Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHALS_064761475872672634500.0
PPTG_171291475874575425480.0
PHYCA_5114151475874475125160.0
PITG_184581475874775025040.0
PHYRA_810981475874175024170.0
PHYSO_3489031475876676923370.0
PHYKE_839514758142076122220.0
HYAP_071041475872174521200.0
PYU1_G0017331475873269314650.0
PYIR_134181475874776914570.0
PYIW_199691475873375814420.0
PYAP_177631475879451413475e-175
PYAR_135711475866647412287e-159
PYVX_23590147586895059713e-120
CCI44111147585764919187e-114
CCA22843147585865078901e-109
SPRG_06355147587135736493e-73
SDRG_01763147587363845372e-57
H310_082921382110073621759e-12
SDRG_045751382110031891704e-11
SPRG_126211382110031701686e-11
H257_117731382110263541661e-10
SPRG_1903013355510001701589e-10
SDRG_079831335559911701581e-09
PHYSO_4705331382110843571571e-09
PYVX_215131382114462091571e-09
H257_0193413355510221791472e-08
PITG_172501382110461871401e-07
PPTG_113651382111061931283e-06
PYAR_14788138217951461258e-06
PYU1_G002110138219993411231e-05
PYIR_141071382111761461222e-05
PYAP_222301382111163691212e-05
PYIW_157171382111211471177e-05
PHYSO_5453781252822443820.50
PYVX_217761252820340810.56
PYU1_G0122671252821740800.69
PYIR_233601252822740800.84
PITG_155251252822443791.0
PHALS_000541252822443791.0
PHYCA_5718411252824143791.3
PPTG_070251252822443781.3
PHYRA_828581252822443781.6
CCI101751252822240771.9
PYAR_202771252821640745.0
H310_003911465828465737.0
PYIW_172481252825241729.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHALS_06476

Length=726
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHALS_06476                                                           1333       0.0   
PPTG_17129                                                            986        0.0   
PHYCA_511415                                                          973        0.0   
PITG_18458                                                            969        0.0   
PHYRA_81098                                                           935        0.0   
PHYSO_348903                                                          904        0.0   
PHYKE_8395                                                            860        0.0   
HYAP_07104                                                            821        0.0   
PYU1_G001733                                                          568        0.0   
PYIR_13418                                                            565        0.0   
PYIW_19969                                                            560        0.0   
PYAP_17763                                                            523        5e-175
PYAR_13571                                                            477        7e-159
PYVX_23590                                                            378        3e-120
CCI44111                                                              358        7e-114
CCA22843                                                              347        1e-109
SPRG_06355                                                            254        3e-73 
SDRG_01763                                                            211        2e-57 
H310_08292                                                            72.0       9e-12 
SDRG_04575                                                            70.1       4e-11 
SPRG_12621                                                            69.3       6e-11 
H257_11773                                                            68.6       1e-10 
SPRG_19030                                                            65.5       9e-10 
SDRG_07983                                                            65.5       1e-09 
PHYSO_470533                                                          65.1       1e-09 
PYVX_21513                                                            65.1       1e-09 
H257_01934                                                            61.2       2e-08 
PITG_17250                                                            58.5       1e-07 
PPTG_11365                                                            53.9       3e-06 
PYAR_14788                                                            52.8       8e-06 
PYU1_G002110                                                          52.0       1e-05 
PYIR_14107                                                            51.6       2e-05 
PYAP_22230                                                            51.2       2e-05 
PYIW_15717                                                            49.7       7e-05 
PHYSO_545378                                                          36.2       0.50  
PYVX_21776                                                            35.8       0.56  
PYU1_G012267                                                          35.4       0.69  
PYIR_23360                                                            35.4       0.84  
PITG_15525                                                            35.0       1.0   
PHALS_00054                                                           35.0       1.0   
PHYCA_571841                                                          35.0       1.3   
PPTG_07025                                                            34.7       1.3   
PHYRA_82858                                                           34.7       1.6   
CCI10175                                                              34.3       1.9   
PYAR_20277                                                            33.1       5.0   
H310_00391                                                            32.7       7.0   
PYIW_17248                                                            32.3       9.6   

>PHALS_06476
Length=726

 Score = 1333 bits (3450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/726 (100%), Positives = 726/726 (100%), Gaps = 0/726 (0%)

Query  1    MVGTMHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVE  60
            MVGTMHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVE
Sbjct  1    MVGTMHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVE  60

Query  61   EMFYNRSTATSGIPQYRTTEQIRGNNLALYALHEDFEtqstasdasssfsqfsattpssy  120
            EMFYNRSTATSGIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTPSSY
Sbjct  61   EMFYNRSTATSGIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTPSSY  120

Query  121  aastpGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELH  180
            AASTPGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELH
Sbjct  121  AASTPGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELH  180

Query  181  VTRYDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplssDERAALTRQTPTKTS  240
            VTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSSDERAALTRQTPTKTS
Sbjct  181  VTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSSDERAALTRQTPTKTS  240

Query  241  QATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSE  300
            QATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSE
Sbjct  241  QATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSE  300

Query  301  LAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGN  360
            LAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGN
Sbjct  301  LAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGN  360

Query  361  LLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKV  420
            LLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKV
Sbjct  361  LLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKV  420

Query  421  LIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSS  480
            LIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSS
Sbjct  421  LIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSS  480

Query  481  KLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLE  540
            KLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLE
Sbjct  481  KLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLE  540

Query  541  FTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQ  600
            FTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQ
Sbjct  541  FTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQ  600

Query  601  LIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKHEEQFYFSIEDALLALR  660
            LIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKHEEQFYFSIEDALLALR
Sbjct  601  LIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKHEEQFYFSIEDALLALR  660

Query  661  KMRLNsssdsssgdpgissdKNAPDHNRRLSRANSRGKLPNKSQRHEPRTNFENYKPVGI  720
            KMRLNSSSDSSSGDPGISSDKNAPDHNRRLSRANSRGKLPNKSQRHEPRTNFENYKPVGI
Sbjct  661  KMRLNSSSDSSSGDPGISSDKNAPDHNRRLSRANSRGKLPNKSQRHEPRTNFENYKPVGI  720

Query  721  LKRGKL  726
            LKRGKL
Sbjct  721  LKRGKL  726

>PPTG_17129
Length=745

 Score = 986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/754 (69%), Positives = 592/754 (79%), Gaps = 37/754 (5%)

Query  1    MVGTMHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDE-TVRVDRSATLTDTVNMTDDV  59
            MVGTM+++KNKLR S L KKE A+ L++DSLR K TQD+  VR DRS TL DTVN+TDDV
Sbjct  1    MVGTMNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDV  60

Query  60   EEMFYNRSTA--TSGIPQYRTTEQIRGNNLALYALHEDFEtqstasdasssfsqfsattp  117
            EEMFY RST+  +S +PQYRTTEQIR NN+ L ALHED E  + ++ +SS     + T  
Sbjct  61   EEMFYGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPS  120

Query  118  ssyaastpGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMN  177
            +  A++  GN +  +H F+T+++TT T  A+SGDF+LERL SEVL++K EVK IRREVMN
Sbjct  121  NYAASTP-GNFSSTYHGFNTVHSTTGTSRAVSGDFELERLRSEVLEVKEEVKAIRREVMN  179

Query  178  ELHVTRYDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplssDERAALTRQTPT  237
            ELHVTRYDVLKEL LLKGAIAQL +T+     S  S+  SSS    + +ERAALTRQT T
Sbjct  180  ELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSDPLSA-EERAALTRQTST  238

Query  238  KTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDF  297
            KTSQATRDRLAA R N +K PP A RAS RLTQLAPVAD+ALSTPL+ QQINE FPLIDF
Sbjct  239  KTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDF  298

Query  298  TSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            TSELAAHAR LTPG+R+WALTR++EWLDARF++GNDTLLAVVGEGG+GKSAFCGTVAQQF
Sbjct  299  TSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQF  358

Query  358  RGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLA  417
            RGNLLAAHCCQFDRKSKS PRNVLLSMVHQLVDNLP FKNQLARLNL+YVLEE DPFLLA
Sbjct  359  RGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLA  418

Query  418  NKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSK  477
             KVL+DPLNA+EEP H+TF+L+DGIDQCA G NGRNELLEF +Q+I  LPSWVGFL+SSK
Sbjct  419  GKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSK  478

Query  478  PSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFA  537
            PSSKLAK LPVSSVLDFSAKNGAFVAD SS+V+DI++ FSDDD  EAK++L KKSGGNFA
Sbjct  479  PSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFA  538

Query  538  YLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKP  597
            YLEFTKQALSHPGMA  S  G VPL VL ELPETLYDIYAEIFEDKFGQG AR WGKAKP
Sbjct  539  YLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKP  598

Query  598  LLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH-------------  644
            LLQLIVGAAAGPYS +TEEQAK+     A+DLRMLRRSFVD+VAVKH             
Sbjct  599  LLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAW  658

Query  645  -------EEQFYFSIEDALLALRKMRLNsssdsssgdpgissdKNAPDHNRRLSRANSRG  697
                   EEQFYFSI+DAL ALRKMR        S     S    +    +   RA+SR 
Sbjct  659  LSDPARSEEQFYFSIDDALQALRKMR------RVSSSGSSSGHSGSSSDGKATHRASSRV  712

Query  698  KLPNKSQ-----RHEPRTNFENYKPVGILKRGKL  726
            K  +K+      RHEPR N  ++KPVGILKR KL
Sbjct  713  KTSSKTHQRAHTRHEPRAN-PDFKPVGILKRNKL  745

>PHYCA_511415
Length=744

 Score = 973 bits (2516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/751 (70%), Positives = 586/751 (78%), Gaps = 36/751 (5%)

Query  5    MHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVEEMFY  64
            MH+LKNKLR S L KKE A+ L++DSLR K  QD+ VR DRS TL DTVN+TDDVEEMFY
Sbjct  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFY  60

Query  65   ----NRSTATSGIPQYRTTEQIRGNNLALYALHEDFEtqstasdasssfsqfsattpssy  120
                NRST  S +PQYRTTEQIRGNNL L ALHE+  T S ++ +SS     + T  +  
Sbjct  61   GRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQFSATTPSNYA  120

Query  121  aastpGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELH  180
            A++        +H FS+  NT  T   IS DF+LERL SEVL++K EVK IRREVMNELH
Sbjct  121  ASTPGNVGNNTYHGFSSALNTAGTSRVISEDFELERLRSEVLEVKEEVKAIRREVMNELH  180

Query  181  VTRYDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplssDERAALTRQTPTKTS  240
            VTRYDVLKELTLLKGAIAQL + +  + S S + + SS       +ERAALTRQT TKTS
Sbjct  181  VTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDPLSA--EERAALTRQTSTKTS  238

Query  241  QATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSE  300
             ATRDRLAA R+N +K PP A RAS RLTQLAPVAD+ALSTPL+SQQINE FPLIDFTS+
Sbjct  239  AATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSD  298

Query  301  LAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGN  360
            LAAHAR LTPGSR+WALTR++EWLDARF++G DTLLAVVGEGG+GKSAF GTVAQQFRGN
Sbjct  299  LAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGN  358

Query  361  LLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKV  420
            LLAAHCCQFDRKSKS PRNVLLSMVHQLVDNLPLFKNQLARLNL+YVLEE DP LLA KV
Sbjct  359  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKV  418

Query  421  LIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSS  480
            L+DPLNA+EEP H+TF+L+DGIDQC+ G NGRNELL+F +Q+I  LPSW+GFL+SSKPSS
Sbjct  419  LVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSS  478

Query  481  KLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLE  540
            KLAK LPVSSVLDFSAKNGAFVAD SSLV+DI++ FSDDDA EAK++L  KSGGNFAYLE
Sbjct  479  KLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLE  538

Query  541  FTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQ  600
            FTKQALSHPGM  TS  G VPL VL ELPETLYDIYAEIFEDKFGQG AR WGKAKPLLQ
Sbjct  539  FTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  598

Query  601  LIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH----------------  644
            L+VGAA+GPYS VTEEQAK+   L A+DLRMLRRSFVD+VAVKH                
Sbjct  599  LVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSD  658

Query  645  ----EEQFYFSIEDALLALRKMRLNsssdsssgdpgissdKNAPDHNRRLSRANSRGKLP  700
                EEQFYFSI+DAL ALRKMR N  S S     G SSD +A  H    SRA+SR    
Sbjct  659  PARSEEQFYFSIDDALHALRKMRRN-VSSSGHSHSGSSSDSSATHHTS--SRASSRVTAS  715

Query  701  NKSQ-----RHEPRTNFENYKPVGILKRGKL  726
            +KSQ     RHEPRTN    KPVGILKRGKL
Sbjct  716  SKSQQRSHTRHEPRTN--PGKPVGILKRGKL  744

>PITG_18458
Length=747

 Score = 969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/750 (69%), Positives = 592/750 (79%), Gaps = 31/750 (4%)

Query  5    MHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDE-TVRVDRSATLTDTVNMTDDVEEMF  63
            M+++KNKLR S L KKE A+ L++DSLR K TQD+  VR DRS TL DTVN+TDDVEEMF
Sbjct  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60

Query  64   YNRSTA--TSGIPQYRTTEQIRGNNLALYALHEDFEtqstasdasssfsqfsattpssya  121
            Y RST+  +S +PQYRTTEQ+RGNN+ L ALHED E  + ++ +SS     + T  +  A
Sbjct  61   YGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFSATTPSNYAA  120

Query  122  astpGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELHV  181
            ++  G     H   +T   TT    A+SGDF+LERL SEVL++K EVK IRREVMNELHV
Sbjct  121  STP-GKFTSTHQGLNTAQTTTGMSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHV  179

Query  182  TRYDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplssDERAALTRQTPTKTSQ  241
            TRYDVLKEL LLKGAIAQL +T+ +  +S  S+  SSS       ERAALTRQT TKTSQ
Sbjct  180  TRYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPD-ERAALTRQTSTKTSQ  238

Query  242  ATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSEL  301
            ATRDRLAA R N +K PP A RAS RLTQLAPVAD+ALSTPLN QQINE FPLID TSEL
Sbjct  239  ATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSEL  298

Query  302  AAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNL  361
            AAHAR LTPG+R+WALTR++EWLDAR+++GNDTLLAVVGEGG+GKS FCGTVAQQFRGNL
Sbjct  299  AAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNL  358

Query  362  LAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKVL  421
            LAAHCCQFDRKSKS PRNVLLSMVHQLVD+LP FKNQLARLNL+YVLEE DPFLLA KVL
Sbjct  359  LAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVL  418

Query  422  IDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSK  481
            +DPLNA+EEP H+TFIL+DGIDQCA GSNGRNELLE  +Q+I  LPSWVGFLVSSKPSSK
Sbjct  419  VDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSK  478

Query  482  LAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEF  541
            LAK LPVSSVLDFSAKNGAFVADASSLV+DI++ FSDDDA EAK++L KKSGGNFAYLEF
Sbjct  479  LAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEF  538

Query  542  TKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQL  601
            TKQALSHPG+A  S  G VPL VL ELPETLYDIYAEIFEDKFGQG AR WGKAKPLLQL
Sbjct  539  TKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL  598

Query  602  IVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH-----------------  644
            +VGAAAGPYS VTEEQAK+  +L  +DLRMLRRSFVD+V+VKH                 
Sbjct  599  VVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDP  658

Query  645  ---EEQFYFSIEDALLALRKMRLNsssdsssgdpgissdKNAPDHNRRLSRANSRGKLPN  701
               EEQFYFS++DALLALRK+R   SS SSSG  G SSD  A  +    SR ++R K  +
Sbjct  659  ARSEEQFYFSVDDALLALRKIRRVGSSSSSSGHSGNSSDGKAAKNGHASSRPSNRVKTSS  718

Query  702  KSQ-----RHEPRTNFENYKPVGILKRGKL  726
            K+      R+EPRT+  +YKPVGILKR KL
Sbjct  719  KTHQRAHTRYEPRTS-PDYKPVGILKRNKL  747

>PHYRA_81098
Length=741

 Score = 935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/750 (69%), Positives = 594/750 (79%), Gaps = 33/750 (4%)

Query  1    MVGTMHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVE  60
            MVGTMH+LKNKLR   L KK++ + L++DSLR K TQD+ +R+DRS TLTDTVN+TDDVE
Sbjct  1    MVGTMHRLKNKLR---LHKKDANWALDEDSLRLKQTQDDALRLDRSTTLTDTVNVTDDVE  57

Query  61   EMFYNRSTATSGIPQYRTTEQIRGNNLALYALHEDFEtqstasdasssfsqfsattpssy  120
            EMFY   +  S +PQYRTTEQ+RG ++ L ALHED E  + +S  S   +   +   +S 
Sbjct  58   EMFYGGRSTVSDVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQFSATTPSNYAAST  117

Query  121  aastpGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELH  180
                P    G +HDFST ++TT    AIS  F+LERL SEV+++K EVK IRREVMNELH
Sbjct  118  PGHVPNQ--GAYHDFSTAHSTTR---AISDAFELERLRSEVVEVKEEVKAIRREVMNELH  172

Query  181  VTRYDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplssDERAALTRQTPTKTS  240
            VTRYDVLKEL LLKGAIAQLA+T+ L+ ++SVSST+SSSSDPLS+DERAALTRQT TKTS
Sbjct  173  VTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAALTRQTSTKTS  232

Query  241  QATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSE  300
             ATR+RLAA R N +K PP A RAS RLTQLAPVAD+ALSTPL  QQIN+ FPLIDFTSE
Sbjct  233  SATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSE  292

Query  301  LAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGN  360
            LAAHARSLTPGSR+WALTR++EWLDARF++G+DTLLAVVGEGG+GKSAF GTVAQQFRGN
Sbjct  293  LAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGN  352

Query  361  LLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKV  420
            LLAAHCCQFDRKSKS PRNVLLSMVHQLVD+LP FKNQLARLNL+YVLEE DPF+LA KV
Sbjct  353  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKV  412

Query  421  LIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSS  480
            L+DPLNA+EEP H+TF+L+DGIDQC+ G  GRNELLEF +Q+I LLPSWVGF+VSSKPSS
Sbjct  413  LVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSS  472

Query  481  KLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLE  540
            KLAK LPVSSVLDFSAKNGAFV+D SSLVED+++ FSD+DA EAK++L +KSGGNFAYLE
Sbjct  473  KLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLE  532

Query  541  FTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQ  600
            FTKQALSHPGMA  S  G VPLSVL ELPETLYDIYAEIFEDKFGQG AR WGKAKPLLQ
Sbjct  533  FTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  592

Query  601  LIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH----------------  644
            LIVGAAAGPYSLVTEEQAKK  +L A+DLRMLR SFVD+VAV+H                
Sbjct  593  LIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSD  652

Query  645  ----EEQFYFSIEDALLALRKMRLNsssdsssgdpgissdKNAPDHNRRLSRANSRGKLP  700
                EEQFYF+I+DA+ ALR MR + SS S S                  SRA+SR    
Sbjct  653  PARSEEQFYFAIDDAIQALRSMRRSVSSSSHSNSGSSDDSPPTSRRGHTSSRASSRVTTS  712

Query  701  NKSQ----RHEPRTNFENYKPVGILKRGKL  726
              +Q    RH+PR   E +KPVGILKR KL
Sbjct  713  KSNQRAHTRHDPRATQE-FKPVGILKRNKL  741

>PHYSO_348903
Length=766

 Score = 904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/769 (67%), Positives = 595/769 (77%), Gaps = 51/769 (7%)

Query  1    MVG-TMHKLKNKLRGSLL--LKKESAYELNDDSLRRKHTQDET-VRVDRSATLTDTVNMT  56
            MVG TMH++KNKLR S L   KK++A+ L++DSLR K  QD+  VR DRS TL+DTVN+T
Sbjct  1    MVGNTMHRIKNKLRSSRLGSSKKDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60

Query  57   DDVEEMFY---NRSTAT--SGIPQYRTTEQIRGNNLALYALHEDFEtqstasdasssfsq  111
            DDVE+MFY   NRSTA+  S +PQYRTTEQ+R  +L L ALHED ET S  ++ SSSFSQ
Sbjct  61   DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120

Query  112  fsattpssyaastpGNHAGIHHDFSTMYNTT------STLP-----AISGDFDLERLHSE  160
            FS TTPS+YAASTPGN +  +   +    +T      S +P     A++ + +LERL +E
Sbjct  121  FSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAE  180

Query  161  VLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLAstkslnssssvsstdssss  220
            VL++K EVK IRREVMNELHVTRYDVLKEL LLKGA+AQL +    +S  SVSSTDSSS 
Sbjct  181  VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQL-TAAQHSSPPSVSSTDSSSL  239

Query  221  dplssDERAALTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALS  280
            DPLS+D+RA L RQT TKTS ATR+RLAA R N  K PP   RAS RLTQLAPVADDALS
Sbjct  240  DPLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALS  299

Query  281  TPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVG  340
            TPL SQQINE FPLIDFTSELAAHAR LTPGSR+WALTR++EWLD+RF+ G+D LLAVVG
Sbjct  300  TPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVG  359

Query  341  EGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLA  400
            EGG+GKSAFCGTVAQQFRGN+LAAHCCQFDRKSKS PRNVLLSMVHQ+VDN P FKNQLA
Sbjct  360  EGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLA  419

Query  401  RLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFIS  460
            RLNL+YVLEE DP LLA KVL+DPLNALEEP  + F+++DGIDQCA G+ GRNELLEF +
Sbjct  420  RLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFA  479

Query  461  QIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDD  520
            QII  LP+WVGFL+SSKPSSKLAK LPVSSVLDFSA+N AFVAD + LVEDI++ FSDDD
Sbjct  480  QIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDD  539

Query  521  AVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIF  580
             V+AK ML +KSGGNFAYLEFTKQALSHPGMA  S  G VPL VL +LPETLYDIYAEIF
Sbjct  540  FVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIF  599

Query  581  EDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIV  640
            EDKFGQG AR WGKAKPLLQL+VGAA+GPYS VTEEQA++  +L A+DLRMLRRSFVD+V
Sbjct  600  EDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLV  659

Query  641  AVKH--------------------EEQFYFSIEDALLALRKMR--LNsssdsssgdpgis  678
            AV+H                    EEQFYFSI+DAL ALR+MR   +S S S        
Sbjct  660  AVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRSGSSGSSSGHSGSSSD  719

Query  679  sdKNAPDHNRRLSRANSRGKLPNKSQ---RHEPRTNFENYKPVGILKRG  724
               +AP     LSR  SRG   +  +   +HEPR N  +YKPVGILKRG
Sbjct  720  GTTSAPT----LSRTTSRGATKSHHRSHVKHEPRAN-PDYKPVGILKRG  763

>PHYKE_8395
Length=1420

 Score = 860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/761 (61%), Positives = 564/761 (74%), Gaps = 54/761 (7%)

Query  7     KLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVEEMFYNR  66
             +LKNKLR S L KKE A+ L++DSLR    Q +  R DR+  +TDTVN++DDVE+MFY R
Sbjct  673   ELKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVNVSDDVEDMFYGR  732

Query  67    STA------TSGIPQYRTTEQIRGNNLALYALHEDFEtqstasdasssfsqfsattpssy  120
             ST       TS +P YRTTEQ+RG N  L ALHE+        +A +  +   + + +S 
Sbjct  733   STTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEE--------EAMTPSASHLSNSFASS  784

Query  121   aastpGNHAG--IHHDFSTMYNTTSTLPAISGDF----DLERLHSEVLKIKSEVKTIRRE  174
              ASTPGN+      + F+T ++T  +   IS D     ++ RL +E+ ++K+EV+TIRRE
Sbjct  785   YASTPGNYQNPPTFNGFNTTHSTGLSR-TISEDTYNNNEVSRLRAELQEVKAEVQTIRRE  843

Query  175   VMNELHVTRYDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplssDERAALTRQ  234
             VMNELH+TRYDVLKELTLLKGA+AQL++ ++  S S  +S+ S        ++RAALTR 
Sbjct  844   VMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGSVSPSTSSSSDPLSA---EDRAALTRV  900

Query  235   TPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPL  294
                 TS+ T+DRLA  R+N +  PP A RAS RLTQLAPVAD+ALSTPLN QQINE FPL
Sbjct  901   PSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPL  960

Query  295   IDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVA  354
             IDFTSELAAHAR L PG+R+WALTR++EWLDARF++GNDT+LAVVG+GG+GKSAFCGTVA
Sbjct  961   IDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVA  1020

Query  355   QQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPF  414
             QQFRGNLLAAHCCQFDRKSKS PRNVLLS VHQLVDNLP FKNQLARLNL+YVLEE+DPF
Sbjct  1021  QQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPF  1080

Query  415   LLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLV  474
             LLA KV +DPLNA+EEP H+TF+L++G+DQC+ G NGRNELLEF+SQII  LPSWVGF++
Sbjct  1081  LLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMI  1140

Query  475   SSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGG  534
             SSKP SK AK LPVSSVLDFSAKNGAFV+D SSLV+DI++ FSD+D+ EAKR+L +KSGG
Sbjct  1141  SSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGG  1200

Query  535   NFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGK  594
             NFAYLEFTKQALSHPGMA+ S  G VPL VL +LP++L+DIY EIFEDKFGQG AR W K
Sbjct  1201  NFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAK  1260

Query  595   AKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH----------  644
             AKPLLQLIVGAAAGPYS VTE QAK+      +DLRMLRRSFVD+V VKH          
Sbjct  1261  AKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSAL  1320

Query  645   ----------EEQFYFSIEDALLALRKM---RLNsssdsssgdpgissdKNAPDHNRRL-  690
                       EEQFY S++DAL ALRK+   R + S+   S     SSD + P       
Sbjct  1321  CSWLSDPARSEEQFYLSVDDALTALRKLRRSRSSGSNSDHSHSGSSSSDGSVPSTTSHTP  1380

Query  691   SRANSRGKLPNKSQ-----RHEPRTNFENYKPVGILKRGKL  726
             SRA S     +KS      RHEPR N E +KP+GILKRGK+
Sbjct  1381  SRATSSRAASSKSHQRAHTRHEPRVNPE-FKPMGILKRGKM  1420

>HYAP_07104
Length=721

 Score = 821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/745 (61%), Positives = 540/745 (72%), Gaps = 47/745 (6%)

Query  5    MHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVEEMFY  64
            MH+LKNKLR   L KK+  ++L++DS+R K  QD  VR+DRS TLTDTVN TDDVEEMFY
Sbjct  1    MHRLKNKLR---LHKKDGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFY  57

Query  65   N--RSTATSGIPQYRTTEQIRGNNLALYALHEDFEtqstasdasssfsqfsattpssyaa  122
            +  ++ +T+G PQYR+TEQ+ G  L L +L+ED ET S  S+ASSSFSQFS    S  + 
Sbjct  58   SSTQTRSTNGPPQYRSTEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFSDHATSISSV  117

Query  123  stpGNHAGIHHDFSTMYNTTSTLPAISG-DFDLERLHSEVLKIKSEVKTIRREVMNELHV  181
                N    HH  +T  +  S   A+ G   +LE+L  E++++K EV  IR+ V+NELHV
Sbjct  118  ----NLTSTHHHLTTSTSMMSHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHV  173

Query  182  TRYDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplssDERAALTRQTPTKTSQ  241
            TRYDVLKEL LLKGAIAQL  T    ++S   S   S S+PLSS +R ALTRQT T TS 
Sbjct  174  TRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSS  233

Query  242  ATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSEL  301
            ATRDRLAA R+NT K PP A RAS RLTQLAPVAD ALSTPL+S Q+N+ FPLIDFT+EL
Sbjct  234  ATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTEL  293

Query  302  AAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNL  361
            AAHAR LTPGSR+WALTR +EWL++RF  G D LLAVVGEGGSGKSAFCGTVAQQ+RG L
Sbjct  294  AAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQL  353

Query  362  LAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKVL  421
            +AAHCCQFDRK KS PRNVLLS+VHQLV NLPLFKNQLARLNL+YVLEE DP LLA+KVL
Sbjct  354  VAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVL  413

Query  422  IDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSK  481
            +DPLNALE+P    F+L+DGIDQC  G  GRNELLEF++Q+I  LPSW+G +VSSKPSSK
Sbjct  414  VDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSK  473

Query  482  LAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEF  541
            LAK LPVSSVLDFSAKN AFVAD SSLV++I+ +F  +D  EAK +L  KSGGNFAYLEF
Sbjct  474  LAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEF  533

Query  542  TKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQL  601
            TKQALS  GMA  S  GVV + VLRELPETLYDIYAEIFEDKFG G AR W KA+ +LQL
Sbjct  534  TKQALS--GMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQL  591

Query  602  IVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH-----------------  644
             +GA AGPYS VTEEQA++   L  +DLR+LRRSFVD+VAVKH                 
Sbjct  592  AIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDP  651

Query  645  ---EEQFYFSIEDALLALRKMRLNsssdsssgdpgissdKNAPDHNRRLSRANSRGKLPN  701
               EEQFYF+I+DAL ALRKMR                   +    +  S  +S G  P 
Sbjct  652  ARAEEQFYFNIDDALQALRKMR---------------RASASASSGQLTSSGSSNGSAPG  696

Query  702  KSQRHEPRTNFENYKPVGILKRGKL  726
            +SQ  +      + +PV ILKRG++
Sbjct  697  RSQSPQKVQTESDCQPVSILKRGRM  721

>PYU1_G001733
Length=732

 Score = 568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/693 (45%), Positives = 425/693 (61%), Gaps = 106/693 (15%)

Query  27   NDDSLR-RKHTQDETVRVDRSATLTDTVN------MTDDVEEMFYN--------------  65
            ++D+LR  KH  ++  R  R+ T+  +        M+DDVE+MFYN              
Sbjct  32   DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNGGGGITRSTSDYTT  91

Query  66   --------------RSTATSGIPQYRTTEQIRGNNLALYALHEDFEtqstasdasssfsq  111
                          RST+      YRTTEQ+R  NL    L+ED                
Sbjct  92   GRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTNL--MPLNED----------------  133

Query  112  fsattpssyaastpGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTI  171
                                      +     T    +G  + + L +E++++K E++TI
Sbjct  134  ------------------------EVLPAAMRTTTGAAGGSEADALRAELVEMKQEMQTI  169

Query  172  RREVMNELHVTRYDVLKELTLLKGAIAQL-AstkslnssssvsstdssssdplssDERAA  230
            RRE+MNE+HVTRYDVLKE+T+LKG I QL A+ +S    +  +   +     LS  +   
Sbjct  170  RREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDT  229

Query  231  LTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRAS-ARLTQLAPVADDALSTPLNSQQIN  289
            +TR T   TS+AT+DRLAA  +    A P  IR + +RLTQLAPVADDALSTPL   QI+
Sbjct  230  ITRTTAVHTSKATKDRLAAREVT---AIPTIIRGTNSRLTQLAPVADDALSTPLLQHQID  286

Query  290  ESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAF  349
            + FPL+DF+++L  HA+   P SR WA  R Q+W+D+RF++G D LLA+VG+GGSGKS  
Sbjct  287  DMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTL  346

Query  350  CGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLE  409
             G +  +F  N++A H C+FDRKSKS PRNVLLS+V+QL+ NLPLFKNQLARLNL+YVLE
Sbjct  347  VGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLE  406

Query  410  ETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSW  469
            ETDP +LA KVL+DPL ALEEP  +  +L+DGIDQC   S  RN+LL+F++ II   P+W
Sbjct  407  ETDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRNDLLDFLAAIIPEFPTW  464

Query  470  VGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLT  529
            +G  ++SKPS +L   L ++S+LDFS KN  ++ D   L+ DI   FSD D  EA+ +L 
Sbjct  465  LGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILK  524

Query  530  KKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHA  589
            +KSGGNF +L+FTKQALSHPGM     NG VPL VL +LPE++Y+IY EIFEDKFG+GH 
Sbjct  525  RKSGGNFTFLDFTKQALSHPGME--EENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHN  582

Query  590  RAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH-----  644
            R W K +PLL LIV AA+GPY+L+TEEQA++Q  L+ DD+RM+RR+F DI+ V+H     
Sbjct  583  RLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRM  642

Query  645  ---------------EEQFYFSIEDALLALRKM  662
                            EQFY +I  ++  LR++
Sbjct  643  ETSAMYEWLVDPQRSGEQFYVNISASMDILRRL  675

>PYIR_13418
Length=747

 Score = 565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/769 (44%), Positives = 453/769 (59%), Gaps = 126/769 (16%)

Query  27   NDDSLR-RKHTQDETVRVDRSATLTDTVN------MTDDVEEMFYN--------------  65
            ++++LR  KH Q+E  R  R+ T+  +        M+DDVEEMFYN              
Sbjct  32   DEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEMFYNGSANGNANPSASAR  91

Query  66   -------------RST----------ATSG----IPQYRTTEQIRGNNLALYALHEDFEt  98
                         RST          AT G       YRTTEQ+RG NL    L ED   
Sbjct  92   STDNFGRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQMRGTNL--MPLQED---  146

Query  99   qstasdasssfsqfsattpssyaastpGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLH  158
                                        + A           TT+   A +G   ++ L 
Sbjct  147  ----------------------EVLPAASRA-----------TTTMATASNGGNPIDALR  173

Query  159  SEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLAstkslnssssvsstdss  218
            +E+ ++K EV+ IRRE+MNE+HVTRYDVLKE+T+LKG I QL +        S+ ++ ++
Sbjct  174  AELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAA  233

Query  219  ssdpl----ssDERAALTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPV  274
                     SSDE   ++R T   TS+AT++R    R     + P  +RAS+RLTQLAPV
Sbjct  234  VGAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAPV  289

Query  275  ADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDT  334
            ADDALSTPL   QI+E FPL++ ++EL A A++  P SR WA+ R QEW+D+RF++G D 
Sbjct  290  ADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDN  349

Query  335  LLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPL  394
            LLA+VG+GGSGKS   G +  +F  N++A H C FDRKSKS PRNVLLS+V+QL+ NLPL
Sbjct  350  LLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPL  409

Query  395  FKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNE  454
            FKNQLARLNL+YVLEETDP +LA KVL+DPL ALEEP  +   + DGIDQC   S GRN+
Sbjct  410  FKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK--SKGRND  467

Query  455  LLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQ  514
            LL+F++ II  LP+WVG  ++SKPS +L   L ++S+LDFSAKN  ++ D   L+ DI  
Sbjct  468  LLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIG  527

Query  515  YFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYD  574
             FSD D  +A+ +L +KSGGNF +L+FTKQALSHPGM     NG +PL VL +LPE++Y+
Sbjct  528  NFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGME--EDNGYIPLDVLHDLPESIYE  585

Query  575  IYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRR  634
            IY EIFEDKFG+G +R W K +PLL+LIV AA+GPY+L+TE QA++Q  L+ +D+R +RR
Sbjct  586  IYEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRR  645

Query  635  SFVDIVAVKH--------------------EEQFYFSIEDALLALRKMRLNsssdsssgd  674
            +FVDI+AV H                     EQFY  +   +  LR++    SSD+ S  
Sbjct  646  AFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHHQDSSDTHSAA  705

Query  675  pgissdKNAPDHNRRLSRANSRGKLPNKSQRHEPRTNFENYKPVGILKR  723
               +S  N  + +   S  +     P       P+ NF   KPVGILK+
Sbjct  706  SSEASSNNVSNVSTASSHLSYVVPPPAA-----PKVNF---KPVGILKK  746

>PYIW_19969
Length=733

 Score = 560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/758 (44%), Positives = 451/758 (59%), Gaps = 118/758 (16%)

Query  27   NDDSLR-RKHTQDETVRVDRSATLTDTVNMT------DDVEEMFYN--------------  65
            ++DSLR  KH Q+E  R  R+ T+  +   +      DDVE+MFYN              
Sbjct  32   DEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDMFYNGGDARSTSSSVRST  91

Query  66   ----RSTATSG----------------IPQYRTTEQIRGNNLALYALHEDFEtqstasda  105
                RSTA S                    YRTTEQ+RG    L  L ED          
Sbjct  92   DTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRGT-ANLIPLQED----------  140

Query  106  sssfsqfsattpssyaastpGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIK  165
                   ++ T ++    T GN++          N  S      G   L+ L +E+ ++K
Sbjct  141  --EVLPAASRTTTTSQMPTNGNYS----------NGNS-----GGGSQLDALRTELSEMK  183

Query  166  SEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplss  225
             EV+ IRRE+MNE+HVTRYDVLKE+T+LKG I QL +       S+              
Sbjct  184  LEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLST--------------  229

Query  226  DERAALTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNS  285
            DE   ++R T   TS+AT+DR A        + P  +RAS+RLTQLAPVAD+ALSTPL  
Sbjct  230  DEINTISRTTALFTSKATKDRRAT---RDESSSPMLVRASSRLTQLAPVADEALSTPLLQ  286

Query  286  QQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSG  345
             QI+E FPLI+ + EL A +R+    SR WA+ R QEW+D+RF++G D LLA+VGEGGSG
Sbjct  287  HQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSG  346

Query  346  KSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLR  405
            KS   G ++ +F  N++A H C FDRKSKS PRNVLLS+V+Q++ NLPLFKNQLARLNL+
Sbjct  347  KSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLK  406

Query  406  YVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISL  465
            YVLEE+DP +LA K+L+DPL ALEEP  +   +IDG+DQC   S GRN+LL+F++ II  
Sbjct  407  YVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCK--SRGRNDLLDFLAVIIPE  464

Query  466  LPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAK  525
            LP+W+G  ++SKPS +L   L +SS+LDFSAKN  ++ D   ++ DI   FSD D  +A+
Sbjct  465  LPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAR  524

Query  526  RMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFG  585
             +L +KSGGNF +L+FTKQALSHPGM     NG +PL VL +LPE++Y+IY EIFEDKFG
Sbjct  525  EILKRKSGGNFTFLDFTKQALSHPGME--EDNGYIPLDVLHDLPESIYEIYEEIFEDKFG  582

Query  586  QGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH-  644
            +G  R W K +PLL+LIV AA+GPY+L+TE QA++Q  L+ +D+R +RRSFVDI+ V+H 
Sbjct  583  KGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHG  642

Query  645  -------------------EEQFYFSIEDALLALRKMRLNsssdsssgdpgissdKNAPD  685
                                EQFY  +   + ALR++    SS++ S      S  NA  
Sbjct  643  TYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQLHHQDSSETHSVGSSDGSSSNATS  702

Query  686  HNRRLSRANSRGKLPNKSQRHEPRTNFENYKPVGILKR  723
            +   +S A+S     + S    P     N+KPVGILK+
Sbjct  703  N---VSTASS-----HLSYVVPPPVPKVNFKPVGILKK  732

>PYAP_17763
Length=794

 Score = 523 bits (1347),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 264/514 (51%), Positives = 363/514 (71%), Gaps = 18/514 (4%)

Query  142  TSTLPAI---SGDFDLERLHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIA  198
            T T PA    +GD DL  L +E+ ++K E++ I+RE+MNE+H+TRYDVLKE+T+LKG I 
Sbjct  167  TPTTPAAVIRAGDADL--LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIM  224

Query  199  QLAstks--------lnssssvsstdssssdplssDERAALTRQTPTKTSQATRDRLAAP  250
            QL S             +++++       ++ LS +E+ AL+R+T T  S+ T++R+   
Sbjct  225  QLVSVIQQSGGVHFDTATAAAMGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTT  284

Query  251  RINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTP  310
            R   ++ PP     S+RLTQLAPV D ALSTPL+ +QI++ FPLIDF++E+   +R    
Sbjct  285  R--EDQIPPVLRSTSSRLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRET  342

Query  311  GSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFD  370
            GSR W   R+QEWLD+RF++G D +LA+VG+ GSGK+    +V  ++   ++A H C+FD
Sbjct  343  GSREWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFD  402

Query  371  RKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEE  430
            RK+KS PRNVLLS+V+QL  +LP+FK+QLARLNL+YVLEETD   L+ KVLIDPLNALEE
Sbjct  403  RKAKSSPRNVLLSLVNQLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEE  462

Query  431  PTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSS  490
            P    F++ D IDQC TG  G N+L +F+S II   P W+GFLVSSKPS + A  +PVSS
Sbjct  463  PLTPKFVVFDAIDQCRTGV-GYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSS  521

Query  491  VLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPG  550
            VLDFSA+N  ++ D   L+ DI+  F D+D  EAK++L  KSGGN++YLEFTKQALS+PG
Sbjct  522  VLDFSAQNANYMNDTVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPG  581

Query  551  MAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPY  610
            M   S  G VP+ VL +LP++LY+IY EIFEDKFG+G  R W KA P+LQLI  AA+GPY
Sbjct  582  MEEAS--GFVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPY  639

Query  611  SLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH  644
            + +TE+     L    D++RMLRR+F+DI++++H
Sbjct  640  AQITEQNIMDSLSYTKDEVRMLRRAFIDIISIRH  673

>PYAR_13571
Length=666

 Score = 477 bits (1228),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 321/474 (68%), Gaps = 49/474 (10%)

Query  171  IRREVMNELHVTRYDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplssDERAA  230
            IRRE+MNE+H +RYDVLKE+T+LKG I QL                              
Sbjct  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLIE---------------------------T  153

Query  231  LTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINE  290
            + R+T T  S++T++R+   R   +  PP     S RLTQLAPV D ALSTPL  +QI+E
Sbjct  154  MARRTTTVASKSTKERITTTR--DDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDE  211

Query  291  SFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFC  350
             FPL+DF++E+   AR    G+R WA  R+QEWLD+RF++G+D LLA+VG+ G+GK+   
Sbjct  212  LFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT---  268

Query  351  GTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEE  410
                          H C+F+RK KS PRNVLLS+V+QL   LP FK+QLARLNL+YVLEE
Sbjct  269  --------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEE  314

Query  411  TDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWV  470
            TD   LA KVL+DPL +LEEP  + F+L+DG+DQC   +NG N+LL+F+S ++   PSW+
Sbjct  315  TDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGV-ANGYNDLLDFLSVVVPECPSWL  373

Query  471  GFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTK  530
            GFL+++KPS + A+ +PV+S+LDFSAKN A+V D + L+ DI   F  +D  +A ++L  
Sbjct  374  GFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKT  433

Query  531  KSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHAR  590
            KS GN++YLEFT+QA+S+PGM   +  G VP+ VL +LP++LY+IY EIFEDKFG+G  R
Sbjct  434  KSCGNYSYLEFTRQAMSNPGME--APQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTR  491

Query  591  AWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH  644
             W KA P+LQLI  AA+GPY+ +TE+     L    DD+RMLRR+F+DI++++H
Sbjct  492  LWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRH  545

>PYVX_23590
Length=689

 Score = 378 bits (971),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 218/505 (43%), Positives = 293/505 (58%), Gaps = 107/505 (21%)

Query  271  LAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHM  330
            LAPV D ALS PL  +Q++E FPL+D ++++AA AR+  PG+R WA  R+QEWLD+RF++
Sbjct  243  LAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNV  302

Query  331  GNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVD  390
            G DTLL VVG  G+GKS FCG+V    +GN+LA H C+FDRK+KS PR VLLS+V Q+V 
Sbjct  303  GQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVVA  362

Query  391  NLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSN  450
            NLP FK QLARLNL+YVLEE D F+LA KVLIDPL A EEP  +  +++DG+DQC T   
Sbjct  363  NLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRR  422

Query  451  G--RNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSL  508
            G  RNELLEF++ ++  LPSW+G LVSSKP+ +LA  L  +S+LDFS KN  FV DA  L
Sbjct  423  GGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFL  482

Query  509  VEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLREL  568
            V+DI+  F+D  A EA+R+L  K+GGNFAYL+FT+QALS PG+     +G + L +L +L
Sbjct  483  VDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGL----DDGELELDMLHDL  538

Query  569  PETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADD  628
            PE+LY+IY EIFED                                            DD
Sbjct  539  PESLYEIYLEIFEDN-------------------------------------------DD  555

Query  629  LRMLRRSFVDIVAV--------------------KHEEQFYFSIEDALLALRKMRLNsss  668
            +R+++RSFVDI+AV                    +  E F+F  +  +  LR+++ + ++
Sbjct  556  MRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAA  615

Query  669  dsssgdpgissdKN---------------------------APDHNRRLSRANSRGKLPN  701
             +        +  +                           +P   R  SR +S      
Sbjct  616  KAKQQSDEADAQGHERRRMSRRESARSTASNSSSSTSSRSHSPPPARTSSRVSS------  669

Query  702  KSQRHEPRTNFENYKPVGILKRGKL  726
               R+EP  N    KPVGILKRG+L
Sbjct  670  ---RYEPPAN--PSKPVGILKRGRL  689

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 92/224 (41%), Gaps = 68/224 (30%)

Query  5    MHKLKNKLRGS---------LLLKKESAYELNDD-SLR-RKHTQDETVRVDRSATLTDTV  53
            M KLK KLRG          L   +     L DD SLR  +   ++ +R  R  TL+   
Sbjct  1    MTKLKTKLRGGGSSSRRERDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSAS  60

Query  54   NMTDD-VEEMFY-------------------NRSTATS--GIPQYRTTEQIRGNNLALYA  91
            +   D VEEMFY                   +RSTA S      YRTTEQ+R   L    
Sbjct  61   SAMSDDVEEMFYGGGPGGHAGHGGHAGHGGADRSTAGSVRTTDVYRTTEQLRSTGLE--P  118

Query  92   LHEDFEtqstasdasssfsqfsattpssyaastpGNHAGIHHDFSTMYNTTSTLPAISGD  151
            L ED                                +  + H         ++ P   G 
Sbjct  119  LAED------------------------RVLPPAVPYGSVPH---------TSGPHADGP  145

Query  152  FDLERLHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKG  195
              L  L +E+  +++E + IRREVMNELHV RYDVLKE+T+LKG
Sbjct  146  GGLAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTVLKG  189

>CCI44111
Length=576

 Score = 358 bits (918),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 196/491 (40%), Positives = 291/491 (59%), Gaps = 10/491 (2%)

Query  154  LERLHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLAstkslnssssvs  213
            +E    E+  ++ E++ +R+E++  +  TRYD+LKE+  LKG +A ++       ++ ++
Sbjct  53   IEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKIN  112

Query  214  stdssssdplssDERAALTRQTPTKTSQATRDR---LAAPRINTNKAPPRAIRASARLTQ  270
              + ++++  +  E A         ++  T DR   L+     T      +I   + L  
Sbjct  113  KLNHTTANGSACSEGA---DDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPT  169

Query  271  LAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHM  330
            L  + +  LS PL+  +I+E FPLID + ++ ++A  L  G+R WAL  I +W+ + F  
Sbjct  170  LMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFEN  229

Query  331  GNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVD  390
            GN+ +L +VGEGG+GKS   G V Q+F  NL A H  QFDRK  S  R+V+LS+V Q   
Sbjct  230  GNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFAS  289

Query  391  NLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHS-TFILIDGIDQCATGS  449
             L L+K QL RLNLRY+L E++P ++A K+LIDPL A+ E   +  F+L DGIDQC    
Sbjct  290  KLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLV-K  348

Query  450  NGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLV  509
            N  N+LLE +S I    PSW+GF+V+SK     A  L  +SV+     N  F+ D+  L+
Sbjct  349  NQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILM  408

Query  510  EDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELP  569
            E++  YF      EA  +L +KSGGN  YL+F  +ALSHP +    T   + L VL ELP
Sbjct  409  ENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQT--FLSLDVLDELP  466

Query  570  ETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDL  629
            E++ +I   IF+DKFGQGH R W  AKP+L++IV AAAGPY LV E Q K+Q +L  ++ 
Sbjct  467  ESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEW  526

Query  630  RMLRRSFVDIV  640
            RM+ R+F DI+
Sbjct  527  RMINRAFTDII  537

>CCA22843
Length=586

 Score = 347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/507 (37%), Positives = 294/507 (58%), Gaps = 29/507 (6%)

Query  154  LERLHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLAstkslnssssv-  212
             E + +E+  +++E++++R+E++  +  TRYD++KE+  L+G +  + +  +     S  
Sbjct  60   FEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSP  119

Query  213  -------sstdssssdplssDERAALTRQTPTKTS----QATRDRLAAPRINTNKAPPRA  261
                   ++ + ++    + D+       TP +++     + +      R+NT  +    
Sbjct  120  TGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSS---  176

Query  262  IRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQ  321
                   +   P+ +  LS PL+  + +E FP ID  S+L ++A  L  G+R WAL R++
Sbjct  177  ------FSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVK  230

Query  322  EWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVL  381
            EW+++ F   ND +L ++GEGGSGKS   G + Q+F   L A H CQFDRKS+S  R+V+
Sbjct  231  EWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVV  290

Query  382  LSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHST---FIL  438
            LS+V Q     PL+K QL  LNLRY+L+E++P ++ANK+LI+PL A+  P  ++   F+L
Sbjct  291  LSLVSQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVL  348

Query  439  IDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKN  498
             DGIDQC    N  N+LL+ IS I    PS +GF+V+SK S          S++    +N
Sbjct  349  FDGIDQCLV-ENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERN  407

Query  499  GAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNG  558
            G F+ D+  L+E+    F      EA  +L +KSGGN  YL+FT++ALSHP +    T  
Sbjct  408  GKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERT--  465

Query  559  VVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQA  618
             + L VL ELP+++ DI+  IFEDKFGQGH R W   KP+L+ IV AAAG + LV E Q 
Sbjct  466  FLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQI  525

Query  619  KKQLDLNADDLRMLRRSFVDIVAVKHE  645
            K++  L  ++ RM++RSF DI+    E
Sbjct  526  KQRFQLGKEEWRMMKRSFTDIICCGTE  552

>SPRG_06355
Length=713

 Score = 254 bits (649),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 175/573 (31%), Positives = 284/573 (50%), Gaps = 74/573 (13%)

Query  127  NH---AGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELHVTR  183
            NH   A  + D  T +  TS  PA S   D     + V ++K  V  IRR+VM ELH T+
Sbjct  114  NHIVPAKAYRDEPTGFENTSDAPAPSMAMD-----AAVDEMKRHVDGIRRDVMMELHTTK  168

Query  184  YDVLKELTLLKGAIAQLAstkslnssssvsstdssssdplssDERAALTRQTPTKTSQAT  243
            YD+LKE+T+L+GA+ QL         ++ +    +    LS    A ++ +  +++S   
Sbjct  169  YDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTEDRKLSVMSDATVSSEADSESSTLE  228

Query  244  RDRLAAPR--------INTNKAPPR--------AIRASARLTQLA---------------  272
               +  P          +   +PP+        +IRAS++L++ +               
Sbjct  229  EPEVFEPNPKVPYLPAASRTPSPPKRESTVVRESIRASSKLSRESSKLSRESSKISRESS  288

Query  273  ---------PVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEW  323
                     P+ D AL+ P  +  +N+  P ++        A  + P +R+WA+ +  +W
Sbjct  289  KLFRESTRQPIKDQALTQPWENV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKW  343

Query  324  LDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLS  383
                       +L VVG  G+GKS     +   +   ++A+H  ++D +  +    +L+S
Sbjct  344  AQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMS  401

Query  384  MVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGID  443
            + HQ+   LP F+ QL RLNL Y+++E DP +LA K+LI+PL ++  P  S  I++D +D
Sbjct  402  LAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVD  461

Query  444  QCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVA  503
            + A+ + G N L+  ++ +    PSWV FL+SS+P   + K LP   VL F  ++  F A
Sbjct  462  EDAS-TPGTN-LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAA  519

Query  504  DASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLS  563
            D +  V+ +      DD      +L  KS G+F YL+F  QA +         +  +   
Sbjct  520  DCTIAVQSLMDKHGLDDK-NILFLLKAKSQGSFLYLQFVDQAFA-------MIHSEIDAG  571

Query  564  VLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAA-------AGPYSLVTEE  616
            ++ ELP+TLY+IY ++FE+K+G+G  R W K +P+L+ IVGAA       A P+  VTE 
Sbjct  572  MILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPF--VTES  629

Query  617  QAKKQLDLNADDLRMLRRSFVDIVAVKHEEQFY  649
              +    L   DL ++ RSF DIVAV  E   Y
Sbjct  630  DVQHIFKLGQPDLALIARSFEDIVAVDEETGVY  662

>SDRG_01763
Length=736

 Score = 211 bits (537),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 202/384 (53%), Gaps = 26/384 (7%)

Query  273  PVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGN  332
            P+ D AL+ P  +  +N+  P ++        A  + P +R+WA+ +  +W         
Sbjct  321  PIKDQALTQPWENV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  375

Query  333  DTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNL  392
              +L VVG  G+GKS     +   +   ++A+H  ++D +    P  +L+S+ HQ+   L
Sbjct  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHA--PSAILMSLAHQISCKL  433

Query  393  PLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGR  452
            P ++ QL RLNL Y+++E DP +LA K+LI+PL ++  P  S  I++D +D+  + + G 
Sbjct  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVS-TPGA  492

Query  453  NELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDI  512
            N L+  ++ +    PSWV FL+SS+    + K LP   VL F  ++  F AD +  V+ +
Sbjct  493  N-LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSV  551

Query  513  SQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETL  572
                  DD      +L  KS G+F YL+F  QA S         +  +   ++ ELP+TL
Sbjct  552  MDKHGLDDK-NILFLLKAKSQGSFLYLQFVDQAFS-------MIHSEIDAGMILELPKTL  603

Query  573  YDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAA-------AGPYSLVTEEQAKKQLDLN  625
            ++IY ++FE+K+G+G  R W K + +L+ IVGAA       A P+  VTE   +    L 
Sbjct  604  HEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLG  661

Query  626  ADDLRMLRRSFVDIVAVKHEEQFY  649
              DL ++ RSF DIV V  +   Y
Sbjct  662  QPDLALIARSFEDIVTVDEDTGVY  685

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 8/77 (10%)

Query  127  NH---AGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELHVTR  183
            NH   A  + D  T +  TS  PA S   D     + V ++K  V  IRR+VM ELH T+
Sbjct  127  NHIVPAKAYRDEPTGFENTSDAPAPSMAMD-----AAVDEMKRHVDGIRRDVMMELHTTK  181

Query  184  YDVLKELTLLKGAIAQL  200
            YD+LKE+T+L+GA+ QL
Sbjct  182  YDLLKEMTMLRGAVMQL  198

>H310_08292
Length=1007

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 81/362 (22%), Positives = 135/362 (37%), Gaps = 47/362 (13%)

Query  262  IRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQ  321
            ++ + R+ QL       L       ++   F    F +E+A   +      R W + ++ 
Sbjct  406  VKYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIAKFTQGF--AGREWVMDQLT  463

Query  322  EWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVL  381
            +W              V G+ G+GK+A    + Q  +  + A H    D +    PR  +
Sbjct  464  QW-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCI  517

Query  382  LSMVHQLVDNLPLFKNQLARLN-LRYVLEETDPFLLANKVLIDPLNALEEPTHSTF-ILI  439
            LS+ +QL   LP +   L +   L  ++  +    L   +L+ PLNA+ +PT     IL+
Sbjct  518  LSLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILL  577

Query  440  DGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSK-------------PSSKLAKCL  486
            DG+D     +   N  +  +  ++  LPSWV  + +S+             P   L KC+
Sbjct  578  DGLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALDKCV  637

Query  487  PVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAV---EAKRMLTKKSGGNFAYLEFTK  543
              SS         A V               D+ AV   E    +  +S G F Y     
Sbjct  638  DQSSADMLKYLQAALVPFVR----------PDEGAVVPLETLHAIVARSEGLFLYASHIV  687

Query  544  QALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIV  603
             AL    +          L  L   P  +     + FED+F   H       +PLL+++ 
Sbjct  688  HALHQKRLT---------LDKLESFPVGMGGYLRQFFEDQFSAHHYET--SIRPLLEVLC  736

Query  604  GA  605
             A
Sbjct  737  AA  738

>SDRG_04575
Length=1003

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 95/189 (50%), Gaps = 12/189 (6%)

Query  292  FPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCG  351
            F    F ++++ + +      R W L ++ +W        +D +  + G+ G+GKSA   
Sbjct  429  FSPFSFQNQISKYTQGF--AGREWVLHQLDQWKQT-----HDQVFWITGQIGTGKSALAA  481

Query  352  TVAQQFRGNLLAAH-CCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLN-LRYVLE  409
             + Q  R  + A H  C+ D +++S  R  +LS+ +QL   LP + + L + + L  V+ 
Sbjct  482  YIIQS-RPEIRAFHLVCKEDEQTQSH-RRCILSLAYQLTTQLPEYASFLQQGSPLEEVVP  539

Query  410  ETDPFLLANKVLIDPLNALEEP-THSTFILIDGIDQCATGSNGRNELLEFISQIISLLPS  468
             +    L + +L+ PL+A+ EP T    IL+DG+D         N L+  +  ++  LPS
Sbjct  540  VSTVVELLDILLVAPLSAIAEPATTPLVILLDGLDSLEDTQETDNCLVSALPGLLQKLPS  599

Query  469  WVGFLVSSK  477
            WV  +++S+
Sbjct  600  WVRVILTSR  608

>SPRG_12621
Length=1003

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 86/170 (51%), Gaps = 10/170 (6%)

Query  311  GSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAH-CCQF  369
              R W L ++ +W        +D +  V G+ G+GKSA    + Q  R  + A H  C+ 
Sbjct  459  AGREWVLDQLDQW-----KQTHDQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKE  512

Query  370  DRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLN-LRYVLEETDPFLLANKVLIDPLNAL  428
            D +++S  R  +LS+ +QL   LP + + L + + L  V+  +    L + +L+ PL A+
Sbjct  513  DEQTQSH-RRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAI  571

Query  429  EEP-THSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSK  477
             EP T    IL+DG+D         N L+  +  ++  LPSWV  +++S+
Sbjct  572  AEPATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSR  621

>H257_11773
Length=1026

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 80/354 (23%), Positives = 148/354 (42%), Gaps = 31/354 (9%)

Query  262  IRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQ  321
            ++ + RL QL       L       ++   F    F +E++   +      R W + ++ 
Sbjct  421  VKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLT  478

Query  322  EWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVL  381
            EW        +     + G+ G+GK+A   +V Q  +  + A H    + +     R  +
Sbjct  479  EW-----KASSSQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCV  532

Query  382  LSMVHQLVDNLPLFKNQLARLN--LRYVLEETDPFLLANKVLIDPLNALEEP-THSTFIL  438
            LS+ +QL   LP +   L + +  L  ++  +    L + +L+ PLNA+ +P T    IL
Sbjct  533  LSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVIL  592

Query  439  IDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSK--PS--SKLAKCLPVSSV--L  492
            IDG+D     +   N  +  ++  +  LP WV ++++S+  PS   KL   +P  ++   
Sbjct  593  IDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKC  652

Query  493  DFSAKNGAFVADASSLVEDISQYFSDDDAVEAK-RMLTKKSGGNFAYLEFTKQALSHPGM  551
                ++        +LV+ ++   +D D   A  R + ++S G F Y      ALS   +
Sbjct  653  GHQTRDDMLKYLQLALVQFVAN--ADKDVPAATLRFIVERSEGLFLYASHIVNALSQKRL  710

Query  552  AVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGA  605
                      L  L   P  +     + FED+F   H       +PLL+++  A
Sbjct  711  T---------LDKLESFPVGMGGYLRQYFEDQFTALHYET--SVRPLLEVLCAA  753

>SPRG_19030
Length=1000

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 75/170 (44%), Gaps = 17/170 (10%)

Query  312  SRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDR  371
            +R W L +   W+          +  V G  GSGKSA    + Q  R  + A H    + 
Sbjct  449  AREWVLAKYDAWVQTP---NGSRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  504

Query  372  KSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFL----LANKVLIDPLNA  427
                  R  +LS+V+QL   LP + N    LN +  LEE  P      L + +LI PL+A
Sbjct  505  DQTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLSA  561

Query  428  LEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSK  477
            +  P     +LIDGI+    G       +  ++  + L PSWV F+  ++
Sbjct  562  IAHPASILVLLIDGIECFEPG------FVATLTAHMDLWPSWVRFVFGTR  605

>SDRG_07983
Length=991

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 75/170 (44%), Gaps = 17/170 (10%)

Query  312  SRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDR  371
            +R W L +   W+          +  + G  GSGKSA    + Q  R  + A H    + 
Sbjct  441  AREWVLAKYDAWVQTP---NGSRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  496

Query  372  KSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFL----LANKVLIDPLNA  427
                  R  +LS+V+QL   LP + N +   N +  LEE  P      L + +LI PL+A
Sbjct  497  DQTQSARRCVLSLVYQLSTQLPEYANVI---NSQEPLEEIVPVKSLVDLIHALLIAPLSA  553

Query  428  LEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSK  477
            +  P     +LIDGID    G       +  ++  + L PSWV F+  ++
Sbjct  554  IAHPASILVLLIDGIDCFEPG------FVATLTAHMDLWPSWVRFVFGTR  597

>PHYSO_470533
Length=1084

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 89/357 (25%), Positives = 140/357 (39%), Gaps = 73/357 (20%)

Query  313  RSWALTRIQEWLDARF---------HMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLA  363
            R W   R Q+W+              + N  +  +VG+ GSGK++    + Q     + A
Sbjct  472  REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTC-PEIAA  530

Query  364  AHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFL----LANK  419
             H  + + +     R  +LS+ +QL   LP + + L        LEE  P      L ++
Sbjct  531  FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVSQ  587

Query  420  VLIDPLNALEEPT--HSTFILIDGIDQ--------------CATGSNGRNELLEFISQII  463
            +LI PLNA+  PT   S  +LIDGI+                + GS     L+  +  + 
Sbjct  588  LLIGPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALA  647

Query  464  SLLPSWVGFLVSSKPS----SKLAKCLPVSSVLD-FSAKNGAFV----------------  502
            S LP WV  +V S+      SKL    P   ++D F  +N   +                
Sbjct  648  SRLPDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEV  707

Query  503  --ADASSLVEDI---SQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTN  557
              A AS    D+   +  F  +  VE   ++ ++S G F Y     QA+         T 
Sbjct  708  DFAKASEQAVDVPANNHEFGLEQVVE---LIARRSEGLFLYAVNVVQAI---------TE  755

Query  558  GVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVT  614
            G + L  L ELP  +     + F   F   H     + +P+L+++  AA  P  L T
Sbjct  756  GRLRLHELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLEVLC-AAYEPLPLAT  810

>PYVX_21513
Length=1446

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 90/209 (43%), Gaps = 27/209 (13%)

Query  313  RSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRK  372
            R W   R+Q+W++      +  +  + G+ GSGK++    + Q F   + A H    +  
Sbjct  438  RDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTFP-EIAAFHFALQEDD  496

Query  373  SKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPF----LLANKVLIDPLNAL  428
                 R  +LS+ +QL   LP +      L  R  LEE  P      L   +L++PLN +
Sbjct  497  QTHIARRCVLSLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTI  553

Query  429  EEPTHSTFILIDGIDQCATGSNGR---------------NELLEFISQIISLLPSWVGFL  473
            + P     +LIDG++   +G+                    L+  +  +++ LPSWV  +
Sbjct  554  KRPAKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLV  613

Query  474  VSSKPS----SKLAKCLPVSSVLDFSAKN  498
            + S+      ++L   +P   +  F+ +N
Sbjct  614  LLSREDHDVMTRLQTYIPSVVIDHFAQEN  642

>H257_01934
Length=1022

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 87/179 (49%), Gaps = 13/179 (7%)

Query  313  RSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRK  372
            R+W L    EW+ +         L + G  GSGK+A    + Q  R  ++A H    + +
Sbjct  463  RAWVLHEFDEWVTSPPSNARRVFL-LTGVIGSGKTALAAHIIQN-RPEVVAFHLASHEGE  520

Query  373  SKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFL-----LANKVLIDPLNA  427
                 R  +L++V+QL   LP + N L   + +  LEET  F+     L  ++LI PL  
Sbjct  521  QTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEET-VFVGNLADLVQELLIAPLER  577

Query  428  LEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCL  486
            +  P  +  ILIDGI +C   ++  + L+  ++  ++  P+W+ F+ +S+   ++   L
Sbjct  578  IATPPSTMVILIDGI-ECFPCAD--DNLVAILTASLNRWPAWMRFVFTSREDPRVLSLL  633

>PITG_17250
Length=1046

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 81/187 (43%), Gaps = 26/187 (14%)

Query  313  RSWALTRIQEWLDARF----HMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQ  368
            R W     Q W+         + N  +  V+G+ GSGKS+    + Q     + A H   
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQAC-PEIAAFHFAT  508

Query  369  FDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFL----LANKVLIDP  424
             + +     R  +LS+ +QL   LP + + L        LEE  P      L   +LI P
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLIGP  565

Query  425  LNALEEPT--HSTFILIDGID-----QCATGSNG-----RNE--LLEFISQIISLLPSWV  470
            LNA+  P+   S  +LIDG++      C   + G     ++E  L+  +  ++S LP WV
Sbjct  566  LNAIARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWV  625

Query  471  GFLVSSK  477
              ++ S+
Sbjct  626  RIVLLSR  632

>PPTG_11365
Length=1106

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 79/193 (41%), Gaps = 32/193 (17%)

Query  313  RSWALTRIQEWLDARF------HMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHC  366
            R W   + Q W+           + N  +  VVG+ GSGK++    + Q     + A H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSC-PEIAAFHL  561

Query  367  CQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFL----LANKVLI  422
               + +     R  +LS+ +QL   LP + + L        LEE  P      L   +LI
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLI  618

Query  423  DPLNALEEPT--HSTFILIDGIDQC------------ATGSNGRNE----LLEFISQIIS  464
             PL A+  P+   S  +LIDG++              + GS   N+     +  +  ++S
Sbjct  619  GPLTAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVS  678

Query  465  LLPSWVGFLVSSK  477
             LP WV  ++ S+
Sbjct  679  RLPEWVRIVLLSR  691

>PYAR_14788
Length=795

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 66/146 (45%), Gaps = 10/146 (7%)

Query  338  VVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKN  397
            V G+ G+GK++    + Q     + A H    +       R  +LS+ +QL   LP +  
Sbjct  421  VTGQIGAGKTSVAAKMVQTIP-EIAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPAYA-  478

Query  398  QLARLNLRYVLEETDPFL----LANKVLIDPLNALEEPTHST--FILIDGIDQCATGSNG  451
                L     LEE  P      L   +LI PLNA+  P       +LIDG++  A+ + G
Sbjct  479  --VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGG  536

Query  452  RNELLEFISQIISLLPSWVGFLVSSK  477
                +  +  +I+ LPSWV  ++ S+
Sbjct  537  AGGGVSLLPSLIARLPSWVRVILLSR  562

>PYU1_G002110
Length=999

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 82/341 (24%), Positives = 134/341 (39%), Gaps = 71/341 (21%)

Query  313  RSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRK  372
            R W + ++ +W+D+        +  V G+ GSGK+A    + Q     + A H    + +
Sbjct  432  RKWLIAQLTKWIDSP---TASQMFWVTGQIGSGKTALAARLVQTI-PEIKAFHFAFEEDE  487

Query  373  SKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFL----LANKVLIDPLN--  426
                 R  +LS+ +QL   L   K+  A L  R  LEE  P      L   +LI PLN  
Sbjct  488  QTQNARRCVLSLAYQLTTQL---KDYAAFLQAREPLEELVPVSTFNELVTHLLIKPLNEI  544

Query  427  -ALEEPTHSTFILIDGIDQCATGSNGRNEL-------------LEFISQIISLLPSWVGF  472
              L+       +LIDG++  + G +  + L             +  +  ++S LP WV  
Sbjct  545  AQLQSQNTPLVLLIDGLENLSDGKSDVSSLPVMTSRQSFAQCLVSALPSLVSQLPKWVRV  604

Query  473  LVSSK--PS--SKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKR--  526
            +V S+  P+  +KL    P + VL+   K            EDI Q+        A    
Sbjct  605  IVLSRNDPAINAKLQNFTP-NIVLEAYVKENK---------EDIKQFIEKSLCSSASTGL  654

Query  527  ------------MLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYD  574
                        ++ ++S G F Y     Q+L     AV  +           LP  +  
Sbjct  655  SSGKTLPPDQIDLIVERSEGLFLYAANVVQSLEEKWFAVGQS-----------LPIGMNG  703

Query  575  IYAEIFEDKFGQGHARAWGK-AKPLLQLIVGAAAGPYSLVT  614
               + F   FG   A+ + +  +P+L+++  AA  P SL T
Sbjct  704  YLYDFFVSHFG---AKQYKRLIRPVLEVLC-AAFEPLSLPT  740

>PYIR_14107
Length=1176

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 66/146 (45%), Gaps = 13/146 (9%)

Query  313  RSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRK  372
            R W   +++ W+ +        +  V G+ GSGK+A    + Q     + A H    + +
Sbjct  550  REWLFMQLENWIASP---TATQVFWVTGQIGSGKTALAARMVQVIP-EIAAFHFALQEDE  605

Query  373  SKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPF----LLANKVLIDPLNAL  428
                 R  +LS+ +QL   LP +      L  R  LEE  P      L  ++L++PLN +
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYA---LFLQSREPLEEIVPVSNFATLVTRLLVEPLNEI  662

Query  429  EEP--THSTFILIDGIDQCATGSNGR  452
              P  T    +LIDG++  ++G N +
Sbjct  663  ARPQSTKPLVLLIDGLEHLSSGKNSQ  688

>PYAP_22230
Length=1116

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 83/369 (22%), Positives = 134/369 (36%), Gaps = 94/369 (25%)

Query  313  RSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRK  372
            R+W L  I++W++     G+     V G+ GSGK++    + Q     + A H    D  
Sbjct  496  RAWLLESIRQWINTPVTSGSKVFW-VTGQIGSGKTSVAARMVQ-LMPEIAAFHFALQDDD  553

Query  373  SKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPF----LLANKVLIDPLNAL  428
                 R  +LS+ +QL   LP +      L     LEE  P      L   +L++PLNA+
Sbjct  554  QTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAI  610

Query  429  EEPTHS--TFILIDGIDQ---------------------------------CATGSNGRN  453
              P       +LIDG++                                  C   S   +
Sbjct  611  ARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGSSD  670

Query  454  E-LLEFISQIISLLPSWVGFLVSSK--PS----------------------------SKL  482
            E L+  +  +IS LP WV  ++ S+  PS                             ++
Sbjct  671  ECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENEADIREFVEM  730

Query  483  AKCL--PVSSVLDFSAKNGAFVADASSLVEDISQYFSDDD----AVEAKRMLTKKSGGNF  536
            A C   P SS +  + +    +   S  +  +S   SD+     + E   ++TK+S G F
Sbjct  731  ALCSPDPQSSHISRTVQVAPPIRHRSPSITALS--VSDNTPRKISAEQVEVITKRSEGLF  788

Query  537  AYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAK  596
             Y     QA+    +AV           L  LP  L     + FE  F     +   K +
Sbjct  789  LYAANIVQAIEEGRLAVDQ---------LETLPVGLGGYLRQFFESHFDDATYKT--KIR  837

Query  597  PLLQLIVGA  605
            P+L+++  A
Sbjct  838  PVLEVLCAA  846

>PYIW_15717
Length=1121

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 66/147 (45%), Gaps = 14/147 (10%)

Query  313  RSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRK  372
            R W   +++ W+ +        +  V G+ GSGK+A    + Q     + A H    + +
Sbjct  525  REWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMVQLIP-EIAAFHFALQEDE  580

Query  373  SKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPF----LLANKVLIDPLNAL  428
                 R  +LS+ +QL   LP +    + L  R  LEE  P      L  ++L++PLN +
Sbjct  581  QTQNARRCVLSLAYQLTTQLPQYA---SFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDI  637

Query  429  EEPTHST---FILIDGIDQCATGSNGR  452
              P  +T    +LIDG++   +  N +
Sbjct  638  ARPQTATKPLVLLIDGLEHLVSDKNAQ  664

>PHYSO_545378
Length=224

 Score = 36.2 bits (82),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  316  ALTRIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +  +I+EWL D + H+G+D +LAVVG      S F  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSTFDFSKAQQF  141

>PYVX_21776
Length=203

 Score = 35.8 bits (81),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  319  RIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +I+EWL D + H+G D +LAVVG      S+F    AQQF
Sbjct  106  KIKEWLRDLQSHVGEDIVLAVVGNKSDCASSFDFAQAQQF  145

>PYU1_G012267
Length=217

 Score = 35.4 bits (80),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  319  RIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +I+EWL D R H+ +D +LAVVG      S+F    AQQF
Sbjct  104  KIKEWLQDLRHHVADDIVLAVVGNKCDVASSFNFAKAQQF  143

>PYIR_23360
Length=227

 Score = 35.4 bits (80),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (3%)

Query  319  RIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +++EWL D R H+G+D +LA+VG      S+F    AQQF
Sbjct  109  KVKEWLQDLRHHVGDDIVLAIVGNKCDVASSFNFAKAQQF  148

>PITG_15525
Length=224

 Score = 35.0 bits (79),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  316  ALTRIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +  +I+EWL D + H+G+D +LAVVG      S F    AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVTSNFDFAKAQQF  141

>PHALS_00054
Length=224

 Score = 35.0 bits (79),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  316  ALTRIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +  +I+EWL D + H+G+D +LAVVG      S F  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSDFDFSKAQQF  141

>PHYCA_571841
Length=241

 Score = 35.0 bits (79),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  316  ALTRIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +  +I+EWL D + H+G+D +LAVVG      S F  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSDFDFSKAQQF  141

>PPTG_07025
Length=224

 Score = 34.7 bits (78),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  316  ALTRIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +  +I+EWL D + H+G+D +LAVVG      S F    AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVTSNFDFAKAQQF  141

>PHYRA_82858
Length=224

 Score = 34.7 bits (78),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  316  ALTRIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +  +I+EWL D + H+G+D +LAVVG      S F    AQQF
Sbjct  99   SFDKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSDFDFAKAQQF  141

>CCI10175
Length=222

 Score = 34.3 bits (77),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 23/40 (58%), Gaps = 1/40 (3%)

Query  319  RIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +I EWL D R H+ ND +LAVVG      S F  + AQ F
Sbjct  102  KIIEWLQDLRHHVSNDIVLAVVGNKSDCASQFDFSKAQAF  141

>PYAR_20277
Length=216

 Score = 33.1 bits (74),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 1/40 (3%)

Query  319  RIQEWL-DARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            +I+EWL D R H+  D +LAVVG      ++F  T A QF
Sbjct  99   KIKEWLHDLRQHVAPDIVLAVVGNKCDCATSFEFTAAMQF  138

>H310_00391
Length=284

 Score = 32.7 bits (73),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query  231  LTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINE  290
            LTRQ  +K+S+     L  P     KAP R+   S ++ QL P+ DD  +  +    I E
Sbjct  12   LTRQFASKSSKKANKTLIKPA--NAKAPHRSRGPSHKMNQLLPLVDDGKTYRIVFASILE  69

Query  291  SFPLI  295
              PLI
Sbjct  70   RLPLI  74

>PYIW_17248
Length=252

 Score = 32.3 bits (72),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (59%), Gaps = 0/41 (0%)

Query  317  LTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357
            L  ++ + D R H+G+D +LAVVG      S+F    AQQF
Sbjct  134  LLYLRNFSDLRHHVGDDIVLAVVGNKCDCNSSFNFAKAQQF  174

Lambda      K        H        a         alpha
   0.317    0.132    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 58047383754

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40