFVDPDGSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETN  953

Query  942   VWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVP  1001
             VWGYVSLDFVVFQD KSN A RLWALA+HPFLT+SAA+FACFHLL RG LD NSG YRV 
Sbjct  954   VWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRV-  1012

Query  1002  GTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTF  1061
              +K L T      SG     DLLLREASL K    GA RC+VVCSYVFHP+VT  QYT F
Sbjct  1013  ASKSLTTVTGRNGSGC--TTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAF  1070

Query  1062  FQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAG  1121
             F  CRLHGVCFDV R LGTLFLLADSLTAGVFG+LSIGET + AL++LRTALEVIGREAG
Sbjct  1071  FHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAG  1130

Query  1122  ATKGIVSSSSRSV---LGNFADVLSTVRASTGGGSSNRLGQVHR  1162
             +T  +VSS SR V    GNFA VLS VRASTGGG S+RLG++ R
Sbjct  1131  STINMVSSPSRPVSGRSGNFAQVLSAVRASTGGGKSDRLGKMQR  1174

>PHYSO_321157
Length=1180

 Score = 1484 bits (3843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 780/1174 (66%), Positives = 909/1174 (77%), Gaps = 38/1174 (3%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
             MEKVQQ +HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RHS+V+T AEVQAF+
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  76    ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRRGDSRAD  135
             A+LQQTE+ELRAKAELVLNG++NSS+S  N+Q Q  T LPAV+VAAP   +HR G ++  
Sbjct  61    AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR  120

Query  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG---ARRVRKKTTQHY  192
                    +D +S  MEFFR+QFRN+ VE+RQ+LM SP + +R  G    R +RKKTTQH 
Sbjct  121   V---AKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHC  177

Query  193   RLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCA  252
             RLLP VNK DPS PTP+LREEDA  G+LNLVTRGFLPAYADLTPAFAGP+G ++GSGG  
Sbjct  178   RLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGANDGSGGGV  237

Query  253   LKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSATVSA----  308
             +K RAT I+DRS++S R TP   S G+NLA LKFD R   TP      +     +     
Sbjct  238   MKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRAPFTPPPPAPESSPPATATTRRR  297

Query  309   -----------SMPNTKFSSIMQTVSSGPAKRNSLVV----AAPRNQNEDIENN---CTH  350
                        S     F    +   SG + R S +V    AA  NQ++D+E+N    + 
Sbjct  298   STRRGSAGHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSE  357

Query  351   SFedqedeegsddsdiikdegFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDT  410
               +++  +E  +D +  KDE    ++L  NV KIR YN+L+DAYSLHQ LI+KGR +RDT
Sbjct  358   QPDEEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDT  417

Query  411   PEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELL  470
             PEF SFRRV  +LWGSVEE LRALE +L QYFVPLA+ DGQRL++LAST QP+FS+RELL
Sbjct  418   PEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLSLASTGQPRFSKRELL  477

Query  471   SCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQ  530
             SCIVN+EQVM+VLRRPGQRY GRDRK RAATTIQAC RMW +  RYV+SR+S+ +A KIQ
Sbjct  478   SCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQ  537

Query  531   SAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHS  590
              A+RA+S   ALKARLRE+R E+   WEA+M + K+QW QIA RRR+VVHVPS+SL EHS
Sbjct  538   LAWRAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHS  597

Query  591   RLNAENFAVQQNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRP  650
             RL+AENFAVQQNLQLTRICAAALD  VDLLVYV+P+ELTADVS YF KLLQL G ADSRP
Sbjct  598   RLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRP  657

Query  651   RVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITL  710
             RVK V+PEQAARFPAHFSLSS++LYSP+CLRRIRHYTAG +AYLVMGLPG EDQRLAI L
Sbjct  658   RVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIAL  717

Query  711   DLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQS  770
             DLPILGA P QALPLLTRSGGKRLLI+AD+NVPTGTYELYDEHE+  ALAKLAVAH+DQ 
Sbjct  718   DLPILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQP  777

Query  771   KWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPG  830
             +WL+KLDYDPLGVGEAVVDLS MQAMREL REK+TPEYWRQPG RDAA+ L L E ERPG
Sbjct  778   RWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPG  837

Query  831   KLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASME------EPTYLRANIF  884
              LARL TP+HTE++P+WREY  AI HFGCV+EAVPPT+  AS E      EP Y+RAN+F
Sbjct  838   VLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLF  897

Query  885   VDPNGTVHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWG  944
             +DP+GTVH+TSTQNVL +  GGL+RK+  F FPQTVAPH A+KGAC A GK L ETNVWG
Sbjct  898   IDPDGTVHITSTQNVLASG-GGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWG  956

Query  945   YVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTK  1004
             YVSLDFVVFQD KS  A RLWALA+HPFLT+SAA+FACFHLL RG LDA+SG YR+    
Sbjct  957   YVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAAN  1016

Query  1005  KLQTACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQN  1064
                 A  + +SG     DLLLREASL K    G  RCYVVCSYVFHP+VT  QYT FF  
Sbjct  1017  STLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHA  1076

Query  1065  CRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATK  1124
             CRLHGVCFDV R LGTLFLL DSLTAGVFG+LS+GET   AL+++RTALEVIGREAGAT 
Sbjct  1077  CRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATV  1136

Query  1125  GIVSSSSR---SVLGNFADVLSTVRASTGGGSSN  1155
              + +S SR   +  GNFA VLS VRASTGGG  +
Sbjct  1137  EMATSPSRPGSARSGNFAQVLSAVRASTGGGKGD  1170

>PITG_18457
Length=1170

 Score = 1467 bits (3797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/1175 (66%), Positives = 904/1175 (77%), Gaps = 40/1175 (3%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
             M+KVQQ +HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RH++++T AEVQAF+
Sbjct  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  76    ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRRGDSRAD  135
             A+LQQTE+ELRAKAELVLNG++NSS+S  N+Q Q  T LPAV+VAA   I HR G  +A+
Sbjct  61    AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG---ARRVRKKTTQHY  192
             +     ++D +S  +EFFR+QFRNN VEIRQSL   PE W R  G    R +RKKTTQH 
Sbjct  121   K---PRQMDASSIPVEFFREQFRNNSVEIRQSL---PEPWERHFGIHHGRLMRKKTTQHC  174

Query  193   RLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCA  252
             RLLP VNK DPS PTP+LREEDA  G+LNLVTRGFLPAYADLTP F+G    S+GSGG  
Sbjct  175   RLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSG---TSDGSGGGV  231

Query  253   LKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRT----------SSTPSSAPKPNH  302
             +K RAT IY+RS++  R TP   S G+NLA LKFD R           ++ P S  +   
Sbjct  232   MKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPDSTTRRRS  291

Query  303   SATVSASMPNTKF--------SSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFed  354
             +   SA      F        S I    S+ P    S  VAA  NQ ED ENN     +D
Sbjct  292   TRRSSALQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFSDD  351

Query  355   qedeegsddsdiikdegFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFT  414
                +E  +  +  KDE    + L  NV KIR YN+L+D YSLHQ LI+KGR +RDTPEF 
Sbjct  352   DISDEEQESDENDKDEYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFV  411

Query  415   SFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIV  474
             SFRRV  +LWGSVEE LRALE +L QYFVPLA+VDGQRL+ALA T QP+FS+RELLSCIV
Sbjct  412   SFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV  471

Query  475   NKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFR  534
             N++QVMSVLRRPGQRY GRDRK RAATTI+AC RMW+V  RY ++R+S+ NA KIQ A+R
Sbjct  472   NEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWR  531

Query  535   AYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNA  594
             AYS  T+LKARLRE+  EK  KWE RM+  KS W QIA RRR+VVHVPS+SL EHSRL A
Sbjct  532   AYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGA  591

Query  595   ENFAVQQNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKF  654
             ENFA+QQNLQLTR+CAAALD  V+LL+YVSP+ELT+DVSQYF KLLQL G  DSRPRVK 
Sbjct  592   ENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKL  651

Query  655   VYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPI  714
             V+PEQ  RFPAHFSLSSL+LYSP+CLRRIRHYT G EAYLVMGLPG EDQRLA+ LDLPI
Sbjct  652   VFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPI  711

Query  715   LGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLI  774
             LGA P+QALPLLTRSGGKRLLI+AD+NVP GTYELYDEHE+  ALAKLA+AH+DQ +WLI
Sbjct  712   LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLI  771

Query  775   KLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLAR  834
             KLDYDPL VGEAVVDLS+MQAMREL REKRTPEYWRQPG RDAAA L L E ERPG LAR
Sbjct  772   KLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLAR  831

Query  835   LTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASME------EPTYLRANIFVDPN  888
             + TP+ TE++P WRE+  A+GHFGCV+EAVPPTA AAS E      EP Y+RAN+FVDP+
Sbjct  832   IATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPD  891

Query  889   GTVHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSL  948
             G+VH++STQNVL    GGL+RK+  F FPQT AP+ AIKGACNA GK L ETNVWGYVSL
Sbjct  892   GSVHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSL  951

Query  949   DFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQT  1008
             DFVVFQD KSN A RLWALA+HPFLT+SA +FACFHLL RG LD NSG+YRV   K L T
Sbjct  952   DFVVFQDEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRV-ANKSLTT  1010

Query  1009  ACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLH  1068
             A +  +S +  A DLLLREA L K+   GA RC+V CSYVFHP+V   QYT FF  CRLH
Sbjct  1011  ANSGRKSESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLH  1070

Query  1069  GVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVS  1128
             GVCFDV R LGTLFLLADSLTAGVFGILSIGET + AL++LRTALEVIGREAG+T  + S
Sbjct  1071  GVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVAS  1130

Query  1129  SSSRSVL---GNFADVLSTVRASTGGGSSNRLGQV  1160
             S SRSV    GNFA +LS +R STGGG S+RLG++
Sbjct  1131  SPSRSVASRSGNFAQILSAIRVSTGGGKSDRLGKM  1165

>PHYRA_95901
Length=1075

 Score = 1398 bits (3618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/1160 (64%), Positives = 875/1160 (75%), Gaps = 99/1160 (9%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
             MEKVQQ +HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RHS+V+T AEVQAF+
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  76    ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRRGDSRAD  135
             A+LQQTE ELRAKAELVL G++NSS+S   +Q Q  T LP V+VAAP   +HR G     
Sbjct  61    AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSG-----  115

Query  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG---ARRVRKKTTQHY  192
              +G     D +S  +EFFR+QF N+ VE+RQSLM SP++W+R  G    R +RKKTTQH 
Sbjct  116   -YG-----DASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHC  169

Query  193   RLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCA  252
             RLLP VNK DP+ PTP+LREEDA  G+LNLVTR                +G  +GSG   
Sbjct  170   RLLPSVNKVDPTAPTPELREEDAKHGVLNLVTRS---------------SGTKDGSG--V  212

Query  253   LKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSATVSASMPN  312
             +K RAT IYDRS++ AR TP   S G+NLA LKFD R++ T                   
Sbjct  213   MKQRATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGT-------------------  253

Query  313   TKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFedqedeegsddsdiikdegF  372
                         G   R+          N+D+E N  H  + +  +E    +D  KDE  
Sbjct  254   ------------GKNDRS----------NDDMEGNREH-IDGEISDEDQGGADNDKDEEA  290

Query  373   STKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLR  432
               ++L  NV KIR YNDL+DAYSLHQ LI+KGR++RDTPEF SFRRV  +LWGSVEE LR
Sbjct  291   EMEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALR  350

Query  433   ALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNG  492
             ALE +L QYFVPLA+VDGQRL++LA+T QP+FS+ ELL+CIVN+EQVMSVLRRPGQRY G
Sbjct  351   ALETLLTQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKG  410

Query  493   RDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCE  552
             RDRK RAATTIQAC RMW +  RYV+SR+S+I+A +IQ A+R+YS   ALK RLRE+R E
Sbjct  411   RDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVRRE  470

Query  553   KAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICaaa  612
             +  +WEARM + ++QW QIA RRR+VVHVPS+SL EHSRL+AENFAVQQNLQLTRICAAA
Sbjct  471   QLERWEARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAA  530

Query  613   ldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSL  672
             LD  VDLLVYVSP+ELTADVSQYF KLLQL G ADSRPRVK V+PEQAARFP HFSLSSL
Sbjct  531   LDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSL  590

Query  673   ILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGK  732
             +LYSP+CLRRIRHYTAG EAYLVMGLPG EDQRLA+ LDLPILGA P+QALPLLTRSGGK
Sbjct  591   LLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGK  650

Query  733   RLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSS  792
             RLLI+AD+NVPTGTYELYDEHE+  ALAKLAVAH++Q KWL+KLDYDPLG+GEAVVDLS 
Sbjct  651   RLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSG  710

Query  793   MQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREYAA  852
             MQAMREL REKRTPEYWRQPG RDAAA L L E ERPG LARL TP+HTE++P WR++  
Sbjct  711   MQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTE  770

Query  853   AIGHFGCVIEAVPPTASAASME------EPTYLRANIFVDPNGTVHMTSTQNVLTTTRGG  906
             AIGHFGCVIEAVPP   AA+ E      EP Y+RAN+FV P+G       +NVL ++ GG
Sbjct  771   AIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDG-------KNVLASSGGG  823

Query  907   LSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWA  966
             L+RK+  F FPQT APH A++GAC+A GK L ET+VWGYVSLDFVVFQD K+  + RLWA
Sbjct  824   LNRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWA  883

Query  967   LAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDAMDLLLR  1026
             LA+HPFLT+SAA+FACFHLL RG        YRV  +  +  A    +SG+  A DLLLR
Sbjct  884   LAVHPFLTDSAASFACFHLLARGA-------YRVAASNSMVNANPG-RSGSGGAADLLLR  935

Query  1027  EASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLAD  1086
             EASLTKA   GA RC+VVCSYVFHP+VT  QY+ FF  CRLHGVCFDV R LGTLFLLAD
Sbjct  936   EASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLAD  995

Query  1087  SLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSVL---GNFADVLS  1143
             SLTAGVFGILS+GET + AL++LRTALEVIGRE GAT  I  ++SR V    GNFA VLS
Sbjct  996   SLTAGVFGILSVGETTEGALAFLRTALEVIGREVGAT--IEMATSRPVSTRNGNFAQVLS  1053

Query  1144  TVRASTGGGSSNRLGQVHRM  1163
              VRASTGGG  +RLG++ R+
Sbjct  1054  AVRASTGGGKGDRLGKMRRL  1073

>PYIR_13453
Length=1186

 Score = 1032 bits (2669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/1218 (46%), Positives = 773/1218 (63%), Gaps = 105/1218 (9%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
             M++ QQ +HVEDVGR+LL+TQEQLR MREQM  AA S   + S +  SS  +  +V AF 
Sbjct  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQM--AATSTTPSSSMRFASSGASQPDVLAFQ  58

Query  76    ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAA---PSPIKHRRGDS  132
              +LQ+ E E+RAKAELVLNG +N+S+          + LP VS +A    SP    R + 
Sbjct  59    EILQRAEVEIRAKAELVLNGFVNTSSQA--------SALPTVSSSANGNASPKARLRQNV  110

Query  133   RADEFGHIN-RIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGARRVRKKTTQH  191
              +      N R+ ++   +++FR +F N  VE   S +  P   +R +  + V+KK  Q+
Sbjct  111   TSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVL-PSPVQRITKGQLVKKKMAQN  169

Query  192   YRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGC  251
              RLLP VNK+DPS PTP+L E+DA  G+L+LV RGFLP  ADLTPAF   +G        
Sbjct  170   ARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHG-------S  222

Query  252   ALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTP------SSAPKPNHSAT  305
              +K+  T IYDR ++  R  P     GFN+A LKFD    ST       S+  +P+   T
Sbjct  223   IIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRT  282

Query  306   VSASMPNTKFSSIM----QTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFedqedeegs  361
              +A+   +K  S +    Q  +S   +     V     Q + +  N   S          
Sbjct  283   AAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAML  342

Query  362   ddsdiikdegFSTK------------------------DLAVNVAKIREYNDLVDAYSLH  397
                   + E   T                         +L  NV KIR YN+L+D YSLH
Sbjct  343   STDQSQEAESPETNLDDEVNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYSLH  402

Query  398   QILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALA  457
             Q +I+KGRA+R+TPEF SF+RV  ++WGSVEEV+RALEA+L +YFVPLA++DGQRL+ +A
Sbjct  403   QFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVA  462

Query  458   STNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYV  517
             +     FS+R+LLSCIVN++QV S++RRPGQRY G+DRK RAA TIQ   RMW    +Y 
Sbjct  463   AMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYT  522

Query  518   KSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRI  577
             + R    + + IQ  +RA++   +LK +L+  R ++  +WEA+M   K  W+ I   RR+
Sbjct  523   RFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRV  582

Query  578   VVHVPSMSLGEHSRLNAENFAVQQNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFH  637
             V+HVPS+S+ E SR++A+NF+V+QN+QL+R+C         +  YVSP+ELTADV+QY  
Sbjct  583   VIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIV--YVSPFELTADVAQYSM  640

Query  638   KLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMG  697
             KLLQL G AD   RVK VYPEQAARFPAHFSL++L+LYSP+CLRRI+ Y    EAYLV G
Sbjct  641   KLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTG  700

Query  698   LPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISV  757
             +PG ED+RLA+ L++PILG  P  ALPL+T+SG KR  ++AD+NVPTGTY++YDE E+  
Sbjct  701   IPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVF  760

Query  758   ALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDA  817
             +LAKL ++HI+QS W++K+DYDP G G A++D+S+M  +RE+ REK++PEYW+QP TRD 
Sbjct  761   SLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDN  820

Query  818   AANLFLTEFERPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPT  877
             AA   + E ER   LA L TP+H E+YP+W+E+  AI  FG V+EA P            
Sbjct  821   AARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIG-------  871

Query  878   YLRANIFVDPNGTVHMTSTQNVLTTTRGGLSR-------------KSEIFAFPQTVAPHA  924
             ++RAN+F++P+G VH++STQ+++TT+    S              K+  +AFPQT AP+ 
Sbjct  872   HVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSKTVGYAFPQTAAPYE  931

Query  925   AIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFH  984
             AI+GA  A+GK LA+  V+GY S+D++VFQ+ K++AA RLWA+A+HP+LT+SA+TFA FH
Sbjct  932   AIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA-RLWAMALHPYLTDSASTFATFH  990

Query  985   LLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDA----------MDLLLREA------  1028
             LL RG L+A+SG+Y +P      ++ + +      +           DL+++EA      
Sbjct  991   LLNRGALNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSAADLVMQEATHSGLV  1050

Query  1029  SLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSL  1088
             SL KA   GA R YVV  Y+FHPNV+  QY+ FF  CRLHGVCFDV R +G++FLLADSL
Sbjct  1051  SLEKA---GAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSL  1107

Query  1089  TAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVS---SSSRSVLGNFADVLSTV  1145
             TAGVFGI+   ++A  AL +LRTALEVIGRE G T+ ++        S  GNFADVL+ +
Sbjct  1108  TAGVFGIMCCSDSASGALGFLRTALEVIGREVG-TQALMDEFMGGGESETGNFADVLAVI  1166

Query  1146  RASTGGGSSNRLGQVHRM  1163
             RA TGG S+ +L ++ R+
Sbjct  1167  RALTGGKSA-KLEKIRRL  1183

>PHYCA_34475
Length=692

 Score = 1018 bits (2633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/725 (72%), Positives = 587/725 (81%), Gaps = 39/725 (5%)

Query  385   REYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVP  444
             R YN+L+DAYSLHQ LI+KGR +RDTPEF SF RV  +LWGSVEE LRALE +L  YFVP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  445   LAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQ  504
             LA+VDGQRL++LA+T QP+FS+RELLSCIVN+EQVM+ LRRPGQRY GRDRK RAATTIQ
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  505   ACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEF  564
             A  RMW    RY +SR+ +INA +IQ A+RAYS   ALKARLRE+R E+  KWEARM+  
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  565   KSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICaaaldlqvdllvYVS  624
             KSQW+QIA+ RR+VVHVPS+SL E+SRL+AEN AV+QNLQLTRICAAALD +VDLLVYVS
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  625   PYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIR  684
             P+ELT DVSQYF KLLQL G ADSRPRVK ++PEQA RFPAHFSLSSL+LYSP+CLRRIR
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  685   HYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPT  744
             HYTAG EAYLVMGLPG EDQRLA+TLDLPILGA P+QALPLLTRSGGKRLLI+AD+NVP 
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  745   GTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKR  804
             GTYELYDEHE+  ALAKLAVAH+DQ KWL KLDYDPLGVGEAVVDLS MQAMREL REKR
Sbjct  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  805   TPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAV  864
             TPEYWRQPG RDAAA L LTE ERPG LARL  P+H +++P+W E+A AIGHFGCVIEAV
Sbjct  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480

Query  865   PPTASAASME------EPTYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEIFAFPQ  918
             P TA A + E      EP Y+RAN+FVDP+G+VH+TST N+L T  GGL+R++  F FPQ
Sbjct  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540

Query  919   TVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAA  978
             T APH A+KGAC+A GK L ETNVWGYVSLDFVVFQD KSN A RLWALA+HPFLT+SAA
Sbjct  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600

Query  979   TFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQGA  1038
             +FACFHLL RG LDANSG+YR+                                      
Sbjct  601   SFACFHLLARGVLDANSGVYRMAAAS---------------------------------T  627

Query  1039  TRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSI  1098
              RC+VVCSYVFHP+VT  QYT FF  CRLHGVCFDV R LGTLFLLADSLTAGVFG+LSI
Sbjct  628   PRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSI  687

Query  1099  GETAQ  1103
             GET +
Sbjct  688   GETTE  692

>PYIW_18793
Length=997

 Score = 941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/1025 (49%), Positives = 664/1025 (65%), Gaps = 84/1025 (8%)

Query  190   QHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSG  249
             QH RLLP VNK DPS PTP+L E+DA  G+L+LV RGFLP   DLT AF       N  G
Sbjct  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFV------NSHG  56

Query  250   GCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRT---------SSTPS-----  295
             G    H+ T IYDR ++  R  P     GFN+A LKFD            S +PS     
Sbjct  57    GIIQNHK-TRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAA  115

Query  296   ----SAPKPNH-SATVSASMPNTKFSSIMQTVSSGPAKRNSL--VVAAPRNQNEDIENNC  348
                 +  + +H SA   A  PN     ++     G A+R +    V + + Q+  I ++ 
Sbjct  116   LAVVNGSQLDHDSAETRARGPN-----VLTVSFQGDARRGNFHATVRSAQQQHSGIRHHA  170

Query  349   THSFedqedeegsddsdiikdegFSTKD--------LAVNVAKIREYNDLVDAYSLHQIL  400
             +        E  S ++++ +D  +  KD        L  NV KIR YN+L+D YSLHQ +
Sbjct  171   S-----ANQEAESPETNVDEDLMYDEKDDDANAMDELRKNVEKIRGYNELLDTYSLHQFI  225

Query  401   IYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTN  460
             I+KGRA+R+TPEF SF+RV  ++WGSV+EV++ALEA+L +YFVPLA+VDGQRL+ +A+  
Sbjct  226   IHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAME  285

Query  461   QPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSR  520
                +S+R+LLSCIVN++QV S++RRPGQRY G+DRK RAA TIQ   RMW    +Y + R
Sbjct  286   MASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFR  345

Query  521   SSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVH  580
                 + + IQ  +R Y+    LK R++  R ++ A+WEA+M   K  W +I   RR+V+H
Sbjct  346   HHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIH  405

Query  581   VPSMSLGEHSRLNAENFAVQQNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLL  640
             VPS S+ E  RL+A+NF+V+QNLQL+R+C         +  YVSP+ELT DV QY  KLL
Sbjct  406   VPSFSVDERLRLSADNFSVKQNLQLSRLCGLVDSNVDIV--YVSPFELTTDVVQYSMKLL  463

Query  641   QLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPG  700
             QL G AD   RVK V+PE A RFP HFSL++L+LYSP+CLRRI+ Y    EAYLV G+PG
Sbjct  464   QLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPG  523

Query  701   PEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALA  760
             PED+RLA+ L++PILG  P  ALPL+T+SGGKR  ++AD+NVPTGTY++YDE E+  +LA
Sbjct  524   PEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLA  583

Query  761   KLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAAN  820
             KL V+HI+QS W++K+DYDP   G A++D+S+M A+RE+ REKR+PEYWRQPGTRD AA 
Sbjct  584   KLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAAR  643

Query  821   LFLTEFERPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLR  880
             + + E ER   L  L TP+H ELYP+W++YA AI  FG V+EA P            ++R
Sbjct  644   VIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVG-------HVR  694

Query  881   ANIFVDPNGTVHMTSTQNVL--------TTTRGGLSRKSEIFAFPQTVAPHAAIKGACNA  932
             AN+FV+P+G VH++STQ++L            G    KS  +AFPQT AP+ AI+GA  A
Sbjct  695   ANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGGAYRHKSVGYAFPQTAAPYEAIRGASTA  754

Query  933   VGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLD  992
             +GK LAE NV+GY S+DF+VFQ+ KS+ A RLWA+A+ P+LT+SAATF  FHLL RG L+
Sbjct  755   IGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALRPYLTDSAATFTTFHLLNRGALN  813

Query  993   ANSGIYRVPGTKKLQTACTAEQ------SGNHDAMDLLLREA------SLTKAIFQGATR  1040
               SG+Y +P       +    Q      +    A DL+L EA      SL K    GA  
Sbjct  814   TTSGLYYLPAATVTSASLVQLQSSSAAFASGASAADLVLHEATHSGLVSLEKV---GAQH  870

Query  1041  CYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGE  1100
              YVV  Y+FHPNV+  QY+ FF  CRLHGVCFDV R +G++FLLADSLTAGVFG++   +
Sbjct  871   TYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSD  930

Query  1101  TAQDALSYLRTALEVIGREAG--ATKGIVSSSSRSVLGNFADVLSTVRASTGGGSSNRLG  1158
             TA  AL +LRTALEV+GRE G  A     +S   +  GNFADVL+ +RA TGG S+ +L 
Sbjct  931   TASGALGFLRTALEVVGREVGTQALTDEFTSGGEAETGNFADVLAAIRALTGGKSA-KLE  989

Query  1159  QVHRM  1163
             ++ R+
Sbjct  990   KIRRL  994

>PYAP_17746
Length=1169

 Score = 919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/1158 (44%), Positives = 729/1158 (63%), Gaps = 74/1158 (6%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
             ME++QQ +HVEDVGR+LL+TQ+QLR +REQ+  +         P   S + +N       
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGS-------NGPGNGSVIASNNAGAEIE  53

Query  76    ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRRGDSRAD  135
              +LQ+ E ELR KAELVL+ I+ +  +   +  +    +P  +V  P   + RR  +   
Sbjct  54    EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELH  113

Query  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGA--------RRVRKK  187
             + G  +        +E+FRQ+F+   V+   S MT+    R++ G         + V+ K
Sbjct  114   DGGSYD------LDIEYFRQRFKRTAVDDASSTMTTAP--RQRGGGPTPTHAHGKVVKHK  165

Query  188   TTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNG-KSN  246
             TT + RLLP VNK DP+ P P L   DA  G+L+L+ RGFLP   DLTPAF   +  KS 
Sbjct  166   TTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQ  225

Query  247   GSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAP----KPNH  302
             G+    +++ +  ++ R ++  R T       FNLA LKFD    +T ++A     +P+ 
Sbjct  226   GNPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHD  285

Query  303   SATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNC-THSFedqedeegs  361
                 S ++P     ++  +  +G ++      ++PRN   + E++       D    E  
Sbjct  286   E---SEALPLRAMKTVTISFHNGKSE------SSPRNNARESEHDGRREDGNDTAPLERE  336

Query  362   ddsdiikdegFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVH  421
             D      +   S +DL  NV KIR YN+L+DAYSLHQ +I+KGRA+RDTPEF SF+RV  
Sbjct  337   DLDVTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQ  396

Query  422   DLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMS  481
             ++WGS+EEV++ALE +L +YFVPLA++DGQRL+ LAS    + S  ELL+C+VN++QV S
Sbjct  397   EIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVAS  456

Query  482   VLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTA  541
             ++RRPGQRY G+DRK RAATT+QA  RM +  +R+ K R +  +A+ IQ  +R+Y+   +
Sbjct  457   LIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQS  516

Query  542   LKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQ  601
             L+ RL  +R E+  +W+A++   +SQW  I  +RR+V+HV S+S+ E +RL+ ENF+V+Q
Sbjct  517   LRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQ  576

Query  602   NLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAA  661
             NLQL+R+    L  Q   +VYV+P+EL+ +VSQYF KLLQLSG A++  RV+ V+PE AA
Sbjct  577   NLQLSRLA--GLVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAA  634

Query  662   RFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGAL-PS  720
             +FP HFSL++ ++YSP C+RRI+    G EAYLVMG+PGPEDQRLA+ L +PILG   P+
Sbjct  635   QFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPT  694

Query  721   QALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDP  780
               LPL+TRSG KR  I+AD+NVPTGTY++YD  E+  +LAKL ++H++Q+ WL+KLD DP
Sbjct  695   SILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADP  754

Query  781   LGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIH  840
             LG G A++D+S M  +R++ REKR PEYW+QPG RD  A   L E ER  ++  L  P H
Sbjct  755   LGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELER--EIGSLLKPSH  812

Query  841   TELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVL  900
              E++ +W+E+A+AI  FG V+EA+P   +         +R NIF++P+G VH+ ST +VL
Sbjct  813   PEIFASWKEFASAIPEFGVVVEALPFHVAGV-------IRMNIFIEPSGDVHVMSTNDVL  865

Query  901   T---TTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVW-GYVSLDFVVFQD-  955
             +   TT     R+   F FPQT+ PH AI GA +AVG+ L E + + GY S+D  + Q+ 
Sbjct  866   SGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEE  925

Query  956   --IKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAE  1013
                  + A RLWA+++ P+LT+SAATFA FH L RG L+  +G Y +          TA 
Sbjct  926   SLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNL----------TAR  975

Query  1014  QSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFD  1073
             +S   ++ D  L  + +      GA R Y V  YVFHPNV+   Y  FF  CRLHGVCFD
Sbjct  976   ESTPPES-DSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFD  1034

Query  1074  VSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVS-----  1128
             V R +G++FLLADSLTAG+FG+LS GE+A  AL YLRTA EVIGRE G T+ +VS     
Sbjct  1035  VERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVG-TQSMVSGDSDI  1093

Query  1129  SSSRSVLGNFADVLSTVR  1146
              SS  + GNFA++L  +R
Sbjct  1094  GSSVQLSGNFAEILGLLR  1111

>PYU1_G001734
Length=800

 Score = 862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/811 (52%), Positives = 571/811 (70%), Gaps = 40/811 (5%)

Query  376   DLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALE  435
             DL  NV KIR YN+L+D YSLHQ +I+KG+A+R+TPEF SF+RV  ++WG VEEV++ALE
Sbjct  3     DLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALE  62

Query  436   AILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDR  495
              +L +YFVPLA+VDGQRL+ +AS     FS+++LLSCIVN++QV S++RRPGQRY G+DR
Sbjct  63    TLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDR  122

Query  496   KHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAA  555
             K RAA TIQ   RMW    +Y + R    + + IQ  +RAY+    L+ +L+  R ++  
Sbjct  123   KRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQHE  182

Query  556   KWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICaaaldl  615
             +WEARM   + +W +I A RR+++HVPS+S+ E  R+ A+NFAV+QNLQL+R+C      
Sbjct  183   QWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDAN  242

Query  616   qvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILY  675
                +  YVSP+ELT++V QYF KLLQL G AD   RVK V+PEQA RFPAHFSL++++LY
Sbjct  243   VDIV--YVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300

Query  676   SPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLL  735
             SP+CLRRIR    G EAYLV G+PG ED+RLA+ L++PILG  P   LPL+T+SG KR  
Sbjct  301   SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360

Query  736   IQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQA  795
             ++AD+NVPTGTY++YDE E+  +LAKL V+HI+Q+ WL+K+DYDP G G A+VD S + A
Sbjct  361   MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420

Query  796   MRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREYAAAIG  855
             +RE+ REK++PEYWRQPGTRD AA + + E ER   + +L TP+H E+YPTW+E+A AI 
Sbjct  421   LREIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADAIA  478

Query  856   HFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEIFA  915
              FG VIEA P            Y+RAN+FV+P+G VH++STQ+V+ +T     RK   +A
Sbjct  479   QFGVVIEAAPSAIVG-------YIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYA  531

Query  916   FPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTN  975
             FPQT AP+ AI+GA  A+GK L + +V+GY S+D++VF++ K++   RLWA+A+HP+LT+
Sbjct  532   FPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVP-RLWAMALHPYLTD  590

Query  976   SAATFACFHLLTRGCLDANSGIYRVPGTK---------------KLQTACTAEQSGNHDA  1020
             SA+TFA FHLL RG L+ ++G Y +P                  KL  + T   +G+  +
Sbjct  591   SASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASST-RAAGSATS  649

Query  1021  MDLLLREA------SLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDV  1074
              +L+L+EA      SL KA   GA R Y V  Y+FHPNV+  QY++FF  CRLHGVCFDV
Sbjct  650   ANLVLQEATHLGLVSLEKA---GAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDV  706

Query  1075  SRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAG--ATKGIVSSSSR  1132
              R  GT+F+LADSLTAGVFGI+  G+TA  AL +LRTALEVIGRE G  A    +     
Sbjct  707   ERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGD  766

Query  1133  SVLGNFADVLSTVRASTGGGSSNRLGQVHRM  1163
                GNFA+VL+ VR  TGG S+ +L ++ R+
Sbjct  767   CESGNFAEVLTVVRTLTGGKSA-KLEKIRRL  796

>SDRG_01764
Length=1092

 Score = 759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/1145 (37%), Positives = 638/1145 (56%), Gaps = 82/1145 (7%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
             M+++ Q YHVEDVGR+LL+ Q++LR MREQ+  +                  N ++ A  
Sbjct  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  43

Query  76    ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRR-GDSRA  134
             A+L++ E +LR+KAE+VLNG++N++              P+VS  +    K R   D+ A
Sbjct  44    AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMA  103

Query  135   DEFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENW-RRKSGARRVRKKTTQHYR  193
              + G ++     S+ +E  RQQ     V + +          R     R ++KK T   R
Sbjct  104   RD-GSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVTGPQR  162

Query  194   LLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCAL  253
             LLP VN+ DP  P PDL ++DA  G+LNLV RGF+P  ADL+ AF      ++G G   +
Sbjct  163   LLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF------THGDG--II  214

Query  254   KHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSATVSASMPNT  313
             ++    +YDRS++  +  P + S  FN+A LK D     T          A   A    +
Sbjct  215   QNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKLDLAPPPTEPDPTPLTRLAV--ARNKKS  272

Query  314   KFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFedqedeegsddsdiikdegFS  373
               +++  T      + + + V  P   +  IE   T                        
Sbjct  273   AVATVQLTFPGAKDEGDVVPVEDPTTDDGPIEPTDT------------------------  308

Query  374   TKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRA  433
               +L  NV KIR YNDL+D YSLHQ +I KG+ + +TPEF SF+R+  DLWGSV   +R 
Sbjct  309   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRE  368

Query  434   LEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGR  493
             LE +L  Y VPLA++DGQ+L+ +A+ +    S+ ELL+C++N ++V + + RPGQR+ G 
Sbjct  369   LETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGE  428

Query  494   DRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEK  553
             D +H AA  +Q+  RM +   R ++    +  A  IQ  +R Y     ++ +LR  R   
Sbjct  429   DSRHAAAILLQSVYRMHLTRRR-LRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREAD  487

Query  554   AAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICaaal  613
             A  WE +M  F + W +I  +RR+VVHVPS S  E +RLN +NFA++QNLQ+ R+CA A 
Sbjct  488   ARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIAD  547

Query  614   dlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLI  673
                  +  Y+SP+EL+AD+ +Y  +LLQL G AD   RV+ ++PE A RFP HFSL++++
Sbjct  548   PNVDVI--YISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATIL  605

Query  674   LYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKR  733
             LYSP+CL++I+ Y  G EAY+V G  GPED+RLAI L LP+LG  P +AL   TRSG KR
Sbjct  606   LYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKR  665

Query  734   LLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSM  793
             L  QAD+N+P G +++YDE E+ ++LAKL  A++ Q  WLIKLD DP   G A +D+ ++
Sbjct  666   LFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHAL  725

Query  794   QAMRELHREKR---TPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREY  850
             + + ++  EKR     EY+ QP  ++      + E     +  RL +P   ++YPTW+  
Sbjct  726   ECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHM  783

Query  851   AAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRK  910
                +   G VIEA PP   A        +RAN+F++P+G VH+TS Q  L   +     +
Sbjct  784   RPVVNRIGAVIEAYPPKVLA-------RVRANVFIEPSGGVHLTSAQEQLMQAKN--KHQ  834

Query  911   SEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAA------VRL  964
             S    +P T  P+AAI+GA  AV + +  + + GY S+D+V F D+K+         +RL
Sbjct  835   SVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRL  894

Query  965   WALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQ--SGNHDAMD  1022
             WAL + P LT +A +F  F  L+   LDA +G   +P      +  T +   +    A++
Sbjct  895   WALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVE  954

Query  1023  LLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLF  1082
              +L E+  +  +  G  R Y+   Y+FHPN+   QY  FF  CR+HGV FD+ +++G  F
Sbjct  955   KILSESPRSSNV--GPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAF  1012

Query  1083  LLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSVLGNFADVL  1142
             +LADSLTAGV G+L IGE+ ++A+   R ALE+IG + G      + +    LGNFA VL
Sbjct  1013  VLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGER-LGNFAAVL  1071

Query  1143  STVRA  1147
               +R+
Sbjct  1072  GAIRS  1076

>H257_06305
Length=1099

 Score = 715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/1171 (36%), Positives = 639/1171 (55%), Gaps = 109/1171 (9%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
             M+K+ Q YH EDVGR+LL+ Q++LR+MRE++       E N           N +V   +
Sbjct  1     MDKLCQQYHAEDVGRILLQAQDELRSMREKVN------EKN-----------NVDVNEIN  43

Query  76    ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRRGDSRAD  135
             A+L++ E++LRAKAE+VLNG++N+S  +          LPA+  A        +  S+  
Sbjct  44    AILERAEADLRAKAEIVLNGVVNNSMKM----------LPAIE-APGGKTSLSKFSSKLA  92

Query  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGARRV----------R  185
             +   +       +S E     +R    E R      P    R  G R V          +
Sbjct  93    QKRELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVK  152

Query  186   KKTTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKS  245
             KKTT+ +RLLP +N+ DP+ P+PDL EEDA  G+ NLVTRGFLP   D+TPAF       
Sbjct  153   KKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAFT------  206

Query  246   NGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTP-SSAPKPNHSA  304
                G   +++    IYDR+ +  +  P     GFN+A LKFD   S+TP +S P P    
Sbjct  207   --HGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM--STTPATSTPSP----  258

Query  305   TVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFedqedeegsdds  364
                          +   VS G   +   +V  P + + D  ++ +H   +Q     +   
Sbjct  259   -------------VAAVVSGGDVSK---MVVTPIDISFDAPSS-SHPPVEQPKGGATGGD  301

Query  365   diikdegFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLW  424
             D    +  +  +L  NV KIR YN+L+D YSLHQ +I KG+ + DTPEF SF+R   DLW
Sbjct  302   DTNGGDSSTIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLW  361

Query  425   GSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLR  484
             GSV   ++ LE +L  Y VPLA+VDGQ+L+ +A+ +       ELLSCI+N ++V S++R
Sbjct  362   GSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMR  421

Query  485   RPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKA  544
             RPGQRY G      A   IQ+  RM++   R +K+   N +A  IQ  +R+Y   + L+ 
Sbjct  422   RPGQRYKGSQGPDLAVVLIQSVWRMFLTKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQ  480

Query  545   RLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQ  604
             RL+ +R      W+A+M  F++ W  +  +RR+VVHVPS +  + +RL  +NF+++QNLQ
Sbjct  481   RLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQ  540

Query  605   LTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFP  664
             + R+CA A      +  Y+SP+EL+ D+ +Y  +LLQL G  D + R++ ++PE   RFP
Sbjct  541   MARMCAIADPNVDII--YISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFP  598

Query  665   AHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALP  724
              HFSL++L+LYSP+CL++I+ +  G  AY+V G  GPED+RLAI L +P+LG  P +AL 
Sbjct  599   EHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALL  658

Query  725   LLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVG  784
               TRSGGKR+ + AD+N+P G +++YDE E+  +L+KL  A +DQ++WL+K+D D    G
Sbjct  659   YGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTG  718

Query  785   EAVVDLSSMQAMRELHREKR-----TPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPI  839
              A +++  MQ++ ++  EKR       EY++QP  RDA       E       A   TP 
Sbjct  719   IASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTE-SYFAANITPC  777

Query  840   HTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNV  899
               ++Y +W E        G VIEA P           + +RAN+F++P+G VH+TS  ++
Sbjct  778   FPDVYASWAELRPVALRVGVVIEAYPSKVL-------SQVRANVFIEPSGGVHITSAHDL  830

Query  900   LTTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSN  959
               +         +   FPQT  P+ AI+GA  A+   +    + GY S+D++ F D K+ 
Sbjct  831   FMSPAN--KHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTL  888

Query  960   AA-----VRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQT------  1008
                     RLWA+ + P LTN+A +F  F  L+  C   N     + G   LQ       
Sbjct  889   VGGGRPRQRLWAMQVVPGLTNTAVSFVMFAFLS--CSQFNP----ITGKCHLQVAAPPPI  942

Query  1009  ---ACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNC  1065
                A  A  +    A++ +L       A+  G  R Y+V  Y++HPN+    ++TFF  C
Sbjct  943   AASATVAPITQAQKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTC  1002

Query  1066  RLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKG  1125
             RL+GV FD+ RA+G  F+LADSLTAGV G++ IGE  ++A    R A+E+IG + G  + 
Sbjct  1003  RLNGVSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVG-VQA  1061

Query  1126  IVSSSSRSVLGNFADVLSTVRASTGGGSSNR  1156
             +  S S   LGNF  +L+ VR  +   +  R
Sbjct  1062  LPDSLSGERLGNFPHLLAIVRNKSDDPADRR  1092

>H310_09212
Length=1113

 Score = 709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/1167 (36%), Positives = 637/1167 (55%), Gaps = 107/1167 (9%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
             MEK+ Q YH EDVGR+LL+ Q++LR+MRE               K H +   N +V   H
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMRE---------------KVHEN--NNLDVNQIH  43

Query  76    ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAA--------PSPIKH  127
             A+L++ E++LRAKAE+VLNG++N+S  +          LPA+             S +  
Sbjct  44    AILERAEADLRAKAEIVLNGVVNNSMKM----------LPAIDAPGGQRYLSKFSSKLAQ  93

Query  128   RRG-----------DSRADEFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWR  176
             +R            +  +  +GH      +  S+    +    +R   R+     P    
Sbjct  94    KRDLAATMARENTYEPGSPTYGHDTSYREHP-SLSGPIEPMERDRTPGRR-----PVGRI  147

Query  177   RKSGARRVRKKTTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTP  236
              K+G+    K T    R+LP +N+ DP+ P P L ++DA  G+ NL+TRGFLP   D+TP
Sbjct  148   VKAGSLVKHKTTKPR-RILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLPPSVDVTP  206

Query  237   AFAGPNGKSNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSS  296
             AF          G   +++    IYDR+ +  +  P     GFN+A LKFD  T + P+ 
Sbjct  207   AFT--------HGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVTPTPPTV  258

Query  297   APKP-NHSATVSASMPNTKFSSIMQTVSSGPAKRNSLV---VAAPRNQNEDIENNCTHSF  352
             A  P N    +  S   T   + +     G A  N+ V      P+  N+    +C  + 
Sbjct  259   ANVPINQGGDIPPS--KTSIPTPIDITFDGHA--NNAVPFRPEQPKGGNDPSGKDCASA-  313

Query  353   edqedeegsddsdiikdegFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPE  412
                       D     ++  S  +L  NV KIR YN+L+D YSLHQ +I KG+ + DTPE
Sbjct  314   ----------DDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPE  363

Query  413   FTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSC  472
             F SF+R   DLWGSV + ++ LEA+L  Y VPLA+VDGQ+L+ +A+ +       ELLSC
Sbjct  364   FISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSC  423

Query  473   IVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSA  532
             I+N ++V S++RRPGQR+ G+     AA  +Q+  RM++   R +K+   N +A  IQ  
Sbjct  424   ILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKR-LKNHHGNEDAAVIQRI  482

Query  533   FRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRL  592
             +R+Y   + L+ RL+ +R      W+A+M  F++ W  I  +RR+VVHVPS S  E +RL
Sbjct  483   YRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRL  542

Query  593   NAENFAVQQNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRV  652
               ENF++QQNLQ+ R+C  A+      ++Y+SP+EL+ D+ +Y  +LLQL G AD + R+
Sbjct  543   KMENFSIQQNLQMARMC--AIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRI  600

Query  653   KFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDL  712
             + ++PE   RFP HFSL++++LYSP+CL++I+ +  G +AY+V G  GPED+RLAI L L
Sbjct  601   RMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQL  660

Query  713   PILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKW  772
             P+LG  P +AL   TRSGGKR+ + AD+N+P G +++YDE E+  +L+KL  A IDQ++W
Sbjct  661   PLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEW  720

Query  773   LIKLDYDPLGVGEAVVDLSSMQAMRELHREKR-----TPEYWRQPGTRDAAANLFLTEFE  827
             LIK+D D    G A +++  MQ++ +   EKR       EY++QP  RDA      +E  
Sbjct  721   LIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELN  780

Query  828   RPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDP  887
                  A   TP   E+Y +W          G VIEA P           +++R NIF++P
Sbjct  781   E-SYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVL-------SHVRTNIFIEP  832

Query  888   NGTVHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVS  947
             +G VH+TS  +V            +   FPQ+  P+ AI+GA  A+   +    + GY S
Sbjct  833   SGGVHITSAHDVFMCPVN--KHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYAS  890

Query  948   LDFVVFQDIKSNAA----VRLWALAIHPFLTNSAATFACFHLLTRGCLDANSG---IYRV  1000
             +D++ F D K+  +     RLWA+ + P LTN+A +F  F  L+    +  +G   +   
Sbjct  891   IDYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVA  950

Query  1001  PG-TKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYT  1059
             P     L TA         +   +L   +S   A   G  R Y+V  Y++HPN+   Q+ 
Sbjct  951   PAPVATLSTANAPITPTQQEIATILSPPSSAAAASVCGPERTYMVLDYIYHPNMATLQFA  1010

Query  1060  TFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGRE  1119
             TFF  CRLHGV FD+ RA+G  ++LADSLTAGV G++ IGE+ ++A    R A+E+IG +
Sbjct  1011  TFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQ  1070

Query  1120  AGATKGIVSSSSRSVLGNFADVLSTVR  1146
              G  + + +S S   LGNF  +L+ VR
Sbjct  1071  VG-VQALPNSLSGERLGNFPHLLAIVR  1096

>SPRG_06354
Length=884

 Score = 651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/900 (39%), Positives = 518/900 (58%), Gaps = 58/900 (6%)

Query  260   IYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSATVSASMPNT--KFSS  317
             +YDRS++  +  P + S GFN+A LK D         AP P     V  + P    K  S
Sbjct  8     LYDRSEQPVKSQPYMNSSGFNVASLKLDL--------APPPTEPDAVPPTRPAVARKRKS  59

Query  318   IMQTVS-SGPAKRNSLVVAAPRNQNEDIENNCTHSFedqedeegsddsdiikdegFSTKD  376
              + TV  S P  ++ LV A P      +E+  T     +  +              +  +
Sbjct  60    TVATVQLSFPGAKDELVDAVP------VEDPATDDGPIEPTD--------------TIDE  99

Query  377   LAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEA  436
             L  NV KIR YNDL+D YSLHQ +I KG+ + +TPEF SF+R+  DLWGSV   +R LE 
Sbjct  100   LRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELET  159

Query  437   ILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRK  496
             +L  Y VPLA++DGQ+L+ +A+ +    S+ ELL+C++N ++V + + RPGQR+ G D +
Sbjct  160   LLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGR  219

Query  497   HRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAK  556
             H AA  IQ+  RM     R ++    +  A  IQ  +R Y     ++ +LR  R   A  
Sbjct  220   HAAAIVIQSVYRMHRTR-RLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADART  278

Query  557   WEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICaaaldlq  616
             WE +M  F + W +I  +RR+VVHVPS S  E +RLN +NFA++QNLQ+ R+CA A    
Sbjct  279   WETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNV  338

Query  617   vdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYS  676
               +  Y+SP+EL+ D+ +Y  +LLQL G AD   RV+ ++PE A RFP HFSL++++LYS
Sbjct  339   DVI--YISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYS  396

Query  677   PYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLI  736
             P+CL++I+ Y  G EAY+V G  GPED+RLAI L LP+LG  P +AL   TRSG KRL  
Sbjct  397   PHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFT  456

Query  737   QADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAM  796
             QAD+N+P G +++YDE E+ ++LAKL  A++ Q  WLIKLD DP   G A +D+ +++ +
Sbjct  457   QADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECV  516

Query  797   RELHREKR---TPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREYAAA  853
              ++  EKR     EY+ QP  ++      + E     +  RL +P   ++YPTW+     
Sbjct  517   NKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHMRPV  574

Query  854   IGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEI  913
             +   G VIEA PP   A        +RAN+F++P+G VH+TS Q  L   +     +S  
Sbjct  575   VNRIGAVIEAYPPKVLA-------RVRANVFIEPSGGVHVTSAQEQLMHVKN--KHQSVG  625

Query  914   FAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAA------VRLWAL  967
               +P T  P+AAI+GA  AV + +  + + GY S+D+V F D+K+         +RLWAL
Sbjct  626   AVYPPTAVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWAL  685

Query  968   AIHPFLTNSAATFACFHLLTRGCLDANSGIYRVP-GTKKLQTACTAEQSGNHDAMDLLLR  1026
              + P LT +A +F  F  L+   LDA +G   +P    +  +      +    A++ +L 
Sbjct  686   QLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPLPAPRPSSLAGPPATETQLAVEKILG  745

Query  1027  EASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLAD  1086
             E+S   A   GA R Y+   Y+FHPN+   QY  FF  CR+HGV FD+ +++G  F+LAD
Sbjct  746   ESS--PAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLAD  803

Query  1087  SLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSVLGNFADVLSTVR  1146
             SLTAGV G+L IGE+ ++A+   R ALE+IG + G      + +    LGNFA VL  +R
Sbjct  804   SLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGER-LGNFAAVLGAIR  862

>CCA18898
Length=1147

 Score = 568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/1160 (33%), Positives = 609/1160 (53%), Gaps = 100/1160 (9%)

Query  15    GMEKVQQHYHVEDVGRLLLETQEQLRAMREQMTA---AAASMEANKSPKR--HSSVIT--  67
             GME+V+Q YH EDVGR+LL+TQ++LR +R +++A   A  S   +  P R  H+S+    
Sbjct  25    GMEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANEN  84

Query  68    -NAEVQAFHALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIK  126
              + +++  H +L + E E++AK +L+  G         N      T LPAV+  +P    
Sbjct  85    QSKDLETLHDILDRAEREIQAKVDLMFRG-------AANFGQMMQTGLPAVT--SPPRQV  135

Query  127   HRRGDSRADEF--GHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGARRV  184
                  S +D+      +++D     +   +  ++ +   ++QS + SP   +R +     
Sbjct  136   STTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCS-PSMQQSELISP---KRPTQGLLT  191

Query  185   RKKTTQHYRL----LPCVNKADPSEPTPDLREEDA-TCGLLNLVTRGFLPAYADLTPAFA  239
              K + + Y +    LP V     S  +  L ++ + T   LN  +R   P  +       
Sbjct  192   SKASKKRYNVSLKSLPAVQNGHASTSSSALADQSSETAHFLN--SRHGSPLNSIEI----  245

Query  240   GPNGKSNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPK  299
                  S  +   AL  R   +++R +   R TP   +I  ++  LKFDF   S P+    
Sbjct  246   -----SQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDF---SAPTILQS  297

Query  300   PNHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVA---APRNQNEDIENNCTHSFedqe  356
             P     V      T F+       +     N + +A     R  N  +  +  HS     
Sbjct  298   P---GKVQIHEQVTHFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHS-----  349

Query  357   deegsddsdiikdegFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSF  416
                      +   +   +  +  +    +  N     +++HQ ++ + R+     +F SF
Sbjct  350   -------KKMGIPKVIKSTKINTDTESHKGNNSSNHDFTIHQGIVDRRRS-----DFKSF  397

Query  417   RRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNK  476
             +   +D+W +VEEV+  LE +L  YF+P+AH++GQR++ L+  N    + R+LLSC+ N+
Sbjct  398   QCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNE  457

Query  477   EQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAY  536
              +V  +L +PGQR+ G ++  RAA  +Q+  RM      Y+   S++     IQ  +R Y
Sbjct  458   HEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRY  517

Query  537   SRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAEN  596
             +   A K ++  IR  +   +   M  F S W +I  +RR V+H+PS+S+    R+  E 
Sbjct  518   AAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQ  577

Query  597   FAVQQNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVY  656
             F++QQNLQL R+C  AL  +   L+Y+ P+ELT D+ QY+ KLLQL+G +D+  R+K + 
Sbjct  578   FSIQQNLQLQRLC--ALIDENVELIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMC  635

Query  657   PEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILG  716
             PE A+RFP+HFSLS+++L SP+ ++R+  Y  G  AYLV G PG ED+RLA  L +PILG
Sbjct  636   PENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILG  695

Query  717   ALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKL  776
               P++   + T SG KR   + + N   G+ +LYDE+E+  +LAKL  A+  QS  ++KL
Sbjct  696   LDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKL  755

Query  777   DYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLT  836
             DYDP   G A+VD+S +Q+++ L    RT +YWRQP  ++      + E +    ++ L 
Sbjct  756   DYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNKLIRNIVQEMQ--SIISSLV  813

Query  837   TPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTST  896
               ++ E+YP+W+ +  AI  +G VIE  P            Y+RAN+F++P+  V ++ST
Sbjct  814   FMVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQG-------YVRANLFIEPSRRVCISST  866

Query  897   QNVLT--TTRGGLSRKSEI--------------FAFPQTVAPHAAIKGACNAVGKQLAET  940
             Q  L+         R  ++              F FPQT+  H  +K A   +G+ LA+ 
Sbjct  867   QEFLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKD  926

Query  941   NVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTR-GCLDANSGIYR  999
              + GY+S+DF+V  D ++   + L+A+A+ PFLTNSAA+F+ F  L+R G  ++ +G++ 
Sbjct  927   GICGYISVDFLVILDDQTQNKI-LYAMALQPFLTNSAASFSLFQFLSRGGGYNSKTGLFH  985

Query  1000  VP-GTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQ----GATRCYVVCSYVFHPNVT  1054
             +P              S +  A DL++REA L+  +        TR YV+  YV +PNV 
Sbjct  986   LPRAITSHGVTSDTPSSSSLSATDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVA  1045

Query  1055  ATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALE  1114
                Y +FFQNCR  GV FD+ R +GT+FLLADSLTAGV GI+ I +T ++AL   R A+E
Sbjct  1046  TLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAME  1105

Query  1115  VIGREAGATKGIVSSSSRSV  1134
              I   AG TK  +S S+ S+
Sbjct  1106  AIAASAG-TKSSISKSNHSM  1124

>CCI45122
Length=1105

 Score = 540 bits (1391),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 363/1158 (31%), Positives = 582/1158 (50%), Gaps = 121/1158 (10%)

Query  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASME---ANKSPKRH-----SSVIT  67
             M+ ++Q +H ED+GR+LL+TQ++LR +R +++    + E   A+ +P         SV  
Sbjct  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  68    NAEVQAFHALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKH  127
             + +++    +L + E E++AK +L+  G+        +   +  T LP V+ + P  I  
Sbjct  61    SKDLETLQNILDRAEREIQAKVDLLYKGV-------AHYGRKTQTGLPFVA-SPPRQIPS  112

Query  128   RRGDS--RADEFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGARRVR  185
                 S  R   F  +        S++  R+Q  +    +++     P             
Sbjct  113   SANSSLERKSSFQEL--------SVDLIRKQLHS----VKEKYKCLP-------------  147

Query  186   KKTTQHYRLLPCVNKADPSEPT-------PDLREEDATCGLLNLVTRGFLPAYADLTPAF  238
               T QH  L+       P  PT       P  +  +A+   L  V RG    ++  +   
Sbjct  148   --TKQHSELI------SPKRPTQGLLTSKPSKKRYNASLRSLPTVQRGEAGDFSSASRDQ  199

Query  239   AGPNGKSNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAP  298
              G    +       L  R  ++++R +   + TP   +I  N+  +KFDF T ++ S   
Sbjct  200   IGEASNTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPTSQSPCG  259

Query  299   KPNHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFedqede  358
             K      +  +      + +     +G    N + ++      ED        F    D 
Sbjct  260   KMQTQEKIVLT------NDLQSKQRNGALLANQISLSPGGGCRED-----DSRFSPGRDP  308

Query  359   egsddsdiikdegF---STKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTS  415
                          F    TK L   ++K  ++            +I++G   R  PEF +
Sbjct  309   SKKIGIIKAITPIFLNDVTKSLVGEISKTYDF------------VIHQGIIDRKRPEFEA  356

Query  416   FRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVN  475
             F+R+ + +W SV+ VL AL  IL  YF+P+A+++GQR++ LA  +    + ++L+SCI N
Sbjct  357   FQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRN  416

Query  476   KEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRA  535
             +++V  +L +PGQR+ G +R  RA   +Q+  RM M   R++  R        IQ  +R 
Sbjct  417   EDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRR  476

Query  536   YSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAE  595
             +S   A K ++   R  +   +   M  F S W +I  +RR ++H+PS+S+    R+  E
Sbjct  477   FSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTE  536

Query  596   NFAVQQNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFV  655
              F++QQNLQL R+CA   +    +  Y+ P+ELT D+ QY+ KLLQL G +D+  R+K +
Sbjct  537   QFSIQQNLQLQRLCAVIDENVELI--YICPFELTDDIVQYYMKLLQLGGISDAAARIKLI  594

Query  656   YPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPIL  715
              PE A+RFP+HFSLSS++LYSP  L R+     G  AY+V G PG ED+R+A  L +PIL
Sbjct  595   CPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPIL  654

Query  716   GALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIK  775
             G   +++L   T SG KR   +A++N      +LYDE+E+  +LAKL  +H  Q   +++
Sbjct  655   GLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLR  714

Query  776   LDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTR-DAAANLFLTEFERPGKLAR  834
             LDYDP G G A++D+S +Q+++E+    +T E W QP  +     NL L   E    ++ 
Sbjct  715   LDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVL---EMQNNISS  771

Query  835   LTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMT  894
                 +H E++P+ + +  AI  +G +IE  P            ++RAN+F++P+  V ++
Sbjct  772   FIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQG-------HVRANLFIEPSRRVCVS  824

Query  895   STQNV--LTTT--------RGGLSRKSEI------FAFPQTVAPHAAIKGACNAVGKQLA  938
             ST  +  L T         + GL + S          FPQT+  H  +K A  A+G+ LA
Sbjct  825   STHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALA  884

Query  939   ETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTR-GCLDANSGI  997
             +  + GY+S+DFVV  D ++     L+A  + PFLTN+AA+FA F LL+R G  ++ +G 
Sbjct  885   KDGICGYISVDFVVCLDDQTQKKT-LYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGS  943

Query  998   YRVPGTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQ----GATRCYVVCSYVFHPNV  1053
               +P    L      +   +  A DL++REA L+  +        TR Y +  YV +P V
Sbjct  944   LHLPQEVPL-VGVQNDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCV  1002

Query  1054  TATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTAL  1113
                  ++FFQ+CR  GV FD  R  GT+FLLADSLTAGVFGI+ I +T ++ALS  R A+
Sbjct  1003  ATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAM  1062

Query  1114  EVIGREAGATKGIVSSSS  1131
             E I   AG TK  VS SS
Sbjct  1063  EAIAGVAG-TKMSVSKSS  1079

>PHYKE_8394
Length=428

 Score = 320 bits (820),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 179/222 (81%), Gaps = 23/222 (10%)

Query  595  ENFAVQQNLQLTRICaaaldlqvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKF  654
            ENFAVQQNLQLTRICAAALD  VDLLVYVSP+ELTADVSQYF KLLQL G ADSRPRVK 
Sbjct  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237

Query  655  VYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPI  714
            V+PEQA RFP                        G +AYLVMGLPG EDQRLAI LDLPI
Sbjct  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDLPI  274

Query  715  LGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLI  774
            LGA P+QALPLLTRSGGKRLLI+AD+NVPTGTYELYD+HE+  ALAKLAV H+DQ +WL+
Sbjct  275  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334

Query  775  KLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRD  816
            KLDYDPLGVGEA++DLS MQAMREL REKR PEYWRQPG RD
Sbjct  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 101/148 (68%), Gaps = 14/148 (9%)

Query  16   MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75
            MEK+QQ +HVEDVGRLLL+TQEQLR MREQMTAAA ++EAN SP RHS+V          
Sbjct  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTV----------  50

Query  76   ALLQQTESELRAKAELVLNGIInssnsvhnsqvqrnTRLPAVSVAAPSPIKHRRGDSRAD  135
                +TE ELRAKAELVLNG++NSS++  ++Q Q  T LPAV+V AP  I+ R G     
Sbjct  51   ----KTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVG  106

Query  136  EFGHINRIDNNSTSMEFFRQQFRNNRVE  163
            +     R D  S  MEFFR++FRN+ VE
Sbjct  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 1/37 (3%)

Query  891  VHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIK  927
            VH+TSTQNVL +   GL+RK+  + FPQT APH A+K
Sbjct  390  VHVTSTQNVLASG-SGLNRKTVAYTFPQTAAPHEAVK  425

>PYAR_13581
Length=730

 Score = 265 bits (678),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 204/303 (67%), Gaps = 28/303 (9%)

Query  376  DLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALE  435
            DL  NV KIR YN+L+D YSLHQ +I+KGRA+R+TPEF SF+RV  ++WG+V+EV+RALE
Sbjct  83   DLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALE  142

Query  436  AILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDR  495
            A+L +YF             +AS     F    LLSC+VN++QV S+LRRPGQRY G+DR
Sbjct  143  ALLTRYF-------------MAS-----FPTSVLLSCVVNEDQVASLLRRPGQRYKGKDR  184

Query  496  KHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAA  555
            K RAATT+QA  RM    +R+ +      +A +IQ+ +R ++   +L+  L   R E+  
Sbjct  185  KRRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQLR  244

Query  556  KWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICaaaldl  615
             W+ +M   +SQW +I+ +RR+VVHVPS+SL EH+R++ ++FAVQQNLQL R+  A +D 
Sbjct  245  VWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLA-AVVDA  303

Query  616  qvdllvYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILY  675
             V+ +VYVSP+EL  D+S          G A++  RVK V PE AA FP HFSL++ +LY
Sbjct  304  TVEYVVYVSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLY  354

Query  676  SPY  678
            SP+
Sbjct  355  SPH  357

 Score = 165 bits (418),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 120/377 (32%), Positives = 160/377 (42%), Gaps = 101/377 (27%)

Query  786   AVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYP  845
             A++D+S++  +RE+ R  + P YW+QPG RD  A   L E ER   +  L  P H+E +P
Sbjct  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446

Query  846   TWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVH-----MTSTQNVL  900
              WR +A AIG  G VIEA+P             +R NIFV P  + H     + STQ  L
Sbjct  447   DWRAFAQAIGRDGVVIEALPARVRGV-------VRVNIFVTPASSDHDADVPVVSTQEAL  499

Query  901   TTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVW-GYVSLDFVVFQDIKSN  959
                R    R    FA PQT+ PH A+ GA  A+G+ L E   + GY S+D  +       
Sbjct  500   ---RASAGRAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQL-------  549

Query  960   AAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHD  1019
                                           C D  SG+Y +P      +A  +       
Sbjct  550   ------------------------------CRDETSGLYLLPSPAVDTSAPLSP------  573

Query  1020  AMDLLLREASLTK------AIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFD  1073
             A  L+L+EA L        A    + RC+V   +  HPN+       FF  CR  GVCFD
Sbjct  574   ATPLVLQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFD  633

Query  1074  VSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRS  1133
             V+R                            A+ YLRTA EV+ RE G       SS+ S
Sbjct  634   VTR---------------------------RAMQYLRTAFEVLAREVG-------SSTPS  659

Query  1134  VLGNFADVLSTVRASTG  1150
               GNF DVL+ +R   G
Sbjct  660   SDGNFGDVLALLRHRVG  676

>PHYSO_304260
Length=202

 Score = 39.7 bits (91),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (45%), Gaps = 3/85 (4%)

Query  988   RGCLDANSGIYRVPGTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSY  1047
             +G + A +G+ R   T K + A   E   N D + L L+ AS+ KA+      C +  S+
Sbjct  61    QGNVPAATGVEREHATHKQEVAAAHELDANFDRISLFLKRASIAKAV-SWIVHCMLCTSF  119

Query  1048  VFHPNVTATQYTTFFQNCRLHGVCF  1072
              F   V A  +T  F       +CF
Sbjct  120   TF--AVDAVDFTFAFDAVDFFELCF  142

>H257_06641
Length=552

 Score = 40.4 bits (93),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 9/66 (14%)

Query  493  RDRKHRAATTIQACARMWMVHHRYVKSRSSNIN------AIKIQSAFRAYS---RCTALK  543
            RDR H AAT IQAC + ++    ++   S +I+       I +Q+A+R YS   R  A+ 
Sbjct  182  RDRLHHAATVIQACVKRFLARVAFIHLTSRHIDELVLWSVIVVQAAYRGYSVRKRVAAML  241

Query  544  ARLREI  549
             +LRE+
Sbjct  242  TQLREV  247

>SDRG_02078
Length=507

 Score = 34.7 bits (78),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 6/50 (12%)

Query  493  RDRKHRAATTIQACARMWM--VHHRYVKSRSSN----INAIKIQSAFRAY  536
            RDR   AATTIQAC + ++  V + ++ SR  +    ++AI IQ+AFR Y
Sbjct  193  RDRLASAATTIQACVKRFLARVGYGHLVSRRLDEIVLVSAIVIQAAFRGY  242

>SDRG_01714
Length=1233

 Score = 34.7 bits (78),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 54/121 (45%), Gaps = 19/121 (16%)

Query  493  RDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRA--------------YSR  538
            R  K  AA  +Q+  R+W+   R++ +++   +  ++ + F                YS 
Sbjct  508  RIEKEAAALMLQSNVRLWLARRRFLAAKAKEASHRRLVALFLGQRSAQRRRNTFLAWYSM  567

Query  539  CTALKARLREIRCEKAAKWEAR--MYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAEN  596
             T ++A  R       + W  R  ++EF+     +A RRR++ HV ++ LG H+    + 
Sbjct  568  HTHVRALKRASASRLQSWWRGRRALWEFRLA---MAHRRRVLNHVEALVLGRHAHWRLQC  624

Query  597  F  597
            F
Sbjct  625  F  625

>H257_01880
Length=346

 Score = 33.9 bits (76),  Expect = 5.4, Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 22/30 (73%), Gaps = 0/30 (0%)

Query  290  TSSTPSSAPKPNHSATVSASMPNTKFSSIM  319
            +SS PS+   P HS+ +S+S+PN+ F S++
Sbjct  50   SSSRPSTTQTPFHSSLMSSSLPNSPFPSVL  79

Lambda      K        H        a         alpha
   0.320    0.132    0.389    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 98689200966

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40