Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_07103147551641647154e-97
PHYCA_11834147551341645391e-70
PHYSO_321155147551361645363e-70
PHYRA_95903147551341645233e-68
PHYKE_8392147551381645182e-67
PPTG_17126147551361645112e-66
PHALS_06479147551361645076e-66
PITG_18455147551321645061e-65
PYVX_18180147551351643811e-46
PYAP_17747147551341653636e-44
PYU1_G001736147551231563226e-38
CCA17542147551201543071e-35
PYIW_19970147551301563011e-34
CCI44820147551231542713e-30
PYIR_13454147551291562713e-30
SDRG_01782147551231562601e-28
H257_06293147551231562532e-27
H310_09224147551231562471e-26
SPRG_06335147551231562462e-26
HYAP_084991114710856900.002
HYAP_085006526017256900.003
PHYKE_58411114712154860.006
PHALS_115641114710756860.006
PITG_137391114710556850.007
PHYSO_3150171114710956850.007
PPTG_092521114710556840.011
CCA175211114710451800.034
PYU1_G0059631114710351780.058
CCI442321114710554780.070
PYVX_208541114710454750.14
PHYRA_816751114710656740.22
PYIW_147431114710551740.23
PYIR_151861114710951740.25
PHYCA_5353801114710856720.44
PYAR_232071114711254720.54
H310_07567111479840710.56
SDRG_149121114710554700.80
SPRG_128831114710554700.91
PYAP_228461114710456690.93
PHYRA_751931416310449691.1
PHALS_00343295789249691.1
H257_07358111479869681.3
CCA240562362427035721.5
PYIW_142931416310449671.9
SPRG_21627911025433658.2
PYU1_G0131561561313153639.2
CCA247171468529441659.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_07103

Length=164
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP_07103                                                            280        4e-97
PHYCA_11834                                                           212        1e-70
PHYSO_321155                                                          211        3e-70
PHYRA_95903                                                           206        3e-68
PHYKE_8392                                                            204        2e-67
PPTG_17126                                                            201        2e-66
PHALS_06479                                                           199        6e-66
PITG_18455                                                            199        1e-65
PYVX_18180                                                            151        1e-46
PYAP_17747                                                            144        6e-44
PYU1_G001736                                                          128        6e-38
CCA17542                                                              122        1e-35
PYIW_19970                                                            120        1e-34
CCI44820                                                              108        3e-30
PYIR_13454                                                            108        3e-30
SDRG_01782                                                            104        1e-28
H257_06293                                                            102        2e-27
H310_09224                                                            99.8       1e-26
SPRG_06335                                                            99.4       2e-26
HYAP_08499                                                            39.3       0.002
HYAP_08500                                                            39.3       0.003
PHYKE_5841                                                            37.7       0.006
PHALS_11564                                                           37.7       0.006
PITG_13739                                                            37.4       0.007
PHYSO_315017                                                          37.4       0.007
PPTG_09252                                                            37.0       0.011
CCA17521                                                              35.4       0.034
PYU1_G005963                                                          34.7       0.058
CCI44232                                                              34.7       0.070
PYVX_20854                                                            33.5       0.14 
PHYRA_81675                                                           33.1       0.22 
PYIW_14743                                                            33.1       0.23 
PYIR_15186                                                            33.1       0.25 
PHYCA_535380                                                          32.3       0.44 
PYAR_23207                                                            32.3       0.54 
H310_07567                                                            32.0       0.56 
SDRG_14912                                                            31.6       0.80 
SPRG_12883                                                            31.6       0.91 
PYAP_22846                                                            31.2       0.93 
PHYRA_75193                                                           31.2       1.1  
PHALS_00343                                                           31.2       1.1  
H257_07358                                                            30.8       1.3  
CCA24056                                                              32.3       1.5  
PYIW_14293                                                            30.4       1.9  
SPRG_21627                                                            29.6       8.2  
PYU1_G013156                                                          28.9       9.2  
CCA24717                                                              29.6       9.2  

>HYAP_07103
Length=164

 Score = 280 bits (715),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 164/164 (100%), Positives = 164/164 (100%), Gaps = 0/164 (0%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
            LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PHYCA_11834
Length=134

 Score = 212 bits (539),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 122/164 (74%), Gaps = 35/164 (21%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RPLYKKLLRLAQSLPEPKRQ S+DQIRREFR H DLTDPKEVS LLQRAQSS+ +LKIV
Sbjct  6    LRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIV  65

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPRAES                                   +TG+QRF+YRDGKR++A E
Sbjct  66   TPRAES-----------------------------------NTGVQRFIYRDGKRVNAEE  90

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
            L+ KGEENAR+KTQD+EAG+KRHHQLLRRQ+FMDRKSGPPRPIF
Sbjct  91   LEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMDRKSGPPRPIF  134

>PHYSO_321155
Length=136

 Score = 211 bits (536),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 123/164 (75%), Gaps = 35/164 (21%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RPLYKKLLRLAQSLPEPKR++SLDQIRREFR HGDLTDP+ VS+L+QRAQSS+ +LKIV
Sbjct  8    LRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKIV  67

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPR ES                                   +TG+QRF+YR+G+R++AAE
Sbjct  68   TPRGES-----------------------------------NTGVQRFIYRNGQRVNAAE  92

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
             + KGEENARYKTQDIEAG+KRHHQLLRRQ+FMDRKSGPPRPIF
Sbjct  93   FEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMDRKSGPPRPIF  136

>PHYRA_95903
Length=134

 Score = 206 bits (523),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 121/164 (74%), Gaps = 35/164 (21%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RPLYKKLLRLAQSLPEPKRQ+SLDQIRREFR H +LTDPKEVS+L+QRAQSS+ +LKIV
Sbjct  6    LRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIV  65

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPRAES                                   + GIQR++YR+G+R++A E
Sbjct  66   TPRAES-----------------------------------NKGIQRYIYRNGQRVNADE  90

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
            ++  GEENARYKTQDIE G+KRHHQLLRRQHFMDRKSGPPRPIF
Sbjct  91   VEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMDRKSGPPRPIF  134

>PHYKE_8392
Length=138

 Score = 204 bits (518),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 123/164 (75%), Gaps = 33/164 (20%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RPLYKKLLR+AQ+LPEPKR +SL QIRREFR HGDL+DPKEVS LLQ AQSS+ +LKIV
Sbjct  8    LRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYLKIV  67

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPR E+                                  S++G+QR++YR+G+R++AAE
Sbjct  68   TPRDET---------------------------------ESNSGVQRYIYRNGQRVNAAE  94

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
            L++KGEENARYKTQD+EAG+KRHHQL+RRQHFMDRKSGPPRP+F
Sbjct  95   LEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPRPMF  138

>PPTG_17126
Length=136

 Score = 201 bits (511),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 122/164 (74%), Gaps = 35/164 (21%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RPLYKKLLRLAQSLPEPKRQ S+DQIRR+FR HGDLTDP+EVS+L+QRAQSS+ +LKIV
Sbjct  8    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKIV  67

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPRAES                                   + G+QR++YR+G+R++A E
Sbjct  68   TPRAES-----------------------------------NMGVQRYIYRNGQRVNADE  92

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
             ++KGEENAR+KTQD+E G++RHHQLLRRQ+F+DRKSGPPRPIF
Sbjct  93   FEEKGEENARWKTQDMEGGLRRHHQLLRRQYFLDRKSGPPRPIF  136

>PHALS_06479
Length=136

 Score = 199 bits (507),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 118/164 (72%), Gaps = 35/164 (21%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RPLYKKLLRLAQ+LP+ KRQ S+DQIRREFR H DLTDPKEVS  +QRAQSS+ +LKI+
Sbjct  8    LRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKII  67

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPR ES                                   +TG+QRF+YR+G+R++AA+
Sbjct  68   TPRTES-----------------------------------NTGVQRFIYRNGQRVNAAD  92

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
             +KKG ENAR+KTQD+EAG KRHHQLLRRQ+FMDRKSGPPRPIF
Sbjct  93   FEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMDRKSGPPRPIF  136

>PITG_18455
Length=132

 Score = 199 bits (506),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 121/164 (74%), Gaps = 35/164 (21%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RPLYKKLLRLAQSLPEPKRQ S+DQIRR+FR HGD TDPKEVS+L+QRAQSS+ +LKIV
Sbjct  4    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKIV  63

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPRAES                                   +TG+QR++YR+G+R++AAE
Sbjct  64   TPRAES-----------------------------------NTGVQRYIYRNGQRVNAAE  88

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
             ++KG ENAR+K QD+E G+KRHHQLL+RQ+FM+RKSGPPRPIF
Sbjct  89   FEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNRKSGPPRPIF  132

>PYVX_18180
Length=135

 Score = 151 bits (381),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 103/164 (63%), Gaps = 35/164 (21%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RPLYKKLLRLAQSLPEPKR  ++ QIR EFR H ++TD  EV+ LLQRAQS + +LKIV
Sbjct  7    LRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIV  66

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPR  S                                    +G++R++YR+G+R+DA  
Sbjct  67   TPRGPSA-----------------------------------SGVKRYIYRNGQRVDADA  91

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
             +  GE+ ARYKT D+E  +KRHHQLLRRQHFMDR   PPRPIF
Sbjct  92   AEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMDRGVAPPRPIF  135

>PYAP_17747
Length=134

 Score = 144 bits (363),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 104/165 (63%), Gaps = 37/165 (22%)

Query  1    MRPLYKKLLRLAQSLP-EPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
            +RPLYK+LLRLA+SLP E KR+ ++ QIR EFR   D  DPKEV++L+QRAQ+ I +LKI
Sbjct  6    LRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKI  65

Query  60   VTPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAA  119
            VTPR+ +                                   D G++ FVY +GKR+D++
Sbjct  66   VTPRSTA-----------------------------------DAGVKSFVYVNGKRVDSS  90

Query  120  ELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164
            +++ + EE ARYKT D E  M+RH+QLLRRQHFMDR   PP+PIF
Sbjct  91   DVQTR-EEGARYKTIDFEGNMRRHNQLLRRQHFMDRGVAPPKPIF  134

>PYU1_G001736
Length=123

 Score = 128 bits (322),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 94/156 (60%), Gaps = 38/156 (24%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RP+YKKLL+LAQ+LP  KRQ +++QIRREFR H    DPKE+++LL RAQSSI +LKIV
Sbjct  6    LRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIV  65

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPRA S                                   D G++ +VY  GKR++AA 
Sbjct  66   TPRATS-----------------------------------DAGVKNYVYIKGKRVEAAG  90

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
                 E+ ARYKT D  A M+RH QLLRRQHFMDRK
Sbjct  91   ---AAEDGARYKTADYNAQMQRHVQLLRRQHFMDRK  123

>CCA17542
Length=120

 Score = 122 bits (307),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 91/154 (59%), Gaps = 38/154 (25%)

Query  2    RPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIVT  61
            R +YK+L+RLA+SLP  K+  +L  IR EFR H D++DP ++S LL+RAQS+I +LKIVT
Sbjct  5    RSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIVT  64

Query  62   PRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAEL  121
            P   S                                   D+G++RF+++DG+RI   E 
Sbjct  65   PHKRS-----------------------------------DSGVKRFMFKDGERI---EE  86

Query  122  KKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDR  155
              K  E AR+K QDI  G+KRHHQLLRRQHFMDR
Sbjct  87   NLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>PYIW_19970
Length=130

 Score = 120 bits (301),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 38/156 (24%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RP+YKKLL+LA++LPE KR+ +  QIR EFR   +L+DPKE+++LL RAQSSI +LKIV
Sbjct  13   LRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIV  72

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPR  S                                   D G++ ++Y++G+R++AA 
Sbjct  73   TPRKSS-----------------------------------DAGVKNYIYKNGQRVEAAA  97

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
            +    E+ A+Y+  D    M RH +LLRRQHFMDRK
Sbjct  98   VM---EDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130

>CCI44820
Length=123

 Score = 108 bits (271),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 91/154 (59%), Gaps = 38/154 (25%)

Query  2    RPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIVT  61
            R ++KK+++LA+SLP  K+  +L  IR EFR H D+ DP +++ LL+RAQS+I +LKIVT
Sbjct  8    RRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKIVT  67

Query  62   PRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAEL  121
            P   S                                   D+G++ FVY+DG+RI+ +  
Sbjct  68   PHKRS-----------------------------------DSGVKHFVYKDGERIEKS--  90

Query  122  KKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDR  155
              +  E A++K QD+E G+KRH+QL+RRQ+FMDR
Sbjct  91   -LQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123

>PYIR_13454
Length=129

 Score = 108 bits (271),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 93/156 (60%), Gaps = 38/156 (24%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +RP+YKKLL+LA++LPE KR  +L QIR EFR   D++DPKE+++LL RAQSSI +LKIV
Sbjct  12   LRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIV  71

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TPR  S                                   D G++ ++Y++G+R++A  
Sbjct  72   TPRKSS-----------------------------------DAGVKNYIYKNGQRVEATS  96

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
            +    E+ A+Y   D  A M+RH +LLRRQHFMDRK
Sbjct  97   VL---EDGAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129

>SDRG_01782
Length=123

 Score = 104 bits (260),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 84/156 (54%), Gaps = 37/156 (24%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +R  YKKLL+LA+S+P+ +R ++L+++R EFR H     P+E+  LL++AQS I +LKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIV  64

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TP+  S     S                                   FVY++G+RID  E
Sbjct  65   TPKKSSSSTQGS----------------------------------HFVYKNGQRIDGRE  90

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
            L     ++A  KT D  A M +H QL+RRQHFMDRK
Sbjct  91   L---SADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123

>H257_06293
Length=123

 Score = 102 bits (253),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 85/156 (54%), Gaps = 37/156 (24%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +R  YKKL++LAQSLP  ++  +LD+IR +FR  G ++  +E+  L+ +AQS I +LKIV
Sbjct  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TP+                                       +G QRF+Y+DGKR+D+  
Sbjct  65   TPK-----------------------------------RTPQSGPQRFIYKDGKRLDSQS  89

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
            L   G  N   KT D+ A M+RH +L+RRQHFMDRK
Sbjct  90   LDDGG--NRTIKTTDVNAMMERHVKLIRRQHFMDRK  123

>H310_09224
Length=123

 Score = 99.8 bits (247),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 83/156 (53%), Gaps = 37/156 (24%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +R  YKKL++LAQSLP  ++  +LD++R EFR HG +T   ++  ++ +AQS I +LKIV
Sbjct  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TP+                                       T  QR++Y+DGKR+D   
Sbjct  65   TPK-----------------------------------RAPQTSPQRYIYKDGKRLDPGC  89

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
            + +    NA  KT D  A M+RH +L+RRQHFMDRK
Sbjct  90   IDQ--STNATIKTVDFNAMMERHVKLVRRQHFMDRK  123

>SPRG_06335
Length=123

 Score = 99.4 bits (246),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 83/156 (53%), Gaps = 37/156 (24%)

Query  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
            +R  YKKLL+LA+S+P+ +R ++L+++R EFR H     P+E+  LL++AQS I +LKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIV  64

Query  61   TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
            TP+        +                                   FVY++G+RID  E
Sbjct  65   TPKKSPSPGQGN----------------------------------HFVYKNGQRIDGRE  90

Query  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
            L     ++A  KT D  A M +H QL+RRQHFMDRK
Sbjct  91   L---SADSATIKTADYNAMMTKHVQLVRRQHFMDRK  123

>HYAP_08499
Length=108

 Score = 39.3 bits (90),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 34/56 (61%), Gaps = 0/56 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
           +Y+++L+LAQ  P  KRQ  +  I+ EFR + +L+D ++V   L   Q+ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  65

>HYAP_08500
Length=172

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 34/56 (61%), Gaps = 0/56 (0%)

Query  4    LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
            +Y+++L+LAQ  P  KRQ  +  I+ EFR + +L+D ++V   L   Q+ I  L +
Sbjct  74   MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  129

>PHYKE_5841
Length=121

 Score = 37.7 bits (86),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
           +Y+++L+LAQ  P  KR   +  I+ EF  H  LTD +++   L  A++ I  L
Sbjct  10  MYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGIKEL  63

>PHALS_11564
Length=107

 Score = 37.7 bits (86),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 0/56 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
           +Y++LL+LAQ  P  KR+  +  I+ EF  +  +TD +++   +  A + I  L +
Sbjct  10  VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELSM  65

>PITG_13739
Length=105

 Score = 37.4 bits (85),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
           +Y+++L+LAQ  P  KR+  +  I+ EF  + DLTD +++   L   ++ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGITELSM  65

>PHYSO_315017
Length=109

 Score = 37.4 bits (85),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
           +Y+++L+LAQ  P  KR+  +  I+ EF  + DLTD +++   L   ++ I  L +
Sbjct  10  MYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGIKELSM  65

>PPTG_09252
Length=105

 Score = 37.0 bits (84),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
           LY+++L+LAQ  P  KR+  +  I+ EF  + +LTD +++   L   ++ I  L +
Sbjct  10  LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65

>CCA17521
Length=104

 Score = 35.4 bits (80),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (55%), Gaps = 0/51 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSI  54
           LY+++LRLA+  P  KR   ++ IR EFR   D+T    +   +  A + I
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGI  59

>PYU1_G005963
Length=103

 Score = 34.7 bits (78),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (57%), Gaps = 0/51 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSI  54
           +Y+++L+LA   P  KR   +  I+ EFR +  LTD   + + +Q A+  I
Sbjct  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

>CCI44232
Length=105

 Score = 34.7 bits (78),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
           LY+++LRLA+  P  KR   ++ IR EFR   ++  P  +   +  A + I  L
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKEL  62

>PYVX_20854
Length=104

 Score = 33.5 bits (75),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
           LY+++L+LAQ  P  KR   +  I+ EF  +  L+D ++V   +  A++ I  L
Sbjct  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>PHYRA_81675
Length=106

 Score = 33.1 bits (74),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 0/56 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
           +Y+++L+LAQ  P  KR   +  I+ EF  +  LTD +++   L   ++ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGIKELSM  65

>PYIW_14743
Length=105

 Score = 33.1 bits (74),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (57%), Gaps = 0/51 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSI  54
           LY+++L+LA   P  KR   + +I+ EF  +  LTD  ++   +Q A+  I
Sbjct  10  LYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQGI  60

>PYIR_15186
Length=109

 Score = 33.1 bits (74),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (57%), Gaps = 0/51 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSI  54
           +Y+++L+LA   P  KR   + +I+ EF  +  LTD  ++   +Q A+  I
Sbjct  10  VYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQGI  60

>PHYCA_535380
Length=108

 Score = 32.3 bits (72),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 30/56 (54%), Gaps = 0/56 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
           +Y+++L+LA   P  KR+  +  I+ EF  +  LTD + +   L   ++ I  L +
Sbjct  10  MYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGIKELSM  65

>PYAR_23207
Length=112

 Score = 32.3 bits (72),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
           LY+++L+LA+  P  KR   ++ I+ EF     LTD   +   +  AQ+ I  L
Sbjct  13  LYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

>H310_07567
Length=98

 Score = 32.0 bits (71),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 27/40 (68%), Gaps = 0/40 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEV  43
           +Y+++L+LA+  P  KR + ++ I+ EF  +  LTDP ++
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKI  49

>SDRG_14912
Length=105

 Score = 31.6 bits (70),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
           +Y+++L+LAQ  P  K+ + +  I+ EF  +  LTD  ++   +  A   I+ L
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

>SPRG_12883
Length=105

 Score = 31.6 bits (70),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
           +Y+++L+LAQ  P  K+ + +  I+ EF  +  LTD  ++   +  A   I+ L
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

>PYAP_22846
Length=104

 Score = 31.2 bits (69),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 0/56 (0%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
           LY+ +L+LA+  P  KR   +  I+ EF      TD + +   +  AQ+ I  L +
Sbjct  10  LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGIKELSM  65

>PHYRA_75193
Length=104

 Score = 31.2 bits (69),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query  4   LYKKLLRLAQSL--PEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRA  50
           LY+  +RLAQ +     K Q   D +RREF    D TDP++V +L   A
Sbjct  14  LYRDCMRLAQHIGGNSKKGQAIKDLVRREFAKGRDETDPEKVEALKANA  62

>PHALS_00343
Length=92

 Score = 31.2 bits (69),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 24/49 (49%), Gaps = 0/49 (0%)

Query  15  LPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIVTPR  63
           L +  RQ+SL    + F  H  +   KE+ + L   Q ++ FL   TPR
Sbjct  37  LKDAGRQESLMSNNKGFGCHLYVQGTKEICTELTLVQCNVGFLATPTPR  85

>H257_07358
Length=98

 Score = 30.8 bits (68),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/69 (28%), Positives = 35/69 (51%), Gaps = 3/69 (4%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLK---IV  60
           +Y+++L+LA   P  K+++ +  I+ EF  +  LTDP ++   +  A   I  L     +
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGIQQLNQYVAL  69

Query  61  TPRAESGGF  69
            P A+S   
Sbjct  70  DPNAQSWSV  78

>CCA24056
Length=4270

 Score = 32.3 bits (72),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  110   YRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHH  144
             YR+G R+DA ++    ++N R K+ D E     HH
Sbjct  2065  YREGSRLDATQVPNDAKQNWRSKSTDAEKDPAFHH  2099

>PYIW_14293
Length=104

 Score = 30.4 bits (67),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query  4   LYKKLLRLAQSLPEPKRQKSL--DQIRREFRIHGDLTDPKEVSSLLQRA  50
           LY+  +RLA+ +    ++ S   D IRREF    D TDP+++ +L   A
Sbjct  13  LYRDCMRLAKHIGGTSKKGSAIKDLIRREFEKARDETDPEKIEALKTNA  61

>SPRG_21627
Length=254

 Score = 29.6 bits (65),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (61%), Gaps = 1/33 (3%)

Query  13  QSLPEPKRQKSL-DQIRREFRIHGDLTDPKEVS  44
           Q+L EP R   L D +R  FR +  LTDPK ++
Sbjct  68  QALLEPHRGADLRDVVRATFRANATLTDPKTIA  100

>PYU1_G013156
Length=131

 Score = 28.9 bits (63),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (57%), Gaps = 1/53 (2%)

Query  4   LYKKLLRLAQSLPEPKRQKSLDQ-IRREFRIHGDLTDPKEVSSLLQRAQSSID  55
           LY + LR A+  P+ ++++ +   ++ +FR   D+ DP  +  LL  A+  +D
Sbjct  14  LYAQCLRSARKCPQWEQREMMKAYVKMKFRHDADVQDPARIQRLLADAREELD  66

>CCA24717
Length=294

 Score = 29.6 bits (65),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (59%), Gaps = 0/41 (0%)

Query  117  DAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKS  157
            D A+L K  EE   Y+    +A +KRH++L+R+   MD  S
Sbjct  17   DKADLGKNAEEFRNYEDSCRQAIVKRHYKLMRQHQTMDFHS  57

Lambda      K        H        a         alpha
   0.322    0.137    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5778797598

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40