Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_071041475872170833340.0
PHYCA_5114151475874473023520.0
PPTG_171291475874566923220.0
PHYSO_3489031475876668222470.0
PITG_184581475874766922440.0
PHYRA_810981475874165822050.0
PHYKE_839514758142066620980.0
PHALS_064761475872666619670.0
PYU1_G0017331475873269114650.0
PYIW_199691475873369214610.0
PYIR_134181475874767014380.0
PYAP_177631475879453413466e-175
PYAR_135711475866651412347e-160
PYVX_235901475868968510871e-137
CCI44111147585765318716e-107
CCA22843147585865348342e-101
SPRG_06355147587135796693e-76
SDRG_01763147587365836549e-74
H310_082921382110072281821e-12
SDRG_045751382110032281775e-12
PYIR_141071382111765161695e-11
SPRG_126211382110032301686e-11
PYVX_215131382114463761633e-10
SDRG_079831335559911731571e-09
SPRG_1903013355510001731571e-09
H257_117731382110262291552e-09
PYAP_222301382111164741543e-09
H257_0193413355510221701453e-08
PYAR_14788138217953671443e-08
PYU1_G002110138219992601382e-07
PHYSO_4705331382110843691382e-07
PYIW_157171382111213401292e-06
PITG_172501382110463171283e-06
PPTG_113651382111063211151e-04
PITG_065805521121478840.51
SDRG_0175812524016956781.0
PPTG_13828551795878811.2
PPTG_138275521121278811.3
H310_11637143986904149792.2
PHYRA_795195521124078792.3
PYIR_229641236497578782.4
PHYSO_560296134114481134772.7
PYIW_186161236488578773.4
SPRG_06059125109131265773.5
PYIW_178721043218105744.4
PHYRA_814571086060297764.6
PITG_07984666360953746.4
PHYRA_8106615572586110746.4
PHYCA_5345035521108978747.4
PYU1_G0137111043472113738.6
SDRG_12763125109131765748.7
PHYSO_34623785467526127739.1
PYVX_151776552790116739.5
PYIR_133581043469104739.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_07104

Length=721
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP_07104                                                            1288       0.0   
PHYCA_511415                                                          910        0.0   
PPTG_17129                                                            899        0.0   
PHYSO_348903                                                          870        0.0   
PITG_18458                                                            868        0.0   
PHYRA_81098                                                           853        0.0   
PHYKE_8395                                                            812        0.0   
PHALS_06476                                                           762        0.0   
PYU1_G001733                                                          568        0.0   
PYIW_19969                                                            567        0.0   
PYIR_13418                                                            558        0.0   
PYAP_17763                                                            523        6e-175
PYAR_13571                                                            479        7e-160
PYVX_23590                                                            423        1e-137
CCI44111                                                              340        6e-107
CCA22843                                                              325        2e-101
SPRG_06355                                                            262        3e-76 
SDRG_01763                                                            256        9e-74 
H310_08292                                                            74.7       1e-12 
SDRG_04575                                                            72.8       5e-12 
PYIR_14107                                                            69.7       5e-11 
SPRG_12621                                                            69.3       6e-11 
PYVX_21513                                                            67.4       3e-10 
SDRG_07983                                                            65.1       1e-09 
SPRG_19030                                                            65.1       1e-09 
H257_11773                                                            64.3       2e-09 
PYAP_22230                                                            63.9       3e-09 
H257_01934                                                            60.5       3e-08 
PYAR_14788                                                            60.1       3e-08 
PYU1_G002110                                                          57.8       2e-07 
PHYSO_470533                                                          57.8       2e-07 
PYIW_15717                                                            54.3       2e-06 
PITG_17250                                                            53.9       3e-06 
PPTG_11365                                                            48.9       1e-04 
PITG_06580                                                            37.0       0.51  
SDRG_01758                                                            34.7       1.0   
PPTG_13828                                                            35.8       1.2   
PPTG_13827                                                            35.8       1.3   
H310_11637                                                            35.0       2.2   
PHYRA_79519                                                           35.0       2.3   
PYIR_22964                                                            34.7       2.4   
PHYSO_560296                                                          34.3       2.7   
PYIW_18616                                                            34.3       3.4   
SPRG_06059                                                            34.3       3.5   
PYIW_17872                                                            33.1       4.4   
PHYRA_81457                                                           33.9       4.6   
PITG_07984                                                            33.1       6.4   
PHYRA_81066                                                           33.1       6.4   
PHYCA_534503                                                          33.1       7.4   
PYU1_G013711                                                          32.7       8.6   
SDRG_12763                                                            33.1       8.7   
PHYSO_346237                                                          32.7       9.1   
PYVX_15177                                                            32.7       9.5   
PYIR_13358                                                            32.7       9.7   

>HYAP_07104
Length=721

 Score = 1288 bits (3334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/708 (100%), Positives = 708/708 (100%), Gaps = 0/708 (0%)

Query  14   DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS  73
            DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS
Sbjct  14   DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS  73

Query  74   TEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSVNltsthhhlttstsmm  133
            TEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFSDHATSISSVNLTSTHHHLTTSTSMM
Sbjct  74   TEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFSDHATSISSVNLTSTHHHLTTSTSMM  133

Query  134  shPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT  193
            SHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT
Sbjct  134  SHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT  193

Query  194  GTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPA  253
            GTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPA
Sbjct  194  GTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPA  253

Query  254  ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAE  313
            ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAE
Sbjct  254  ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAE  313

Query  314  EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVL  373
            EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVL
Sbjct  314  EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVL  373

Query  374  LSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDG  433
            LSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDG
Sbjct  374  LSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDG  433

Query  434  IDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAF  493
            IDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAF
Sbjct  434  IDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAF  493

Query  494  VADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAID  553
            VADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAID
Sbjct  494  VADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAID  553

Query  554  VLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFr  613
            VLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFR
Sbjct  554  VLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFR  613

Query  614  lttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMR  673
            LTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMR
Sbjct  614  LTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMR  673

Query  674  RasasassgqltssgssngsapgrsQSPQKVQTESDCQPVSILKRGRM  721
            RASASASSGQLTSSGSSNGSAPGRSQSPQKVQTESDCQPVSILKRGRM
Sbjct  674  RASASASSGQLTSSGSSNGSAPGRSQSPQKVQTESDCQPVSILKRGRM  721

>PHYCA_511415
Length=744

 Score = 910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/730 (67%), Positives = 571/730 (78%), Gaps = 24/730 (3%)

Query  14   DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGP--PQY  71
            +G W LDEDS+RLKQ QD  VR DRS TL DTVN TDDVEEMFY     RST     PQY
Sbjct  17   EGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFYGRNTNRSTTASEMPQY  76

Query  72   RSTEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSV---Nltsthhhltt  128
            R+TEQ+ G  LTL++L+E+A TPS  + +SS     +   ++ ++    N+ +  +H  +
Sbjct  77   RTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQFSATTPSNYAASTPGNVGNNTYHGFS  136

Query  129  stsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGA  188
            S    +    V     ELE+LR E++EVK+EV AIR+ V+NELHVTRYDVLKEL LLKGA
Sbjct  137  SALNTAGTSRVISEDFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGA  196

Query  189  IAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYK  248
            IAQLT      ++    S + S S+PLS+ +R ALTRQTST TS+ATRDRLAASR+N +K
Sbjct  197  IAQLTAA--QHSSPSVSSTESSSSDPLSAEERAALTRQTSTKTSAATRDRLAASRLNVHK  254

Query  249  PPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWA  308
             PPPAARASVRLTQLAPVAD+ALSTPLSS Q+N++FPLIDFT++LAAHAR LTPGSRTWA
Sbjct  255  TPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWA  314

Query  309  LTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSS  368
            LTR EEWL++RF  G D LLAVVGEGG+GKSAF GTVAQQ+RG L+AAHCCQFDRK KSS
Sbjct  315  LTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSS  374

Query  369  PRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAF  428
            PRNVLLS+VHQLV NLPLFKNQLARLNLKYVLEEADP+LLA KVLVDPLNA+E+PV   F
Sbjct  375  PRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATF  434

Query  429  MLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSA  488
            MLVDGIDQC+ GP GRNELL+F AQ+IPQLPSW+G ++SSKPSSKLAKRLPVSSVLDFSA
Sbjct  435  MLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSA  494

Query  489  KNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSK  546
            KN AFVADVSSLVD+IA +F  +D  EAK+VLKHKSGGNFAYLEFTKQALS  GM + SK
Sbjct  495  KNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSK  554

Query  547  EGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEE  606
            EG V + VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL +GA +GPYSPVTEE
Sbjct  555  EGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEE  614

Query  607  QAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDAL  666
            QA+EHF+LT EDLR+LRRSFVDLVAVKHG YRIE+SALCAWL DPAR+EEQFYF+IDDAL
Sbjct  615  QAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFSIDDAL  674

Query  667  QALRKMRRasasassgqltssgssngsapgrsQSPQKVQTESDCQ---------------  711
             ALRKMRR  +S+      SS  S+ +    S++  +V   S  Q               
Sbjct  675  HALRKMRRNVSSSGHSHSGSSSDSSATHHTSSRASSRVTASSKSQQRSHTRHEPRTNPGK  734

Query  712  PVSILKRGRM  721
            PV ILKRG++
Sbjct  735  PVGILKRGKL  744

>PPTG_17129
Length=745

 Score = 899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/669 (71%), Positives = 548/669 (82%), Gaps = 12/669 (2%)

Query  14   DGTWDLDEDSMRLKQNQDH-VVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYR  72
            +G W LDEDS+RLKQ QD   VR DRS TL DTVN TDDVEEMFY  + + +++  PQYR
Sbjct  21   EGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYGRSTSNTSSDMPQYR  80

Query  73   STEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSV---Nltsthhhltts  129
            +TEQ+    +TL++L+ED E  +  + +SS     +   ++ ++    N +ST+H   T 
Sbjct  81   TTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPSNYAASTPGNFSSTYHGFNTV  140

Query  130  tsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAI  189
             S     RAV G   ELE+LR E++EVK+EV AIR+ V+NELHVTRYDVLKELALLKGAI
Sbjct  141  HSTTGTSRAVSG-DFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAI  199

Query  190  AQLTGT--FPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTY  247
            AQLT T    PP+ S   S + S S+PLS+ +R ALTRQTST TS ATRDRLAASR N +
Sbjct  200  AQLTATQHSAPPSVS---STESSSSDPLSAEERAALTRQTSTKTSQATRDRLAASRTNIH  256

Query  248  KPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTW  307
            K PPPAARASVRLTQLAPVAD+ALSTPLS  Q+N++FPLIDFT+ELAAHAR LTPG+RTW
Sbjct  257  KTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTW  316

Query  308  ALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKS  367
            ALTR EEWL++RF  G D LLAVVGEGG+GKSAFCGTVAQQ+RG L+AAHCCQFDRK KS
Sbjct  317  ALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKS  376

Query  368  SPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVA  427
            SPRNVLLS+VHQLV NLP FKNQLARLNLKYVLEEADP LLA KVLVDPLNA+E+P+   
Sbjct  377  SPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHAT  436

Query  428  FMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFS  487
            FMLVDGIDQC  G  GRNELLEF AQ+IPQLPSW+G ++SSKPSSKLAKRLPVSSVLDFS
Sbjct  437  FMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFS  496

Query  488  AKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVS  545
            AKN AFVADVSS+VD+IA +F  +D  EAK+VLK KSGGNFAYLEFTKQALS  GMA+ S
Sbjct  497  AKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAAS  556

Query  546  KEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTE  605
            KEG V ++VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL +GA AGPYSP+TE
Sbjct  557  KEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTE  616

Query  606  EQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDA  665
            EQA+EHF+ T EDLR+LRRSFVDLVAVKHG YRIE+SALCAWL DPAR+EEQFYF+IDDA
Sbjct  617  EQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDA  676

Query  666  LQALRKMRR  674
            LQALRKMRR
Sbjct  677  LQALRKMRR  685

>PHYSO_348903
Length=766

 Score = 870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/682 (69%), Positives = 544/682 (80%), Gaps = 23/682 (3%)

Query  14   DGTWDLDEDSMRLKQNQDHV-VRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGP----  68
            D  W LDEDS+RLKQ QD   VR DRSGTL+DTVN TDDVE+MFY     RST       
Sbjct  24   DAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVEDMFYGRNN-RSTASAASDV  82

Query  69   PQYRSTEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSVNl---------  119
            PQYR+TEQL    LTL++L+EDAETPS  +N SSSFSQFS    S  + +          
Sbjct  83   PQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPGNFSNHNG  142

Query  120  --tsthhhlttstsmmshPRAVGGA---SSELEQLRFELIEVKQEVAAIRQHVVNELHVT  174
               +T+   T +    + P  VG A     ELE+LR E++EVK+EV AIR+ V+NELHVT
Sbjct  143  QNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAEVLEVKEEVKAIRREVMNELHVT  202

Query  175  RYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSA  234
            RYDVLKELALLKGA+AQLT        SV  +   S+ +PLS+ DR  L RQTST TS A
Sbjct  203  RYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSL-DPLSADDRAKLVRQTSTKTSPA  261

Query  235  TRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELA  294
            TR+RLAASR N  K PPP ARASVRLTQLAPVAD ALSTPL+S Q+N++FPLIDFT+ELA
Sbjct  262  TRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELA  321

Query  295  AHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLV  354
            AHAR LTPGSRTWALTR EEWL+SRF  G D LLAVVGEGG+GKSAFCGTVAQQ+RG ++
Sbjct  322  AHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNML  381

Query  355  AAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLV  414
            AAHCCQFDRK KS+PRNVLLS+VHQ+V N P FKNQLARLNLKYVLEEADP+LLA+KVLV
Sbjct  382  AAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLV  441

Query  415  DPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKL  474
            DPLNALE+PV  AFM+VDGIDQC  G  GRNELLEF AQ+IPQLP+W+G ++SSKPSSKL
Sbjct  442  DPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFLLSSKPSSKL  501

Query  475  AKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFT  534
            AKRLPVSSVLDFSA+N+AFVADV+ LV++IA +F  +D  +AK +LK KSGGNFAYLEFT
Sbjct  502  AKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFT  561

Query  535  KQALS--GMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLA  592
            KQALS  GMA+ SKEG V + VL +LPETLYDIYAEIFEDKFG GRARVW KA+ +LQL 
Sbjct  562  KQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  621

Query  593  IGATAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPA  652
            +GA +GPYSPVTEEQA+EHF LT EDLR+LRRSFVDLVAV+HG YRIE+SALCAWL DPA
Sbjct  622  VGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPA  681

Query  653  RAEEQFYFNIDDALQALRKMRR  674
            R+EEQFYF+IDDALQALR+MRR
Sbjct  682  RSEEQFYFSIDDALQALRQMRR  703

>PITG_18458
Length=747

 Score = 868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/669 (70%), Positives = 538/669 (80%), Gaps = 12/669 (2%)

Query  14   DGTWDLDEDSMRLKQNQDH-VVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYR  72
            +G W LDEDS+RLKQ QD   VR DRS TL DTVN TDDVEEMFY  + + +++  PQYR
Sbjct  17   EGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYGRSTSNTSSDMPQYR  76

Query  73   STEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSV---Nltsthhhltts  129
            +TEQL G  +TL++L+ED E  +  + +SS     +   ++ ++      TSTH  L T+
Sbjct  77   TTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFSATTPSNYAASTPGKFTSTHQGLNTA  136

Query  130  tsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAI  189
             +     RAV G   ELE+LR E++EVK+EV AIR+ V+NELHVTRYDVLKELALLKGAI
Sbjct  137  QTTTGMSRAVSG-DFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAI  195

Query  190  AQLTGT--FPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTY  247
            AQLT T    P + S   S         S  +R ALTRQTST TS ATRDRLAASR N +
Sbjct  196  AQLTATQHIAPASVSSTESSSSDPL---SPDERAALTRQTSTKTSQATRDRLAASRTNIH  252

Query  248  KPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTW  307
            K PPPAARASVRLTQLAPVAD+ALSTPL+  Q+N++FPLID T+ELAAHAR LTPG+RTW
Sbjct  253  KTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTW  312

Query  308  ALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKS  367
            ALTR EEWL++R+  G D LLAVVGEGG+GKS FCGTVAQQ+RG L+AAHCCQFDRK KS
Sbjct  313  ALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKS  372

Query  368  SPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVA  427
            SPRNVLLS+VHQLV +LP FKNQLARLNLKYVLEEADP LLA KVLVDPLNA+E+P+   
Sbjct  373  SPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHAT  432

Query  428  FMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFS  487
            F+LVDGIDQC VG  GRNELLE  AQ+IPQLPSW+G +VSSKPSSKLAKRLPVSSVLDFS
Sbjct  433  FILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFS  492

Query  488  AKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVS  545
            AKN AFVAD SSLVD+IA +F  +D  EAK+VLK KSGGNFAYLEFTKQALS  G+A+ S
Sbjct  493  AKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAAS  552

Query  546  KEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTE  605
            KEG V ++VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL +GA AGPYSPVTE
Sbjct  553  KEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTE  612

Query  606  EQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDA  665
            EQA+EHF LTTEDLR+LRRSFVDLV+VKHG YRIE+SALCAWL DPAR+EEQFYF++DDA
Sbjct  613  EQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPARSEEQFYFSVDDA  672

Query  666  LQALRKMRR  674
            L ALRK+RR
Sbjct  673  LLALRKIRR  681

>PHYRA_81098
Length=741

 Score = 853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/658 (71%), Positives = 530/658 (81%), Gaps = 6/658 (1%)

Query  14   DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS  73
            D  W LDEDS+RLKQ QD  +RLDRS TLTDTVN TDDVEEMFY    T S    PQYR+
Sbjct  18   DANWALDEDSLRLKQTQDDALRLDRSTTLTDTVNVTDDVEEMFYGGRSTVS--DVPQYRT  75

Query  74   TEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSVNltsthhhlttstsmm  133
            TEQL G  +TL++L+EDAE  S  S++ S FS  +    + S+             ++  
Sbjct  76   TEQLRGTHMTLSALHEDAEA-SNASSSFSQFSATTPSNYAASTPGHVPNQGAYHDFSTAH  134

Query  134  shPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT  193
            S  RA+  A  ELE+LR E++EVK+EV AIR+ V+NELHVTRYDVLKELALLKGAIAQL 
Sbjct  135  STTRAISDAF-ELERLRSEVVEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLA  193

Query  194  GTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPA  253
             T      +   S + S S+PLS+ +R ALTRQTST TSSATR+RLAASR N +K PPPA
Sbjct  194  ATQHLSPAASVSSTESSSSDPLSADERAALTRQTSTKTSSATRERLAASRANIHKTPPPA  253

Query  254  ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAE  313
            ARASVRLTQLAPVAD+ALSTPL+  Q+ND+FPLIDFT+ELAAHAR LTPGSRTWALTR E
Sbjct  254  ARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRVE  313

Query  314  EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVL  373
            EWL++RF  G D LLAVVGEGG+GKSAF GTVAQQ+RG L+AAHCCQFDRK KSSPRNVL
Sbjct  314  EWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVL  373

Query  374  LSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDG  433
            LS+VHQLV +LP FKNQLARLNLKYVLEEADP +LA KVLVDPLNA+E+P+   FMLVDG
Sbjct  374  LSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHATFMLVDG  433

Query  434  IDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAF  493
            IDQC+ GP GRNELLEF AQ+IP LPSW+G +VSSKPSSKLAKRLPVSSVLDFSAKN AF
Sbjct  434  IDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAF  493

Query  494  VADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSKEGVVA  551
            V+DVSSLV+++A +F   D  EAK+VLK KSGGNFAYLEFTKQALS  GMA+ SKEG V 
Sbjct  494  VSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVP  553

Query  552  IDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEH  611
            + VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL +GA AGPYS VTEEQA++H
Sbjct  554  LSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKH  613

Query  612  FrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQAL  669
            F LT EDLR+LR SFVDLVAV+HG YRIE+SALC WL DPAR+EEQFYF IDDA+QAL
Sbjct  614  FNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQFYFAIDDAIQAL  671

>PHYKE_8395
Length=1420

 Score = 812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/666 (64%), Positives = 518/666 (78%), Gaps = 11/666 (2%)

Query  14    DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRS----TNGPP  69
             +G W LDEDS+RL + Q    R DR+  +TDTVN +DDVE+MFY  + T+S    T+  P
Sbjct  687   EGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVNVSDDVEDMFYGRSTTQSQLSNTSDVP  746

Query  70    QYRSTEQLPGRLLTLTSLNED-AETPsggsnasssfsqfsdhatsISSVNltsthhhltt  128
              YR+TEQ+ G   TLT+L+E+ A TPS    ++S  S ++    +  +    +  +   +
Sbjct  747   SYRTTEQMRGTNSTLTALHEEEAMTPSASHLSNSFASSYASTPGNYQNPPTFNGFNTTHS  806

Query  129   stsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGA  188
             +    +        ++E+ +LR EL EVK EV  IR+ V+NELH+TRYDVLKEL LLKGA
Sbjct  807   TGLSRTISEDTYN-NNEVSRLRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGA  865

Query  189   IAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYK  248
             +AQL+      TT        S S+PLS+ DR ALTR  S +TS  T+DRLA SRVN + 
Sbjct  866   VAQLSAA---QTTGSVSPSTSSSSDPLSAEDRAALTRVPSKLTSKTTKDRLAKSRVNIHT  922

Query  249   PPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWA  308
              PPPAARASVRLTQLAPVAD+ALSTPL+  Q+N++FPLIDFT+ELAAHAR L PG+RTWA
Sbjct  923   VPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWA  982

Query  309   LTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSS  368
             LTR EEWL++RF  G D +LAVVG+GG+GKSAFCGTVAQQ+RG L+AAHCCQFDRK KS+
Sbjct  983   LTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKST  1042

Query  369   PRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAF  428
             PRNVLLS VHQLV NLP FKNQLARLNLKYVLEE+DP LLA+KV VDPLNA+E+P+   F
Sbjct  1043  PRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATF  1102

Query  429   MLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSA  488
             MLV+G+DQC+ GP GRNELLEFL+Q+IPQLPSW+G ++SSKP SK AKRLPVSSVLDFSA
Sbjct  1103  MLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSA  1162

Query  489   KNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSK  546
             KN AFV+DVSSLVD+IA +F  ED  EAK VLK KSGGNFAYLEFTKQALS  GMA  SK
Sbjct  1163  KNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASK  1222

Query  547   EGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEE  606
             EG V ++VL +LP++L+DIY EIFEDKFG GRAR+W+KA+ +LQL +GA AGPYSPVTE 
Sbjct  1223  EGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEG  1282

Query  607   QAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDAL  666
             QA+EHF  TTEDLR+LRRSFVDLV VKHG YR+E+SALC+WL DPAR+EEQFY ++DDAL
Sbjct  1283  QAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDAL  1342

Query  667   QALRKM  672
              ALRK+
Sbjct  1343  TALRKL  1348

>PHALS_06476
Length=726

 Score = 762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/666 (65%), Positives = 506/666 (76%), Gaps = 29/666 (4%)

Query  14   DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS  73
            +  ++L++DS+R K  QD  VR+DRS TLTDTVN TDDVEEMFY+  ++ +T+G PQYR+
Sbjct  21   ESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVEEMFYN--RSTATSGIPQYRT  78

Query  74   TEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSV----Nltsthhhltts  129
            TEQ+ G  L L +L+ED ET S  S+ASSSFSQFS    S  +     N    HH  +T 
Sbjct  79   TEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTPSSYAASTPGNHAGIHHDFSTM  138

Query  130  tsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAI  189
             +  S   A+ G   +LE+L  E++++K EV  IR+ V+NELHVTRYDVLKEL LLKGAI
Sbjct  139  YNTTSTLPAISG-DFDLERLHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAI  197

Query  190  AQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKP  249
            AQL  T    ++S   S   S S+PLSS +R ALTRQT T TS ATRDRLAA R+NT K 
Sbjct  198  AQLASTKSLNSSSSVSSTDSSSSDPLSSDERAALTRQTPTKTSQATRDRLAAPRINTNKA  257

Query  250  PPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWAL  309
            PP A RAS RLTQLAPVAD ALSTPL+S Q+N+ FPLIDFT+ELAAHAR LTPGSR+WAL
Sbjct  258  PPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWAL  317

Query  310  TRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSP  369
            TR +EWL++RF  G D LLAVVGEGGSGKSAFCGTVAQQ+RG L+AAHCCQFDRK KS P
Sbjct  318  TRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRP  377

Query  370  RNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFM  429
            RNVLLS+VHQLV NLPLFKNQLARLNL+YVLEE DP LLA+KVL+DPLNALE+P    F+
Sbjct  378  RNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFI  437

Query  430  LVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAK  489
            L+DGIDQC  G  GRNELLEF++Q+I  LPSW+G +VSSKPSSKLAK LPVSSVLDFSAK
Sbjct  438  LIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAK  497

Query  490  NEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSKE  547
            N AFVAD SSLV++I+ +F  +D  EAK +L  KSGGNFAYLEFTKQALS  GMA  S  
Sbjct  498  NGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTN  557

Query  548  GVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQ  607
            GVV + VLRELPETLYDIYAEIFEDKFG G AR W KA+ +LQL +GA AGPYS VTEEQ
Sbjct  558  GVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQ  617

Query  608  AQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQ  667
            A++   L  +DLR+LRRSFVD+VAVKH                    EEQFYF+I+DAL 
Sbjct  618  AKKQLDLNADDLRMLRRSFVDIVAVKH--------------------EEQFYFSIEDALL  657

Query  668  ALRKMR  673
            ALRKMR
Sbjct  658  ALRKMR  663

>PYU1_G001733
Length=732

 Score = 568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/691 (45%), Positives = 427/691 (62%), Gaps = 81/691 (12%)

Query  20   DEDSMRL-KQNQDHVVRLDRSGTLTDTVNE------TDDVEEMFY---------------  57
            DED++R+ K   +   R  R+ T+  +         +DDVE+MFY               
Sbjct  32   DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNGGGGITRSTSDYTT  91

Query  58   --SSTQTRSTNGPPQ---------YRSTEQLPGRLLTLTSLNEDAETPsggsnasssfsq  106
              +++  R  NG  +         YR+TEQL  R   L  LNED   P+     +     
Sbjct  92   GRTTSSMRDANGMNRSTSLRVTDVYRTTEQL--RNTNLMPLNEDEVLPAAMRTTTG----  145

Query  107  fsdhatsISSVNltsthhhlttstsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQH  166
                                           A GG  SE + LR EL+E+KQE+  IR+ 
Sbjct  146  -------------------------------AAGG--SEADALRAELVEMKQEMQTIRRE  172

Query  167  VVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNP---LSSADRGAL  223
            ++NE+HVTRYDVLKE+ +LKG I QL       +  V       V+ P   LS A    +
Sbjct  173  MMNEMHVTRYDVLKEITMLKGTIIQLVAALE--SKGVRTLDAGGVAEPQPELSPAQLDTI  230

Query  224  TRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDL  283
            TR T+  TS AT+DRLAA  V     P      + RLTQLAPVAD ALSTPL   Q++D+
Sbjct  231  TRTTAVHTSKATKDRLAAREVTAI--PTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDM  288

Query  284  FPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCG  343
            FPL+DF+ +L  HA++  P SR WA  R ++W++SRF  G D LLA+VG+GGSGKS   G
Sbjct  289  FPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVG  348

Query  344  TVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEA  403
             +  ++   +VA H C+FDRK KSSPRNVLLS+V+QL+ NLPLFKNQLARLNLKYVLEE 
Sbjct  349  ALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET  408

Query  404  DPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLG  463
            DP++LA KVLVDPL ALE+P+    +LVDGIDQC      RN+LL+FLA +IP+ P+WLG
Sbjct  409  DPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRNDLLDFLAAIIPEFPTWLG  466

Query  464  VIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHK  523
            + ++SKPS +L  +L ++S+LDFS KN  ++ D   L+++I  +F  +DV EA+++LK K
Sbjct  467  IFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRK  526

Query  524  SGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWS  583
            SGGNF +L+FTKQALS      + G V +DVL +LPE++Y+IY EIFEDKFG G  R+W 
Sbjct  527  SGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWK  586

Query  584  KAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSA  643
            K + +L L + A +GPY+ +TEEQAQE F L+ +D+R++RR+F D++ V+HG YR+E SA
Sbjct  587  KVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSA  646

Query  644  LCAWLCDPARAEEQFYFNIDDALQALRKMRR  674
            +  WL DP R+ EQFY NI  ++  LR++ R
Sbjct  647  MYEWLVDPQRSGEQFYVNISASMDILRRLHR  677

>PYIW_19969
Length=733

 Score = 567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/692 (46%), Positives = 433/692 (63%), Gaps = 83/692 (12%)

Query  20   DEDSMRL-KQNQDHVVRLDRSGTLTDTVNET------DDVEEMFY---------------  57
            DEDS+R+ K  Q+   R  R+ T+  +   +      DDVE+MFY               
Sbjct  32   DEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDMFYNGGDARSTSSSVRST  91

Query  58   -------------SSTQTRSTNGPPQ----YRSTEQLPGRLLTLTSLNEDAETPsggsna  100
                         + T +R+T G  +    YR+TEQL G    L  L ED   P+     
Sbjct  92   DTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRG-TANLIPLQEDEVLPAASRTT  150

Query  101  sssfsqfsdhatsISSVNltsthhhlttstsmmshPRAVGGASSELEQLRFELIEVKQEV  160
            ++S    + + ++ +S                        G  S+L+ LR EL E+K EV
Sbjct  151  TTSQMPTNGNYSNGNS------------------------GGGSQLDALRTELSEMKLEV  186

Query  161  AAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADR  220
             AIR+ ++NE+HVTRYDVLKE+ +LKG I QL                   +  LS+ + 
Sbjct  187  QAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALE--------------TKGLSTDEI  232

Query  221  GALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQM  280
              ++R T+  TS AT+DR A    ++    P   RAS RLTQLAPVAD ALSTPL   Q+
Sbjct  233  NTISRTTALFTSKATKDRRATRDESS---SPMLVRASSRLTQLAPVADEALSTPLLQHQI  289

Query  281  NDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSA  340
            +++FPLI+ + EL A +R     SR WA+ R +EW++SRF  G+D LLA+VGEGGSGKS 
Sbjct  290  DEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKST  349

Query  341  FCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVL  400
              G ++ ++   +VA H C FDRK KSSPRNVLLS+V+Q++ NLPLFKNQLARLNLKYVL
Sbjct  350  LAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVL  409

Query  401  EEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPS  460
            EE+DPV+LA K+LVDPL ALE+P+     ++DG+DQC     GRN+LL+FLA +IP+LP+
Sbjct  410  EESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCK--SRGRNDLLDFLAVIIPELPT  467

Query  461  WLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVL  520
            W+GV ++SKPS +L  RL +SS+LDFSAKN  ++ D   ++++I   F  +DV +A+E+L
Sbjct  468  WIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREIL  527

Query  521  KHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRAR  580
            K KSGGNF +L+FTKQALS        G + +DVL +LPE++Y+IY EIFEDKFG GR R
Sbjct  528  KRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRNR  587

Query  581  VWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIE  640
            +W K + +L+L + A +GPY+ +TE QAQE F L+ ED+R +RRSFVD++ V+HG YRIE
Sbjct  588  IWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIE  647

Query  641  NSALCAWLCDPARAEEQFYFNIDDALQALRKM  672
            NSAL  WL DP RA EQFY ++   + ALR++
Sbjct  648  NSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679

>PYIR_13418
Length=747

 Score = 558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/670 (46%), Positives = 430/670 (64%), Gaps = 25/670 (4%)

Query  20   DEDSMRL-KQNQDHVVRLDRSGTLTDTVNE------TDDVEEMFYSSTQTRSTNGPPQYR  72
            DE+++R+ K  Q+   R  R+ T+  +         +DDVEEMFY+ +   + N     R
Sbjct  32   DEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEMFYNGSANGNANPSASAR  91

Query  73   STEQLPGRLLTL------TSLNEDAETPsggsnasssfsqfsdhatsISSVNltsthhhl  126
            ST+   GR  T       T  N +A   +GGS   +   + ++     + + L       
Sbjct  92   STDNF-GRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQMRGTNLMPLQEDEVLP  150

Query  127  ttstsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLK  186
              S +  +   A  G +  ++ LR EL E+K EV AIR+ ++NE+HVTRYDVLKE+ +LK
Sbjct  151  AASRATTTMATASNGGNP-IDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLK  209

Query  187  GAIAQLTGTFPPPTT----SVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAAS  242
            G I QL             +   ++       LSS +   ++R T+  TS AT++R    
Sbjct  210  GTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSDELDTISRTTALYTSKATKER----  265

Query  243  RVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTP  302
            R       P   RAS RLTQLAPVAD ALSTPL   Q++++FPL++ +TEL A A+   P
Sbjct  266  RATREDSAPVLVRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDP  325

Query  303  GSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFD  362
             SR WA+ R +EW++SRF  G+D LLA+VG+GGSGKS   G +  ++   +VA H C FD
Sbjct  326  SSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFD  385

Query  363  RKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALED  422
            RK KSSPRNVLLS+V+QL+ NLPLFKNQLARLNLKYVLEE DP++LA KVLVDPL ALE+
Sbjct  386  RKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEE  445

Query  423  PVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSS  482
            P+     + DGIDQC     GRN+LL+FLA +IP+LP+W+GV ++SKPS +L  +L ++S
Sbjct  446  PLTAKVFVFDGIDQCK--SKGRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITS  503

Query  483  VLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMA  542
            +LDFSAKN  ++ D   L+++I  +F  +DV +A+E+LK KSGGNF +L+FTKQALS   
Sbjct  504  LLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPG  563

Query  543  SVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSP  602
                 G + +DVL +LPE++Y+IY EIFEDKFG GR+R+W K + +L+L + A +GPY+ 
Sbjct  564  MEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYAL  623

Query  603  VTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNI  662
            +TE QAQE F L+ ED+R +RR+FVD++AV HG YRIE SAL  WL DP RA EQFY ++
Sbjct  624  ITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDV  683

Query  663  DDALQALRKM  672
               +  LR++
Sbjct  684  SGGMNLLRQL  693

>PYAP_17763
Length=794

 Score = 523 bits (1346),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 267/534 (50%), Positives = 368/534 (69%), Gaps = 11/534 (2%)

Query  149  LRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT-------GTFPPPTT  201
            LR EL E+KQE+ AI++ ++NE+H+TRYDVLKE+ +LKG I QL        G      T
Sbjct  183  LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242

Query  202  SVPLSIQRS-VSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRL  260
            +  + I     +N LS  ++ AL+R+T+T+ S  T++R+  +R +  + PP     S RL
Sbjct  243  AAAMGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTRED--QIPPVLRSTSSRL  300

Query  261  TQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRF  320
            TQLAPV DSALSTPL   Q++D+FPLIDF+ E+   +R    GSR W   R +EWL+SRF
Sbjct  301  TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  360

Query  321  KAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQL  380
              G D +LA+VG+ GSGK+    +V  +Y  Q+VA H C+FDRK KSSPRNVLLS+V+QL
Sbjct  361  NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420

Query  381  VVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVG  440
              +LP+FK+QLARLNLKYVLEE D   L+ KVL+DPLNALE+P+   F++ D IDQC  G
Sbjct  421  TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480

Query  441  PAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSL  500
              G N+L +FL+ +IP+ P WLG +VSSKPS + A  +PVSSVLDFSA+N  ++ D   L
Sbjct  481  -VGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFL  539

Query  501  VDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPE  560
            +++IA  F   D  EAK++LK KSGGN++YLEFTKQALS        G V +DVL +LP+
Sbjct  540  INDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQ  599

Query  561  TLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedlr  620
            +LY+IY EIFEDKFG GR RVW KA  VLQL   A +GPY+ +TE+   +    T +++R
Sbjct  600  SLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVR  659

Query  621  llrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMRR  674
            +LRR+F+D+++++HG Y I +SA+  WL D  R  EQ++ +++  ++ LRK+ R
Sbjct  660  MLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLR  713

>PYAR_13571
Length=666

 Score = 479 bits (1234),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 245/514 (48%), Positives = 346/514 (67%), Gaps = 49/514 (10%)

Query  162  AIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRG  221
            AIR+ ++NE+H +RYDVLKE+ +LKG I QL  T                          
Sbjct  120  AIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET--------------------------  153

Query  222  ALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARA-SVRLTQLAPVADSALSTPLSSVQM  280
             + R+T+T+ S +T++R+  +R +     PP  RA SVRLTQLAPV DSALSTPL+  Q+
Sbjct  154  -MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQI  209

Query  281  NDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSA  340
            ++LFPL+DF+ E+   AR    G+R WA  R +EWL+SRF  G D LLA+VG+ G+GK+ 
Sbjct  210  DELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-  268

Query  341  FCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVL  400
                            H C+F+RKGKSSPRNVLLSVV+QL   LP FK+QLARLNLKYVL
Sbjct  269  ----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVL  312

Query  401  EEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPS  460
            EE D + LA KVLVDPL +LE+P+   F+L+DG+DQC V   G N+LL+FL+ ++P+ PS
Sbjct  313  EETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPS  371

Query  461  WLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVL  520
            WLG ++++KPS + A+++PV+S+LDFSAKN A+V D + L+ +I   F  ED  +A ++L
Sbjct  372  WLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQIL  431

Query  521  KHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRAR  580
            K KS GN++YLEFT+QA+S     + +G V +DVL +LP++LY+IY EIFEDKFG GR R
Sbjct  432  KTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTR  491

Query  581  VWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIE  640
            +W KA  VLQL   A +GPY+ +TE+   +      +D+R+LRR+F+D+++++HG Y I 
Sbjct  492  LWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIV  551

Query  641  NSALCAWLCDPARAEEQFYFNIDDALQALRKMRR  674
            +SAL  WL DP R  E ++ ++   ++ LR++ R
Sbjct  552  SSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLR  585

>PYVX_23590
Length=689

 Score = 423 bits (1087),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 288/685 (42%), Positives = 384/685 (56%), Gaps = 124/685 (18%)

Query  14   DGTWDLDEDSMRL-KQNQDHVVRLDRSGTLTDTVNETDD-VEEMFYSSTQT---------  62
            DG    D++S+RL +Q  +  +R  R  TL+   +   D VEEMFY              
Sbjct  27   DGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYGGGPGGHAGHGGHA  86

Query  63   ------RSTNGPPQ----YRSTEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhat  112
                  RST G  +    YR+TEQL  R   L  L ED   P                  
Sbjct  87   GHGGADRSTAGSVRTTDVYRTTEQL--RSTGLEPLAEDRVLPPAVP--------------  130

Query  113  sISSVNltsthhhlttstsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELH  172
               SV                S P A G     L  LR EL +V+ E  AIR+ V+NELH
Sbjct  131  -YGSV-------------PHTSGPHADGPGG--LAALRAELADVRAETQAIRREVMNELH  174

Query  173  VTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTS  232
            V RYDVLKE+ +LKGA+AQL     P                    D G+      + TS
Sbjct  175  VLRYDVLKEVTVLKGAVAQLLAALAP-----------------GGGDAGSRPGSAGSATS  217

Query  233  SATRDRLAASRVNTYKPPPPAARASVRLT-QLAPVADSALSTPLSSVQMNDLFPLIDFTT  291
            +AT    +++ ++      PA RA++ +   LAPV D+ALS PL   Q+++LFPL+D +T
Sbjct  218  AATTASSSSAELS------PADRAAIGVAPTLAPVDDAALSAPLRPEQLDELFPLVDAST  271

Query  292  ELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRG  351
            ++AA AR   PG+R WA  R +EWL+SRF  G D LL VVG  G+GKS FCG+V    +G
Sbjct  272  DIAAFARARAPGTRDWATARVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCDMLQG  331

Query  352  QLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASK  411
             ++A H C+FDRK KS+PR VLLS+V Q+V NLP FK QLARLNLKYVLEE D  +LA K
Sbjct  332  NVLATHFCKFDRKAKSTPRVVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFVLAGK  391

Query  412  VLVDPLNALEDPVDVAFMLVDGIDQCNVGPAG--RNELLEFLAQLIPQLPSWLGVIVSSK  469
            VL+DPL A E+P+    +++DG+DQC     G  RNELLEFLA ++PQLPSWLGV+VSSK
Sbjct  392  VLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSK  451

Query  470  PSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFA  529
            P+ +LA +L  +S+LDFS KN+ FV D   LVD+IA +F      EA+ +L+ K+GGNFA
Sbjct  452  PAPELATQLKFTSLLDFSGKNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAGGNFA  511

Query  530  YLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVL  589
            YL+FT+QALS       +G + +D+L +LPE+LY+IY EIFED                 
Sbjct  512  YLDFTRQALSSPG--LDDGELELDMLHDLPESLYEIYLEIFEDN----------------  553

Query  590  QLAIGATAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLC  649
                                       +D+RL++RSFVD++AV+ G YRIE+SAL  WL 
Sbjct  554  ---------------------------DDMRLVKRSFVDIIAVRGGCYRIESSALFEWLS  586

Query  650  DPARAEEQFYFNIDDALQALRKMRR  674
            DPAR+ E F+F+ D  +  LR++++
Sbjct  587  DPARSGESFFFDADAGVDELRRLQQ  611

>CCI44111
Length=576

 Score = 340 bits (871),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 192/531 (36%), Positives = 305/531 (57%), Gaps = 11/531 (2%)

Query  145  ELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVP  204
            ++E  R E+  +++E+  +RQ ++  +  TRYD+LKE+  LKG +A ++     P  +  
Sbjct  52   QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKI  111

Query  205  LSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLA----ASRVNTYKPPPPAARASVRL  260
              +  + +N  S+   GA       +++  T DR       S +          R S  L
Sbjct  112  NKLNHTTANG-SACSEGA--DDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRES-GL  167

Query  261  TQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRF  320
              L  + ++ LS PLS  +++++FPLID + ++ ++A +L  G+R WAL    +W++S F
Sbjct  168  PTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNF  227

Query  321  KAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQL  380
            + G + +L +VGEGG+GKS   G V Q++   L A H  QFDRK  SS R+V+LS+V Q 
Sbjct  228  ENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQF  287

Query  381  VVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNAL-EDPVDVAFMLVDGIDQCNV  439
               L L+K QL RLNL+Y+L E++P+++A+K+L+DPL A+ E      F+L DGIDQC V
Sbjct  288  ASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLV  347

Query  440  GPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSS  499
                 N+LLE L+ +  + PSW+G +V+SK     A RL  +SV+     N  F+ D   
Sbjct  348  KNQS-NDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRI  406

Query  500  LVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELP  559
            L++ +  +F+ +   EA ++L  KSGGN  YL+F  +ALS      ++  +++DVL ELP
Sbjct  407  LMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELP  466

Query  560  ETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedl  619
            E++ +I   IF+DKFG G  RVW  A+ +L++ + A AGPY  V E Q ++ F L   + 
Sbjct  467  ESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEW  526

Query  620  rllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALR  670
            R++ R+F D++      YRI NS+L  WL    R+ + F+ N     + LR
Sbjct  527  RMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576

>CCA22843
Length=586

 Score = 325 bits (834),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 183/534 (34%), Positives = 305/534 (57%), Gaps = 30/534 (6%)

Query  144  SELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQL-----------  192
            ++ E +R E+ +++ E+ ++RQ ++  +  TRYD++KE+  L+G +  +           
Sbjct  58   NQFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKS  117

Query  193  --TGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPP  250
              TGT    TT+   +   S  +      R     +++ +   + +      R+NT    
Sbjct  118  SPTGTNENHTTANKTAFSESAEDD-EIISRFITPERSTIVADCSYKSGFVTERLNTKDSS  176

Query  251  PPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALT  310
                      +   P+ +S LS PL   + +++FP ID  ++L ++A +L  G+R WAL 
Sbjct  177  ---------FSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALD  227

Query  311  RAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPR  370
            R +EW+ES FK+  D +L ++GEGGSGKS   G + Q++  +L A H CQFDRK +SS R
Sbjct  228  RVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSR  287

Query  371  NVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVA---  427
            +V+LS+V Q     PL+K QL  LNL+Y+L+E++P+++A+K+L++PL A+  PV  +   
Sbjct  288  DVVLSLVSQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRG  345

Query  428  FMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFS  487
            F+L DGIDQC V     N+LL+ ++ +  + PS +G +V+SK S     +    S++   
Sbjct  346  FVLFDGIDQCLVENES-NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLH  404

Query  488  AKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKE  547
             +N  F+ D   L++    +F+ +   EA ++L  KSGGN  YL+FT++ALS      + 
Sbjct  405  ERNGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGER  464

Query  548  GVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQ  607
              +++DVL ELP+++ DI+  IFEDKFG G  RVW   + +L+  + A AG +  V E Q
Sbjct  465  TFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQ  524

Query  608  AQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFN  661
             ++ F+L  E+ R+++RSF D++      YRI  S+L AWL    R+ + FY +
Sbjct  525  IKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYID  577

>SPRG_06355
Length=713

 Score = 262 bits (669),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 184/579 (32%), Positives = 295/579 (51%), Gaps = 92/579 (16%)

Query  155  EVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTF--PPPTTSVPLSIQRSVS  212
            E+K+ V  IR+ V+ ELH T+YD+LKE+ +L+GA+ QL       P   + PL       
Sbjct  148  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPL-------  200

Query  213  NPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPP-----PAA-------------  254
              L + DR       +T++S A  +         ++P P     PAA             
Sbjct  201  --LRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTV  258

Query  255  -----RASVRLTQLA------------------------PVADSALSTPLSSVQMNDLFP  285
                 RAS +L++ +                        P+ D AL+ P  +V +N   P
Sbjct  259  VRESIRASSKLSRESSKLSRESSKISRESSKLFRESTRQPIKDQALTQPWENV-LNQHLP  317

Query  286  LIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTV  345
             ++        A  + P +RTWA+ +  +W +         +L VVG  G+GKS     +
Sbjct  318  FLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHL  373

Query  346  AQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADP  405
               Y  Q++A+H  ++D +  +S   +L+S+ HQ+   LP F+ QL RLNL Y+++E DP
Sbjct  374  VSNYPEQIMASHFVRYDERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDP  431

Query  406  VLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVI  465
            V+LA+K+L++PL ++  P++   +++D +D+    P G N L+  LA +  + PSW+  +
Sbjct  432  VVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTP-GTN-LISLLADVALEFPSWVLFL  489

Query  466  VSSKPSSKLAKRLPVSSVLDFSAKNEAFVAD----VSSLVDEIACHFKHEDVEEAKEVLK  521
            +SS+P   + K LP   VL F  ++  F AD    V SL+D+        D +    +LK
Sbjct  490  LSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGL-----DDKNILFLLK  544

Query  522  HKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARV  581
             KS G+F YL+F  QA + + S    G++      ELP+TLY+IY ++FE+K+G GR RV
Sbjct  545  AKSQGSFLYLQFVDQAFAMIHSEIDAGMIL-----ELPKTLYEIYDQVFEEKYGKGRRRV  599

Query  582  WSKAEQVLQLAIGA-------TAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKH  634
            W K + VL+  +GA        A P+  VTE   Q  F+L   DL L+ RSF D+VAV  
Sbjct  600  WQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIVAVDE  657

Query  635  --GIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRK  671
              G+YR+++  L  +L D +R++E  + N++  +  L K
Sbjct  658  ETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696

>SDRG_01763
Length=736

 Score = 256 bits (654),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 181/583 (31%), Positives = 296/583 (51%), Gaps = 90/583 (15%)

Query  155  EVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNP  214
            E+K+ V  IR+ V+ ELH T+YD+LKE+ +L+GA+ QL       +T       R+V+ P
Sbjct  161  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTP------RAVATP  214

Query  215  L-SSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPP-----PAA--------------  254
            L  + DR       +T++S A  +         ++P P     PAA              
Sbjct  215  LLRTEDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTVF  274

Query  255  ----RASVRLTQLA--------------------------------PVADSALSTPLSSV  278
                RAS +L++ +                                P+ D AL+ P  +V
Sbjct  275  RESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQPWENV  334

Query  279  QMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGK  338
             +N   P ++        A  + P +RTWA+ +  +W +         +L VVG  G+GK
Sbjct  335  -LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGK  389

Query  339  SAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKY  398
            S     +   Y  Q++A+H  ++D +   +P  +L+S+ HQ+   LP ++ QL RLNL Y
Sbjct  390  STLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQISCKLPDYQQQLVRLNLPY  447

Query  399  VLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQL  458
            +++E DP++LA+K+L++PL ++  P++   +++D +D+ +V   G N L+  LA +  + 
Sbjct  448  LIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DVSTPGAN-LISLLADVALEF  505

Query  459  PSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHE-DVEEAK  517
            PSW+  ++SS+    + K LP   VL F  ++  F AD +  V  +    KH  D +   
Sbjct  506  PSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMD--KHGLDDKNIL  563

Query  518  EVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHG  577
             +LK KS G+F YL+F  QA S + S    G++      ELP+TL++IY ++FE+K+G G
Sbjct  564  FLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMIL-----ELPKTLHEIYDQVFEEKYGKG  618

Query  578  RARVWSKAEQVLQLAIGA-------TAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLV  630
            R RVW K + VL+  +GA        A P+  VTE   Q  F+L   DL L+ RSF D+V
Sbjct  619  RRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIV  676

Query  631  AVKH--GIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRK  671
             V    G+YR+++  L  +L D AR++E  + N++  +  L K
Sbjct  677  TVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719

>H310_08292
Length=1007

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 105/228 (46%), Gaps = 14/228 (6%)

Query  255  RASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPG--SRTWALTRA  312
            + +VR+ QL       L       ++  +F    F  E+A    + T G   R W + + 
Sbjct  407  KYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIA----KFTQGFAGREWVMDQL  462

Query  313  EEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNV  372
             +W     KA       V G+ G+GK+A    + Q  + ++ A H    D +   +PR  
Sbjct  463  TQW-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRC  516

Query  373  LLSVVHQLVVNLPLFKNQLARLN-LKYVLEEADPVLLASKVLVDPLNALEDPVDVAF-ML  430
            +LS+ +QL   LP +   L +   L+ ++  +    L + +LV PLNA+  P  V   +L
Sbjct  517  ILSLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVIL  576

Query  431  VDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRL  478
            +DG+D      A  N  +  L  L+ +LPSW+ +I +S+    + ++L
Sbjct  577  LDGLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKL  624

>SDRG_04575
Length=1003

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/228 (27%), Positives = 111/228 (49%), Gaps = 12/228 (5%)

Query  254  ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAE  313
            A+   RL Q+A      L       ++  +F    F  +++ + +      R W L + +
Sbjct  399  AKYPQRLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLD  456

Query  314  EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAH-CCQFDRKGKSSPRNV  372
            +W     K   D +  + G+ G+GKSA    + Q  R ++ A H  C+ D + +S  R  
Sbjct  457  QW-----KQTHDQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSH-RRC  509

Query  373  LLSVVHQLVVNLPLFKNQLARLN-LKYVLEEADPVLLASKVLVDPLNALEDPVDVAF-ML  430
            +LS+ +QL   LP + + L + + L+ V+  +  V L   +LV PL+A+ +P      +L
Sbjct  510  ILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVIL  569

Query  431  VDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRL  478
            +DG+D         N L+  L  L+ +LPSW+ VI++S+    + ++L
Sbjct  570  LDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKL  617

>PYIR_14107
Length=1176

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 109/516 (21%), Positives = 203/516 (39%), Gaps = 92/516 (18%)

Query  203  VPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQ  262
            +PLSI R     +S      L  Q +T  S++    + ++ +N       A R S+R  Q
Sbjct  461  IPLSICRIQWLDMSDC----LIYQANTSESNSNARFVDSATLN-------AVRYSIRKDQ  509

Query  263  LAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKA  322
            L       L       ++  +   + F  +++    R     R W   + E W+ S    
Sbjct  510  LVTALKGKLDHEGQQARLFSILSPLSFQQQISKLTSRF--AGREWLFMQLENWIAS---P  564

Query  323  GMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVV  382
                +  V G+ GSGK+A    + Q    ++ A H    + +   + R  +LS+ +QL  
Sbjct  565  TATQVFWVTGQIGSGKTALAARMVQVI-PEIAAFHFALQEDEQTQNARRCVLSLAYQLTT  623

Query  383  NLPLFKNQL-ARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVA--FMLVDGI-----  434
             LP +   L +R  L+ ++  ++   L +++LV+PLN +  P       +L+DG+     
Sbjct  624  QLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARPQSTKPLVLLIDGLEHLSS  683

Query  435  ---------------------------DQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVS  467
                                       D CN  P+G   L+  L  L+ +LP+W+ V++ 
Sbjct  684  GKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVSALPSLVARLPNWVRVVLL  743

Query  468  SKPSSKLAKRL---PVSSVLDFSAKNEAFVADVSSLVDEI--------------------  504
            S+    +  +L     S VLD S K+E+   D+   V+ +                    
Sbjct  744  SRLDPAIVAKLQGYTPSIVLD-SLKSES-QQDIKRYVENMLGESPATTLRRGIYGSASST  801

Query  505  -ACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLY  563
             A  F ++   E  +++  +S G F Y     Q++       +E  +A+D L  LP  + 
Sbjct  802  GASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI-------EEKRLAVDQLESLPIGMG  854

Query  564  DIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedlrllr  623
              + + F+  F         + +  ++  +      + P +             D + + 
Sbjct  855  GYFRQFFDGHFDE------QQYQDSIRPVLEVLCASFEPFSLWNIVSILNWDVYDQQKIA  908

Query  624  rSFVDLVAV-KHGIYRIENSALCAWLCDPARAEEQF  658
             SF  L+++   G  R  +S++C W+ DPA A + F
Sbjct  909  LSFGSLLSIGADGNIRPFHSSMCDWVQDPATAGKYF  944

>SPRG_12621
Length=1003

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 109/230 (47%), Gaps = 18/230 (8%)

Query  254  ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPG--SRTWALTR  311
            A+   RL Q+A      L       ++  +F    F T       + T G   R W L +
Sbjct  414  AKYPQRLAQIATALRGKLDHDGLQARLFSIFSPFSFQTN------KYTQGFAGREWVLDQ  467

Query  312  AEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAH-CCQFDRKGKSSPR  370
             ++W     K   D +  V G+ G+GKSA    + Q  R ++ A H  C+ D + +S  R
Sbjct  468  LDQW-----KQTHDQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDEQTQSH-R  520

Query  371  NVLLSVVHQLVVNLPLFKNQLARLN-LKYVLEEADPVLLASKVLVDPLNALEDPVDVAF-  428
              +LS+ +QL   LP + + L + + L+ V+  +  V L   +LV PL A+ +P      
Sbjct  521  RCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAEPATTPLV  580

Query  429  MLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRL  478
            +L+DG+D         N L+  L  L+ +LPSW+ VI++S+    + ++L
Sbjct  581  ILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKL  630

>PYVX_21513
Length=1446

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 86/376 (23%), Positives = 146/376 (39%), Gaps = 70/376 (19%)

Query  255  RASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEE  314
            R + R  QLA      L       ++  L     F  +++    R T   R W   R ++
Sbjct  390  RYAARKDQLATALRGQLDHEGQQARLFSLLSPFSFQQQISKLTYRFT--GRDWLFKRVQQ  447

Query  315  WLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLL  374
            W+          +  + G+ GSGK++    + Q +  ++ A H    +       R  +L
Sbjct  448  WINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDDQTHIARRCVL  506

Query  375  SVVHQLVVNLPLFKNQLARLNLKYVLEEADPV----LLASKVLVDPLNALEDPVDVAFML  430
            S+ +QL   LP +      L  +  LEE  PV     L + +LV+PLN ++ P     +L
Sbjct  507  SLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRPAKPLILL  563

Query  431  VDGIDQCNVGPAGRNE----------------LLEFLAQLIPQLPSWLGVIVSSKPSSKL  474
            +DG+ +C V  A  +                 L+  L  L+ +LPSW+ +++ S+    +
Sbjct  564  IDGL-ECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLSREDHDV  622

Query  475  AKRLPV---SSVLD-FSAKNEA----FVADV----SSLVD----------------EIAC  506
              RL     S V+D F+ +NE     FV        SL D                 +A 
Sbjct  623  MTRLQTYIPSVVIDHFAQENECDIKKFVGSALAPKKSLADIVEAATAETSGRSRLTTLAR  682

Query  507  HF--------KHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLREL  558
            H         +     E  E++  ++ G F Y     Q +       +EG VA++ L +L
Sbjct  683  HVSFIRSPRNRPGATTEQIEMIARRAEGLFLYAANIVQGI-------EEGRVALNELDKL  735

Query  559  PETLYDIYAEIFEDKF  574
            P  +     + F+  F
Sbjct  736  PTGMGGCLRQFFDSHF  751

>SDRG_07983
Length=991

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 80/173 (46%), Gaps = 23/173 (13%)

Query  304  SRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDR  363
            +R W L + + W+++        +  + G  GSGKSA    + Q  R ++ A H    + 
Sbjct  441  AREWVLAKYDAWVQT---PNGSRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  496

Query  364  KGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVL----LASKVLVDPLNA  419
                S R  +LS+V+QL   LP + N    +N +  LEE  PV     L   +L+ PL+A
Sbjct  497  DQTQSARRCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVKSLVDLIHALLIAPLSA  553

Query  420  LEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQL---PSWLGVIVSSK  469
            +  P  +  +L+DGID    G         F+A L   +   PSW+  +  ++
Sbjct  554  IAHPASILVLLIDGIDCFEPG---------FVATLTAHMDLWPSWVRFVFGTR  597

>SPRG_19030
Length=1000

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 80/173 (46%), Gaps = 23/173 (13%)

Query  304  SRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDR  363
            +R W L + + W+++        +  V G  GSGKSA    + Q  R ++ A H    + 
Sbjct  449  AREWVLAKYDAWVQT---PNGSRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  504

Query  364  KGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVL----LASKVLVDPLNA  419
                S R  +LS+V+QL   LP + N    LN +  LEE  PV     L   +L+ PL+A
Sbjct  505  DQTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLSA  561

Query  420  LEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQL---PSWLGVIVSSK  469
            +  P  +  +L+DGI+    G         F+A L   +   PSW+  +  ++
Sbjct  562  IAHPASILVLLIDGIECFEPG---------FVATLTAHMDLWPSWVRFVFGTR  605

>H257_11773
Length=1026

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/229 (25%), Positives = 103/229 (45%), Gaps = 15/229 (7%)

Query  255  RASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPG--SRTWALTRA  312
            + +VRL QL       L       ++  +F    F  E++    + T G   R W + + 
Sbjct  422  KYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIS----KFTQGFAGREWVMDQL  477

Query  313  EEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNV  372
             EW     KA       + G+ G+GK+A   +V Q  + ++ A H    + +   + R  
Sbjct  478  TEW-----KASSSQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRC  531

Query  373  LLSVVHQLVVNLPLFKNQLARLN--LKYVLEEADPVLLASKVLVDPLNALEDPVDVAF-M  429
            +LS+ +QL   LP +   L + +  L+ ++  +    L   +LV PLNA+  P  V   +
Sbjct  532  VLSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVI  591

Query  430  LVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRL  478
            L+DG+D      A  N  +  LA  +  LP W+  +++S+    + ++L
Sbjct  592  LIDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKL  640

>PYAP_22230
Length=1116

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 110/474 (23%), Positives = 173/474 (36%), Gaps = 101/474 (21%)

Query  255  RASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEE  314
            R   R  QL       L       ++  L     F  +++   +R T   R W L    +
Sbjct  448  RYETRRDQLVTALKGKLDHDGQQARLFSLLSPFSFQLQISQLTQRFT--GRAWLLESIRQ  505

Query  315  WLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLL  374
            W+ +   +G   +  V G+ GSGK++    + Q    ++ A H    D       R  +L
Sbjct  506  WINTPVTSG-SKVFWVTGQIGSGKTSVAARMVQ-LMPEIAAFHFALQDDDQTQLARRCVL  563

Query  375  SVVHQLVVNLPLFKNQLARLNLKYVLEEADPV----LLASKVLVDPLNALEDPVD--VAF  428
            S+ +QL   LP +      L     LEE  PV     L + +LV+PLNA+  P       
Sbjct  564  SLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAIARPKSDKPVV  620

Query  429  MLVDGIDQ---------------------------------CNVGPAGRNE-LLEFLAQL  454
            +L+DG++                                  C+      +E L+  L  L
Sbjct  621  LLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGSSDECLVSLLPSL  680

Query  455  IPQLPSWLGVIVSSKPSSKLAKRLPV---SSVLD-FSAKNEAFVADVSSLVDEIACH---  507
            I +LP W+ VI+ S+    +  +L V   S  LD    +NE   AD+   V+   C    
Sbjct  681  ISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENE---ADIREFVEMALCSPDP  737

Query  508  --------------FKHED----------------VEEAKEVLKHKSGGNFAYLEFTKQA  537
                           +H                    E  EV+  +S G F Y     QA
Sbjct  738  QSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKISAEQVEVITKRSEGLFLYAANIVQA  797

Query  538  LSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATA  597
            +       +EG +A+D L  LP  L     + FE  F     +  +K   VL++   A  
Sbjct  798  I-------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYK--TKIRPVLEVLCAA--  846

Query  598  GPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIY-RIENSALCAWLCD  650
              Y P+T       F  +T + + +  SF  L+ V    Y R  +S++  W+ D
Sbjct  847  --YEPMTTAMLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSSVLEWVQD  898

>H257_01934
Length=1022

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 80/170 (47%), Gaps = 11/170 (6%)

Query  304  SRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDR  363
             R W L   +EW+ S   +    +  + G  GSGK+A    + Q  R ++VA H    + 
Sbjct  462  GRAWVLHEFDEWVTSP-PSNARRVFLLTGVIGSGKTALAAHIIQN-RPEVVAFHLASHEG  519

Query  364  KGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEE----ADPVLLASKVLVDPLNA  419
            +   + R  +L++V+QL   LP + N L   + K  LEE     +   L  ++L+ PL  
Sbjct  520  EQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEETVFVGNLADLVQELLIAPLER  577

Query  420  LEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSK  469
            +  P     +L+DGI+     P   + L+  L   + + P+W+  + +S+
Sbjct  578  IATPPSTMVILIDGIE---CFPCADDNLVAILTASLNRWPAWMRFVFTSR  624

>PYAR_14788
Length=795

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 88/367 (24%), Positives = 141/367 (38%), Gaps = 66/367 (18%)

Query  330  VVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKN  389
            V G+ G+GK++    + Q    ++ A H    +       R  +LS+ +QL   LP +  
Sbjct  421  VTGQIGAGKTSVAAKMVQTI-PEIAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPAYA-  478

Query  390  QLARLNLKYVLEEADPVL----LASKVLVDPLNALEDPVDVA--FMLVDGIDQCNVGPAG  443
                L     LEE  PV     L + +L+ PLNA+  P       +L+DG++       G
Sbjct  479  --VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGG  536

Query  444  RNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRL----PVSSVLDFSAKNEAFVADVSS  499
                +  L  LI +LPSW+ VI+ S+    +  +L    P  S+     +NE    D+  
Sbjct  537  AGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRREQENE---EDIRG  593

Query  500  LVDEIAC---HFKHEDV--------------------------------EEAKEVLKHKS  524
             V+   C   H KH                                    E  E++  +S
Sbjct  594  FVEAALCSPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSEQVELITKRS  653

Query  525  GGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSK  584
             G F Y     Q++       +EG +++D L  LP  L     + FE  F     +  +K
Sbjct  654  EGLFLYAVNIVQSI-------EEGRLSVDQLASLPLGLGGYLRQFFESHFDDTTYK--TK  704

Query  585  AEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVK-HGIYRIENSA  643
               VL++   A    Y P+T       F  +T D   +  SF  L  +   G  R  +S+
Sbjct  705  IRPVLEVLCAA----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCISDDGYMRPFHSS  760

Query  644  LCAWLCD  650
            +  W+ D
Sbjct  761  VLEWVQD  767

>PYU1_G002110
Length=999

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/260 (25%), Positives = 111/260 (43%), Gaps = 36/260 (14%)

Query  239  LAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHAR  298
            +AAS +N         R S+R  QL       L       +++ +   + F  +++  A 
Sbjct  375  IAASSINE-------VRYSMRKDQLITALQGQLDHEGQQARLHSILAPVPFQQQISKLAS  427

Query  299  RLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHC  358
            R     R W + +  +W++S   + M     V G+ GSGK+A    + Q    ++ A H 
Sbjct  428  RFV--GRKWLIAQLTKWIDSPTASQM---FWVTGQIGSGKTALAARLVQTI-PEIKAFHF  481

Query  359  CQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVL----LASKVLV  414
               + +   + R  +LS+ +QL   L   K+  A L  +  LEE  PV     L + +L+
Sbjct  482  AFEEDEQTQNARRCVLSLAYQLTTQL---KDYAAFLQAREPLEELVPVSTFNELVTHLLI  538

Query  415  DPLN---ALEDPVDVAFMLVDGIDQCNVGPAGRNEL-------------LEFLAQLIPQL  458
             PLN    L+       +L+DG++  + G +  + L             +  L  L+ QL
Sbjct  539  KPLNEIAQLQSQNTPLVLLIDGLENLSDGKSDVSSLPVMTSRQSFAQCLVSALPSLVSQL  598

Query  459  PSWLGVIVSSKPSSKLAKRL  478
            P W+ VIV S+    +  +L
Sbjct  599  PKWVRVIVLSRNDPAINAKL  618

>PHYSO_470533
Length=1084

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 80/369 (22%), Positives = 142/369 (38%), Gaps = 59/369 (16%)

Query  255  RASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEE  314
            R   R  QL    +  L       ++  L    +F  +++    R     R W   R ++
Sbjct  424  RYESRKGQLISALEGTLDHEGQQARLFSLLAPFNFQRQISQLTERFI--GREWLFERFQQ  481

Query  315  WLESRFKAGMDP---------LLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKG  365
            W++                  +  +VG+ GSGK++    + Q    ++ A H  + + + 
Sbjct  482  WVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTC-PEIAAFHFARQEDEQ  540

Query  366  KSSPRNVLLSVVHQLVVNLPLFKNQL-ARLNLKYVLEEADPVLLASKVLVDPLNALEDPV  424
              + R  +LS+ +QL   LP + + L +   L+ ++  A  V L S++L+ PLNA+  P 
Sbjct  541  THNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLIGPLNAIARPT  600

Query  425  DVA--FMLVDGID--------------QCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSS  468
                  +L+DGI+                + G      L+  L  L  +LP W+ V+V S
Sbjct  601  TYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASRLPDWVRVVVLS  660

Query  469  KPS----SKLAKRLPVSSVLD-FSAKN------------------EAFVADVSSLVDEIA  505
            +      SKL    P   ++D F  +N                  E   A  S    ++ 
Sbjct  661  REDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDFAKASEQAVDVP  720

Query  506  CHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDI  565
             +     +E+  E++  +S G F Y     QA++       EG + +  L ELP  +   
Sbjct  721  ANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT-------EGRLRLHELAELPVGMGAY  773

Query  566  YAEIFEDKF  574
              + F   F
Sbjct  774  LQQFFASHF  782

>PYIW_15717
Length=1121

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 75/340 (22%), Positives = 140/340 (41%), Gaps = 58/340 (17%)

Query  203  VPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQ  262
            +PLSI R     +S      L  + S+ T ++ R  + +  +N+        R ++R  Q
Sbjct  436  IPLSICRIQWLDMSDC----LLYEASSSTGASQRRLVDSVTINS-------VRYAIRKEQ  484

Query  263  LAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKA  322
            L       L       ++  +   + F  +++    R     R W   + E W+ S   A
Sbjct  485  LVTALKGKLDHEGQQTRLFSILSPLSFQQQISKLTSRF--AGREWLFAQLESWIASPSAA  542

Query  323  GMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVV  382
                +  V G+ GSGK+A    + Q    ++ A H    + +   + R  +LS+ +QL  
Sbjct  543  ---QVFWVTGQIGSGKTALAARMVQLIP-EIAAFHFALQEDEQTQNARRCVLSLAYQLTT  598

Query  383  NLPLFKNQL-ARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVA---FMLVDGIDQC-  437
             LP + + L +R  L+ ++  ++   L +++LV+PLN +  P        +L+DG++   
Sbjct  599  QLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARPQTATKPLVLLIDGLEHLV  658

Query  438  --------NVGPAGRNE---------------------LLEFLAQLIPQLPSWLGVIVSS  468
                       P GR                       L+  L  L+ +LP W+ V++ S
Sbjct  659  SDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLVSALPSLVARLPKWVRVVLLS  718

Query  469  KPSSKLAKRLPVSS---VLD-FSAKNEAFVADVSSLVDEI  504
            +    +  +L   +   VLD F  +N+    D+ S V++I
Sbjct  719  RKDPAIIAKLQGHTPNVVLDRFERENQ---QDIKSYVEKI  755

>PITG_17250
Length=1046

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 73/317 (23%), Positives = 130/317 (41%), Gaps = 59/317 (19%)

Query  305  RTWALTRAEEWLE----SRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQ  360
            R W     + W++    S  +     +  V+G+ GSGKS+    + Q    ++ A H   
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQAC-PEIAAFHFAT  508

Query  361  FDRKGKSSPRNVLLSVVHQLVVNLPLFKNQL-ARLNLKYVLEEADPVLLASKVLVDPLNA  419
             + +   + R  +LS+ +QL   LP + + L +   L+ ++  A  V L + +L+ PLNA
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNA  568

Query  420  LEDPVDVA--FMLVDGID-----QCNVGPAG-----RNE--LLEFLAQLIPQLPSWLGVI  465
            +  P       +L+DG++      C     G     ++E  L+  L  L+ +LP W+ ++
Sbjct  569  IARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIV  628

Query  466  VSSKPS----SKLAKRLPVSSVLD-FSAKNEAFVADVSSLVDEIACHFKHEDV-------  513
            + S+      SKL    P   +++ F  +N+    D+   +          DV       
Sbjct  629  LLSREEPPVLSKLHAFDPPDVIIEQFKLQND---QDIRRFISSSLSKLNLSDVDFEQASA  685

Query  514  -------------EEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELP-  559
                         E+  E++  +S G F Y     QA+S       EG + +  L ELP 
Sbjct  686  QIGSGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLRLHELAELPV  738

Query  560  ---ETLYDIYAEIFEDK  573
                 L+  +A  F D 
Sbjct  739  GMGAYLHQFFASHFADH  755

>PPTG_11365
Length=1106

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 66/321 (21%), Positives = 127/321 (40%), Gaps = 62/321 (19%)

Query  305  RTWALTRAEEWLE------SRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHC  358
            R W   + + W++      S  +     +  VVG+ GSGK++    + Q    ++ A H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSC-PEIAAFHL  561

Query  359  CQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQL-ARLNLKYVLEEADPVLLASKVLVDPL  417
               + +   + R  +LS+ +QL   LP + + L +   L+ ++  A  V L + +L+ PL
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPL  621

Query  418  NALEDPVDVA--FMLVDGIDQC------------NVGPAGRNE----LLEFLAQLIPQLP  459
             A+  P       +L+DG++              + G    N+     +  L  L+ +LP
Sbjct  622  TAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLP  681

Query  460  SWLGVIVSSKPSSKLAKRL-----PVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVE  514
             W+ +++ S+    +  +L     P  ++  F  +N+    D+   ++      +  +VE
Sbjct  682  EWVRIVLLSREEPPVLSKLRAFDPPDVTIEQFKHEND---QDIRRYINHSLSKLQLSEVE  738

Query  515  EAK---------------------EVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAID  553
              K                     E++  +S G F Y     QA+S       EG + + 
Sbjct  739  FEKAAAQIGTDSGNNHEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLHLH  791

Query  554  VLRELPETLYDIYAEIFEDKF  574
             L ELP  +     + F   F
Sbjct  792  ELAELPVGMGAYLQQFFASHF  812

>PITG_06580
Length=1214

 Score = 37.0 bits (84),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 0/78 (0%)

Query  351  GQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLAS  410
            G L++A     D  GK+ P NV +   H  VV+L  F+++  R N        + + LA 
Sbjct  481  GNLLSADVHSADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFIKLAC  540

Query  411  KVLVDPLNALEDPVDVAF  428
            + L+ P+N     +  AF
Sbjct  541  RSLLQPVNYPRRLIIFAF  558

>SDRG_01758
Length=169

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  139  VGGASSELEQLRFELIEVKQEVAAIRQ---HVVNELHVTRYDVLKELALLKGAIAQ  191
            VGG    L+ L   L E K EVA +RQ   H+VN     R D+ KE+A L+GAIA+
Sbjct  81   VGGHEETLKILISALAETKAEVARLRQEKAHLVN----GRKDMEKEVAGLQGAIAK  132

>PPTG_13828
Length=958

 Score = 35.8 bits (81),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 0/78 (0%)

Query  351  GQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLAS  410
            G L++A     D  GK+ P NV +   H  VV+L  F+++  R N        + + LA 
Sbjct  227  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFLKLAC  286

Query  411  KVLVDPLNALEDPVDVAF  428
            + L+ P+N     +  AF
Sbjct  287  RSLLQPVNYPRRLIIFAF  304

>PPTG_13827
Length=1212

 Score = 35.8 bits (81),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 0/78 (0%)

Query  351  GQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLAS  410
            G L++A     D  GK+ P NV +   H  VV+L  F+++  R N        + + LA 
Sbjct  481  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFLKLAC  540

Query  411  KVLVDPLNALEDPVDVAF  428
            + L+ P+N     +  AF
Sbjct  541  RSLLQPVNYPRRLIIFAF  558

>H310_11637
Length=904

 Score = 35.0 bits (79),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 66/149 (44%), Gaps = 21/149 (14%)

Query  423  PVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSS  482
            P DVA +L D +   N   +    +LE LA        WLGV V  KP      + P++S
Sbjct  323  PQDVAIVLCDTV---NAMESFERAVLECLA--CQDNECWLGVDVEWKPVFSKTDQ-PLAS  376

Query  483  VLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKH----KSGGNFAY-LEFTKQA  537
            VL  +  ++ F+ D+ +L +E +  F+  D      VL+H    K G  F++ L+  +Q 
Sbjct  377  VLQLAVGHQVFIVDLIAL-EEASAAFEMLD-----RVLQHPDVIKVGFGFSHDLQVLRQT  430

Query  538  LSGMASVSKEGVVAIDVLRELPETLYDIY  566
                          +    EL + L+++Y
Sbjct  431  FPDKGRCFH----YVSSFIELTQILHNLY  455

>PHYRA_79519
Length=1240

 Score = 35.0 bits (79),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 21/78 (27%), Positives = 36/78 (46%), Gaps = 0/78 (0%)

Query  351  GQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLAS  410
            G L++A     D  GK+ P NV +   H  V++L  F+ +  + N        + + LA 
Sbjct  501  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVISLLEFEEKFNKKNFSARYRVKNFIKLAC  560

Query  411  KVLVDPLNALEDPVDVAF  428
            + L+ P+N     +  AF
Sbjct  561  RSLLQPINYPRRVIIFAF  578

>PYIR_22964
Length=975

 Score = 34.7 bits (78),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 38/78 (49%), Gaps = 4/78 (5%)

Query  143  SSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTS  202
            + EL  L  ELIE  QEV  I   + + L     +VL++L  +  AIAQ+        + 
Sbjct  574  TEELRNLNRELIEASQEVIRIESEIFDALRAKVLNVLQDLQGMAHAIAQVDVV----CSH  629

Query  203  VPLSIQRSVSNPLSSADR  220
              ++I R+ + PL  + R
Sbjct  630  AQVAIDRNFTRPLLDSSR  647

>PHYSO_560296
Length=481

 Score = 34.3 bits (77),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 53/134 (40%), Gaps = 23/134 (17%)

Query  433  GIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEA  492
            G D      AG N  L+ +A LI + P+   V+  S   +  +           SA N A
Sbjct  327  GADYLEGACAGSNVFLQAVANLIGECPASTAVVALSYEGATYST----------SALNTA  376

Query  493  FVADVSSL---VDEIACHFKHEDVEE--------AKEVLKHKSGGNFAYLEFTKQALSGM  541
            +VA  S+    VD   C   +  +          A EV+ HKS  N   +E+  Q+ +G 
Sbjct  377  YVAAQSAFRSNVDAAICSDNYSGLLSVYQAEYILAGEVIPHKSSENDGVVEY--QSCAGG  434

Query  542  ASVSKEGVVAIDVL  555
             S SK G    D  
Sbjct  435  LSTSKFGTTYDDTF  448

>PYIW_18616
Length=885

 Score = 34.3 bits (77),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 38/78 (49%), Gaps = 4/78 (5%)

Query  143  SSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTS  202
            + EL  L  EL+E  QEVA I   + + L      VL++L  +  AIAQ+        + 
Sbjct  559  TEELRDLNRELVEAVQEVARIESEIFDALRAQVLSVLQDLQTMALAIAQVDVV----CSH  614

Query  203  VPLSIQRSVSNPLSSADR  220
              +++ R+ + PL  A R
Sbjct  615  AQVALDRNFTRPLLDASR  632

>SPRG_06059
Length=1312

 Score = 34.3 bits (77),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 32/65 (49%), Gaps = 7/65 (11%)

Query  327   LLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKS-------SPRNVLLSVVHQ  379
             LL VVG+GG GK      +A +  G++ A    Q D+   S       + R++L+ V H 
Sbjct  983   LLKVVGQGGFGKVFLGKKIAGENTGEIYAIKVLQKDQVLSSGLVHTTMAERHILIEVAHP  1042

Query  380   LVVNL  384
              VV L
Sbjct  1043  FVVKL  1047

>PYIW_17872
Length=218

 Score = 33.1 bits (74),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 9/105 (9%)

Query  313  EEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQ--LVAAHCCQFDRKGKS-SP  369
            ++ L S +K G  PL+ V+G GG+G +A    +A Q  G   +VA   CQ    G+S +P
Sbjct  87   KKRLVSAYKDG-KPLITVIGLGGAGNNAVNNMIASQLEGVEFIVANTDCQA--LGRSLAP  143

Query  370  RNVLLSVVHQLVVNLPLF-KNQLARLNLKYVLEEADPVLLASKVL  413
            R + L    ++   L    K QL +L+ +   EE +  L  S +L
Sbjct  144  RKITLG--KEITKGLGAGSKPQLGKLSAEMQREEIEVALQDSNML  186

>PHYRA_81457
Length=602

 Score = 33.9 bits (76),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 47/97 (48%), Gaps = 15/97 (15%)

Query  182  LALLKGAIAQLTGTFPPPTTSVPLSI------------QRSVSNPLSSADRGALTRQTST  229
            +ALL+GAIA+   +  PP +SV L+             QR  S  LS      L R+ + 
Sbjct  502  VALLRGAIARCARSEEPPRSSVSLAATNLSAKLWQSIKQRDFSQTLSVGYSSLLRRRANA  561

Query  230  MTSSATRDRLAAS--RVNTYKPPPPAARASVRLTQLA  264
            M+++   + +  S    N+ +PPP   R  +R ++LA
Sbjct  562  MSAACNTEEVNGSTDESNSDEPPPQTERL-LRTSRLA  597

>PITG_07984
Length=609

 Score = 33.1 bits (74),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  140  GGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQL  192
            GG  S  E  R E   +  ++AAIR+H  +E+   R D+ +EL  L+  + ++
Sbjct  431  GGNVSGGEGSRREFAALYAQIAAIRRHTTDEVQQLRRDIQRELQKLQAIVRRV  483

>PHYRA_81066
Length=586

 Score = 33.1 bits (74),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  418  NALED-----PVDVAFMLVDGIDQCNV----GPAGRNELLEFL-AQLIPQLPS-WLGVIV  466
            NA E+     P+D    LVD I + N+     PA   E  + L  Q +    S W  V +
Sbjct  303  NAFEEQVELSPLDTCLSLVDAIGEANIIFVDTPAALQECADHLMKQAVVGFDSEWKAVHI  362

Query  467  SSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDE---IACHFKHEDV  513
            S+ P    AK     +++  ++ ++AFV DV +L D    +A  F+ E V
Sbjct  363  SADPGDVPAK----CALVQLASPDKAFVVDVLALYDHGNILAPLFRSESV  408

>PHYCA_534503
Length=1089

 Score = 33.1 bits (74),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 21/78 (27%), Positives = 37/78 (47%), Gaps = 0/78 (0%)

Query  351  GQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLAS  410
            G L++A     D  GK+ P NV +   H  V++L  F+++  R N        + + LA 
Sbjct  608  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVISLLEFEDKFNRKNFSARYRVKNFLKLAC  667

Query  411  KVLVDPLNALEDPVDVAF  428
            + L+ P++     +  AF
Sbjct  668  RSLLQPISYPRRLIIFAF  685

>PYU1_G013711
Length=472

 Score = 32.7 bits (73),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 55/113 (49%), Gaps = 9/113 (8%)

Query  305  RTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQ--LVAAHCCQFD  362
            R  A    ++ L S +K G  PL+ V+G GG+G +A    +A Q  G   +VA   CQ  
Sbjct  87   RKEANEENKQRLVSAYKDG-KPLITVMGLGGAGNNAVNNMIASQLEGVEFIVANTDCQA-  144

Query  363  RKGKS-SPRNVLLSVVHQLVVNLPLF-KNQLARLNLKYVLEEADPVLLASKVL  413
              G+S +PR + L    ++   L    K QL +L+ +   +E +  L  S +L
Sbjct  145  -LGRSLAPRKITLG--KEITKGLGAGSKPQLGKLSAEMQRDEIEAALQDSNML  194

>SDRG_12763
Length=1317

 Score = 33.1 bits (74),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 31/65 (48%), Gaps = 7/65 (11%)

Query  327   LLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKS-------SPRNVLLSVVHQ  379
             LL VVG+GG GK      +A +  G+  A    Q D+   S       + R++L+ V H 
Sbjct  988   LLKVVGQGGFGKVFLGKKIAGENTGETYAIKVLQKDQVLSSGLVHTTMAERHILIEVAHP  1047

Query  380   LVVNL  384
              VV L
Sbjct  1048  FVVKL  1052

>PHYSO_346237
Length=526

 Score = 32.7 bits (73),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 51/127 (40%), Gaps = 23/127 (18%)

Query  433  GIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEA  492
            G D      +G N  LE +A LI + P+   V+  S      +           SA N A
Sbjct  373  GADYLQNACSGSNVFLEAIANLIGECPASTAVVGLSYEDETYST----------SALNTA  422

Query  493  FVADVSSL---VDEIACHFKHEDVEE--------AKEVLKHKSGGNFAYLEFTKQALSGM  541
            +VA  S+    VD   C   +  +          A EV+ HKS  N   +E+  Q+ +G 
Sbjct  423  YVAAQSAFRSNVDAAICSDNYSGLLSVYQAEYILAGEVIPHKSSENDGVVEY--QSCAGG  480

Query  542  ASVSKEG  548
             S SK G
Sbjct  481  LSTSKFG  487

>PYVX_15177
Length=790

 Score = 32.7 bits (73),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 50/116 (43%), Gaps = 11/116 (9%)

Query  427  AFMLVDGIDQCNVGPAGRNELLEFLAQL-IPQLPSWLGVIVSSKPSSKLAKRLP---VSS  482
            AF       Q  VG A R  L E L ++   QL S    ++ S  S    K L    V++
Sbjct  297  AFTFSCSRSQEVVGTALRTALSEVLVEIGDKQLASASKALLFSASSCIFVKDLADSLVAA  356

Query  483  VLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKH-------KSGGNFAYL  531
            ++D S +NE     +S L+  +A HF    V    EVL H       + G N A+L
Sbjct  357  LIDKSRENEKCRHRLSRLLVGLAAHFDRVGVSSVLEVLLHLASGYEAQDGDNVAFL  412

>PYIR_13358
Length=469

 Score = 32.7 bits (73),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 52/104 (50%), Gaps = 9/104 (9%)

Query  314  EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQ--LVAAHCCQFDRKGKS-SPR  370
            + L S +K G  PL+ V+G GG+G +A    +A Q  G   +VA   CQ    G+S +PR
Sbjct  98   KRLVSAYKDG-KPLITVIGLGGAGSNAVNNMIASQLEGVEFIVANTDCQA--LGRSLAPR  154

Query  371  NVLLSVVHQLVVNLPL-FKNQLARLNLKYVLEEADPVLLASKVL  413
             + L    ++   L    K QL +L+ +   +E +  L  S +L
Sbjct  155  KITLG--KEITKGLGAGSKPQLGKLSAEMQRDEIEQALKDSNML  196

Lambda      K        H        a         alpha
   0.316    0.131    0.373    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 57566062164

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40