Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_070965346125125113530.0
PHYCA_537323449662001817042e-93
PPTG_17123147532011806894e-91
PHYRA_81105534612011806885e-91
PITG_18452147538562157177e-88
PHYSO_353401534611461466054e-79
PYVX_18173449665001805712e-69
PYU1_G001739932032661654913e-60
PYU1_G001741854041991914453e-54
PYU1_G001738534612261614449e-54
PYIR_25089854042621794427e-53
PYU1_G001744568762131614379e-53
PYU1_G001742932042131614333e-52
PPTG_10635528561991604262e-51
PHYRA_85631109792281604274e-51
PPTG_10636109792461814261e-50
PHYRA_84190720132061604212e-50
PHYSO_536424606911971704193e-50
PHYSO_507031586531971704193e-50
PHYSO_341599109791851604173e-50
PHYCA_14369109792481614224e-50
PYIW_18788932032441654215e-50
PYU1_G001740147522061624161e-49
PYIR_26626147522121834108e-49
PHYCA_102624720131951604081e-48
PPTG_10634720132081604091e-48
PPTG_10643457052501814102e-48
PHYCA_102852242061951604036e-48
PHALS_00498109791991724021e-47
PHYRA_81107568762021804002e-47
PPTG_10048213141901943992e-47
PHYKE_8388568762051603994e-47
PHYCA_102550457052681614026e-47
PHYKE_3446231281991913932e-46
PHYKE_8389147522041833915e-46
PHYSO_284086147522041603891e-45
PHYRA_82864231281931883872e-45
PHYSO_477820568762021803872e-45
PHYCA_511409568762041603837e-45
PPTG_15264231281941833802e-44
PPTG_17366239131941833802e-44
PHYKE_7718109792201603822e-44
PPTG_17121568762021833784e-44
PPTG_17122147522041833776e-44
PHYCA_129425147522041603777e-44
PHYRA_81106147522021603672e-42
PHYKE_8390534611301083603e-42
PYIW_18791854041941613629e-42
PITG_18450147522031863612e-41
PHALS_03284309411881703573e-41
PYVX_18176568762011603463e-39
PYAP_22273932032681883462e-38
PHYCA_510817445761881873304e-37
PYVX_18174854042041613308e-37
PPTG_14255469372681873225e-35
PYIR_26546866052391713197e-35
PHYKE_9185445762811843192e-34
PPTG_14254445761881803113e-34
PHYSO_499978231281741393095e-34
PHYSO_501575820771741393095e-34
PYAR_24096932032271623135e-34
PYAP_22279854042231663101e-33
PHYSO_262732469371881853043e-33
PYAP_22278932042891723105e-33
PITG_13520109791711293017e-33
PHYCA_53693413059831933237e-33
PHYSO_417649445761851843001e-32
PPTG_0882086622501933006e-32
PHYSO_343376532371721512833e-30
PHYSO_340369526762001942732e-28
PITG_1049986623231522732e-27
PHYSO_254168462841701832624e-27
PHYSO_527908600641741722582e-26
PHYCA_14368528562191882516e-25
PHALS_0648053461159732413e-24
PHYSO_341596528562311092412e-23
PHYRA_74651699693441332462e-23
PHYRA_73607194343431332453e-23
PHYRA_7358442332871332354e-22
PHYCA_13036542352661272326e-22
PPTG_04622696962731332311e-21
PHYSO_342364529831941332261e-21
PHYCA_534473423310501332346e-21
PHYSO_484051571982851312268e-21
PHYKE_2937571983661332299e-21
PITG_0494842342321312229e-21
PPTG_0461942342761312251e-20
PHYSO_48552442342782012241e-20
PPTG_04647194343271312261e-20
PHYRA_73606571983661312262e-20
PYVX_14662510865401342283e-20
PYAP_246891014392521362186e-20
PYAP_18131991722261202167e-20
PHYKE_2809752822911312181e-19
PYAP_18711943562101322122e-19
PHYCA_531163194343141332172e-19
PHYSO_533903604652081392113e-19
PPTG_0461842353261282163e-19
PHYKE_391342343211422154e-19
PHYKE_600144782891302127e-19
PYIR_1643542333041232111e-18
PHALS_0539242353671272112e-18
PYU1_G005323943552511202072e-18
PHYRA_7358242353261272093e-18
PHYSO_48395542353201272084e-18
H310_0636217301971452024e-18
PYIR_16375823732621182038e-18
PYU1_G007364851643161642051e-17
SDRG_081371363342821412031e-17
PHYCA_534296526713091332041e-17
PHYSO_459106194342231311992e-17
PYIR_24743851643571792042e-17
SDRG_075651244122781411994e-17
SDRG_081291363312181411965e-17
PYAP_18709943552351191965e-17
PHYRA_7868968382961421996e-17
PHYSO_34033244782951381987e-17
H257_1355017302661321977e-17
PHYSO_340333526712841381977e-17
PHYRA_7358342346301312011e-16
PITG_0494942353371281981e-16
PHYSO_533747604512061381911e-16
SPRG_19916161733051391952e-16
SPRG_199171339462411361922e-16
PHYSO_438103557212381331923e-16
PITG_0527144782781331933e-16
SDRG_173181339462411361914e-16
PYVX_18179534611471601854e-16
PYU1_G007476539131951241875e-16
PITG_0494742332981311925e-16
PHYSO_246676457051871601875e-16
SPRG_2216117303001391926e-16
PYU1_G01469042342951251916e-16
PHYKE_10578778802391181896e-16
PHYSO_533682604462781321907e-16
PPTG_0462042333421311928e-16
PYVX_16138786195591511931e-15
PHYCA_69583463492241331861e-15
PYAR_206171040482541361871e-15
PHYCA_12727044782791421881e-15
PHYSO_255056463492691241872e-15
PHYKE_6002526711971231823e-15
PHYRA_86016727462361201833e-15
PYAP_24691101441145681784e-15
PPTG_0313997753201291855e-15
PHYRA_86752732363001321855e-15
PYU1_G005324845341911211797e-15
PYU1_G005326463491911211797e-15
PYU1_G00532842331911211797e-15
PHYCA_12942213313531131858e-15
PYU1_G005325943562071211798e-15
PYAR_14260845342121211798e-15
PPTG_1422144782751331829e-15
SDRG_17317161731221111721e-14
PPTG_07521450302811191802e-14
PHYRA_83499204334731321832e-14
PHYCA_98479819502761191802e-14
PHYRA_77971705552301061773e-14
PHYRA_85794726192301061773e-14
PYU1_G00586817292671301783e-14
PPTG_0750738072991181785e-14
PPTG_07509718142991181785e-14
PHYCA_97965401872881971775e-14
PHYRA_86241728921951261735e-14
PYAR_14256943551991231736e-14
PYIR_16443823992751211766e-14
PYVX_20789539132901981768e-14
PYIR_1644442341821211719e-14
PPTG_0625673983181181769e-14
PYU1_G006403823732521231741e-13
PHYRA_73581696932931311741e-13
PHYCA_12943369712871181732e-13
SDRG_0878217304501391762e-13
PYIR_22634841752691201722e-13
PYIW_27477823991801171682e-13
PHALS_0539442342881271722e-13
SPRG_046791244122261501702e-13
PYU1_G006405371743051201723e-13
SPRG_076271258855361391743e-13
PHYRA_78175764333191301723e-13
PITG_0889273983091191723e-13
PYIW_19151831912481291694e-13
PHYCA_112615308831961261674e-13
PPTG_07516464352941321714e-13
PHALS_04411944962621281704e-13
PPTG_0752038142941321704e-13
PHYRA_8063173983201221714e-13
PYVX_24563161732542011685e-13
PYVX_1817514752147741626e-13
PYIR_14463819503691731716e-13
PYVX_211747985295641587e-13
PHYKE_391242332521381677e-13
PYIW_18792932041251171608e-13
PHYCA_15125371743341211698e-13
PHYRA_8075044782751331689e-13
PHYKE_902473982991211689e-13
PHALS_10635341192961281681e-12
PHYRA_83494464352241061651e-12
PHYCA_1865738072951451671e-12
PPTG_06253371743031211671e-12
PHYKE_2379539132852031671e-12
PHYRA_93650463492311181641e-12
PHYCA_1961197755311291692e-12
H257_112581259833711991672e-12
PYAP_222571003612471541642e-12
PYAP_1970799579241831642e-12
PYAP_18138991732681821652e-12
PYIR_2486773983191191662e-12
PHYCA_122958161732601251642e-12
PHALS_03179308833721331662e-12
PHYSO_476077161732681291643e-12
PHYSO_472009159812681291643e-12
SDRG_00948125983352991663e-12
PPTG_06249168112911211643e-12
PHYKE_1913732362801181643e-12
PYAR_1816599579261681633e-12
PHYRA_78626578954731651663e-12
SPRG_07799125983345991653e-12
PITG_0820268381911211603e-12
PHYKE_771752856568441664e-12
PHYRA_78625541464341651654e-12
PHYRA_7914038074241241654e-12
PPTG_18176242122631301625e-12
PHYRA_78176597733121281626e-12
PHYKE_2454751493741251636e-12
PYIR_23585845342401211606e-12
PHYKE_574938073001181626e-12
PITG_20631161732701341617e-12
PHYKE_1029517292921291627e-12
PPTG_10186161732701341617e-12
PYAP_1871342341841241577e-12
PHYSO_26284417292761611618e-12
PYIR_2048117292771301618e-12
PITG_20312159812701341609e-12
PHYRA_84732161732651341591e-11
PHYRA_78174188562791291601e-11
SDRG_17448138489262911591e-11
PITG_1193697753331311601e-11
SDRG_154261258855231411621e-11
PHYSO_48813917302651301581e-11
PHALS_03177526712591381582e-11
PHYKE_2539161732581371572e-11
PHALS_0317644782071331552e-11
SPRG_0782697753711591592e-11
H257_113061432123691251592e-11
PHYSO_524101597733081281582e-11
H310_054381259833391221592e-11
PHYRA_83500718143941241592e-11
PHYCA_6388711612941181573e-11
PYAP_19712995812761181563e-11
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_07096

Length=251
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP_07096                                                            525        0.0  
PHYCA_537323                                                          275        2e-93
PPTG_17123                                                            270        4e-91
PHYRA_81105                                                           269        5e-91
PITG_18452                                                            280        7e-88
PHYSO_353401                                                          237        4e-79
PYVX_18173                                                            224        2e-69
PYU1_G001739                                                          193        3e-60
PYU1_G001741                                                          176        3e-54
PYU1_G001738                                                          175        9e-54
PYIR_25089                                                            174        7e-53
PYU1_G001744                                                          172        9e-53
PYU1_G001742                                                          171        3e-52
PPTG_10635                                                            168        2e-51
PHYRA_85631                                                           169        4e-51
PPTG_10636                                                            168        1e-50
PHYRA_84190                                                           166        2e-50
PHYSO_536424                                                          166        3e-50
PHYSO_507031                                                          166        3e-50
PHYSO_341599                                                          165        3e-50
PHYCA_14369                                                           167        4e-50
PYIW_18788                                                            166        5e-50
PYU1_G001740                                                          164        1e-49
PYIR_26626                                                            162        8e-49
PHYCA_102624                                                          161        1e-48
PPTG_10634                                                            162        1e-48
PPTG_10643                                                            162        2e-48
PHYCA_102852                                                          159        6e-48
PHALS_00498                                                           159        1e-47
PHYRA_81107                                                           158        2e-47
PPTG_10048                                                            158        2e-47
PHYKE_8388                                                            158        4e-47
PHYCA_102550                                                          159        6e-47
PHYKE_3446                                                            155        2e-46
PHYKE_8389                                                            155        5e-46
PHYSO_284086                                                          154        1e-45
PHYRA_82864                                                           153        2e-45
PHYSO_477820                                                          153        2e-45
PHYCA_511409                                                          152        7e-45
PPTG_15264                                                            150        2e-44
PPTG_17366                                                            150        2e-44
PHYKE_7718                                                            151        2e-44
PPTG_17121                                                            150        4e-44
PPTG_17122                                                            149        6e-44
PHYCA_129425                                                          149        7e-44
PHYRA_81106                                                           145        2e-42
PHYKE_8390                                                            143        3e-42
PYIW_18791                                                            144        9e-42
PITG_18450                                                            143        2e-41
PHALS_03284                                                           142        3e-41
PYVX_18176                                                            137        3e-39
PYAP_22273                                                            137        2e-38
PHYCA_510817                                                          131        4e-37
PYVX_18174                                                            131        8e-37
PPTG_14255                                                            128        5e-35
PYIR_26546                                                            127        7e-35
PHYKE_9185                                                            127        2e-34
PPTG_14254                                                            124        3e-34
PHYSO_499978                                                          123        5e-34
PHYSO_501575                                                          123        5e-34
PYAR_24096                                                            125        5e-34
PYAP_22279                                                            124        1e-33
PHYSO_262732                                                          121        3e-33
PYAP_22278                                                            124        5e-33
PITG_13520                                                            120        7e-33
PHYCA_536934                                                          129        7e-33
PHYSO_417649                                                          120        1e-32
PPTG_08820                                                            120        6e-32
PHYSO_343376                                                          113        3e-30
PHYSO_340369                                                          109        2e-28
PITG_10499                                                            109        2e-27
PHYSO_254168                                                          105        4e-27
PHYSO_527908                                                          103        2e-26
PHYCA_14368                                                           101        6e-25
PHALS_06480                                                           97.4       3e-24
PHYSO_341596                                                          97.4       2e-23
PHYRA_74651                                                           99.4       2e-23
PHYRA_73607                                                           99.0       3e-23
PHYRA_73584                                                           95.1       4e-22
PHYCA_130365                                                          94.0       6e-22
PPTG_04622                                                            93.6       1e-21
PHYSO_342364                                                          91.7       1e-21
PHYCA_534473                                                          94.7       6e-21
PHYSO_484051                                                          91.7       8e-21
PHYKE_2937                                                            92.8       9e-21
PITG_04948                                                            90.1       9e-21
PPTG_04619                                                            91.3       1e-20
PHYSO_485524                                                          90.9       1e-20
PPTG_04647                                                            91.7       1e-20
PHYRA_73606                                                           91.7       2e-20
PYVX_14662                                                            92.4       3e-20
PYAP_24689                                                            88.6       6e-20
PYAP_18131                                                            87.8       7e-20
PHYKE_2809                                                            88.6       1e-19
PYAP_18711                                                            86.3       2e-19
PHYCA_531163                                                          88.2       2e-19
PHYSO_533903                                                          85.9       3e-19
PPTG_04618                                                            87.8       3e-19
PHYKE_3913                                                            87.4       4e-19
PHYKE_6001                                                            86.3       7e-19
PYIR_16435                                                            85.9       1e-18
PHALS_05392                                                           85.9       2e-18
PYU1_G005323                                                          84.3       2e-18
PHYRA_73582                                                           85.1       3e-18
PHYSO_483955                                                          84.7       4e-18
H310_06362                                                            82.4       4e-18
PYIR_16375                                                            82.8       8e-18
PYU1_G007364                                                          83.6       1e-17
SDRG_08137                                                            82.8       1e-17
PHYCA_534296                                                          83.2       1e-17
PHYSO_459106                                                          81.3       2e-17
PYIR_24743                                                            83.2       2e-17
SDRG_07565                                                            81.3       4e-17
SDRG_08129                                                            80.1       5e-17
PYAP_18709                                                            80.1       5e-17
PHYRA_78689                                                           81.3       6e-17
PHYSO_340332                                                          80.9       7e-17
H257_13550                                                            80.5       7e-17
PHYSO_340333                                                          80.5       7e-17
PHYRA_73583                                                           82.0       1e-16
PITG_04949                                                            80.9       1e-16
PHYSO_533747                                                          78.2       1e-16
SPRG_19916                                                            79.7       2e-16
SPRG_19917                                                            78.6       2e-16
PHYSO_438103                                                          78.6       3e-16
PITG_05271                                                            79.0       3e-16
SDRG_17318                                                            78.2       4e-16
PYVX_18179                                                            75.9       4e-16
PYU1_G007476                                                          76.6       5e-16
PITG_04947                                                            78.6       5e-16
PHYSO_246676                                                          76.6       5e-16
SPRG_22161                                                            78.6       6e-16
PYU1_G014690                                                          78.2       6e-16
PHYKE_10578                                                           77.4       6e-16
PHYSO_533682                                                          77.8       7e-16
PPTG_04620                                                            78.6       8e-16
PYVX_16138                                                            79.0       1e-15
PHYCA_69583                                                           76.3       1e-15
PYAR_20617                                                            76.6       1e-15
PHYCA_127270                                                          77.0       1e-15
PHYSO_255056                                                          76.6       2e-15
PHYKE_6002                                                            74.7       3e-15
PHYRA_86016                                                           75.1       3e-15
PYAP_24691                                                            73.2       4e-15
PPTG_03139                                                            75.9       5e-15
PHYRA_86752                                                           75.9       5e-15
PYU1_G005324                                                          73.6       7e-15
PYU1_G005326                                                          73.6       7e-15
PYU1_G005328                                                          73.6       7e-15
PHYCA_12942                                                           75.9       8e-15
PYU1_G005325                                                          73.6       8e-15
PYAR_14260                                                            73.6       8e-15
PPTG_14221                                                            74.7       9e-15
SDRG_17317                                                            70.9       1e-14
PPTG_07521                                                            73.9       2e-14
PHYRA_83499                                                           75.1       2e-14
PHYCA_98479                                                           73.9       2e-14
PHYRA_77971                                                           72.8       3e-14
PHYRA_85794                                                           72.8       3e-14
PYU1_G005868                                                          73.2       3e-14
PPTG_07507                                                            73.2       5e-14
PPTG_07509                                                            73.2       5e-14
PHYCA_97965                                                           72.8       5e-14
PHYRA_86241                                                           71.2       5e-14
PYAR_14256                                                            71.2       6e-14
PYIR_16443                                                            72.4       6e-14
PYVX_20789                                                            72.4       8e-14
PYIR_16444                                                            70.5       9e-14
PPTG_06256                                                            72.4       9e-14
PYU1_G006403                                                          71.6       1e-13
PHYRA_73581                                                           71.6       1e-13
PHYCA_12943                                                           71.2       2e-13
SDRG_08782                                                            72.4       2e-13
PYIR_22634                                                            70.9       2e-13
PYIW_27477                                                            69.3       2e-13
PHALS_05394                                                           70.9       2e-13
SPRG_04679                                                            70.1       2e-13
PYU1_G006405                                                          70.9       3e-13
SPRG_07627                                                            71.6       3e-13
PHYRA_78175                                                           70.9       3e-13
PITG_08892                                                            70.9       3e-13
PYIW_19151                                                            69.7       4e-13
PHYCA_112615                                                          68.9       4e-13
PPTG_07516                                                            70.5       4e-13
PHALS_04411                                                           70.1       4e-13
PPTG_07520                                                            70.1       4e-13
PHYRA_80631                                                           70.5       4e-13
PYVX_24563                                                            69.3       5e-13
PYVX_18175                                                            67.0       6e-13
PYIR_14463                                                            70.5       6e-13
PYVX_21174                                                            65.5       7e-13
PHYKE_3912                                                            68.9       7e-13
PYIW_18792                                                            66.2       8e-13
PHYCA_15125                                                           69.7       8e-13
PHYRA_80750                                                           69.3       9e-13
PHYKE_9024                                                            69.3       9e-13
PHALS_10635                                                           69.3       1e-12
PHYRA_83494                                                           68.2       1e-12
PHYCA_18657                                                           68.9       1e-12
PPTG_06253                                                            68.9       1e-12
PHYKE_2379                                                            68.9       1e-12
PHYRA_93650                                                           67.8       1e-12
PHYCA_19611                                                           69.7       2e-12
H257_11258                                                            68.9       2e-12
PYAP_22257                                                            67.8       2e-12
PYAP_19707                                                            67.8       2e-12
PYAP_18138                                                            68.2       2e-12
PYIR_24867                                                            68.6       2e-12
PHYCA_122958                                                          67.8       2e-12
PHALS_03179                                                           68.6       2e-12
PHYSO_476077                                                          67.8       3e-12
PHYSO_472009                                                          67.8       3e-12
SDRG_00948                                                            68.6       3e-12
PPTG_06249                                                            67.8       3e-12
PHYKE_1913                                                            67.8       3e-12
PYAR_18165                                                            67.4       3e-12
PHYRA_78626                                                           68.6       3e-12
SPRG_07799                                                            68.2       3e-12
PITG_08202                                                            66.2       3e-12
PHYKE_7717                                                            68.6       4e-12
PHYRA_78625                                                           68.2       4e-12
PHYRA_79140                                                           68.2       4e-12
PPTG_18176                                                            67.0       5e-12
PHYRA_78176                                                           67.0       6e-12
PHYKE_2454                                                            67.4       6e-12
PYIR_23585                                                            66.2       6e-12
PHYKE_5749                                                            67.0       6e-12
PITG_20631                                                            66.6       7e-12
PHYKE_10295                                                           67.0       7e-12
PPTG_10186                                                            66.6       7e-12
PYAP_18713                                                            65.1       7e-12
PHYSO_262844                                                          66.6       8e-12
PYIR_20481                                                            66.6       8e-12
PITG_20312                                                            66.2       9e-12
PHYRA_84732                                                           65.9       1e-11
PHYRA_78174                                                           66.2       1e-11
SDRG_17448                                                            65.9       1e-11
PITG_11936                                                            66.2       1e-11
SDRG_15426                                                            67.0       1e-11
PHYSO_488139                                                          65.5       1e-11
PHALS_03177                                                           65.5       2e-11
PHYKE_2539                                                            65.1       2e-11
PHALS_03176                                                           64.3       2e-11
SPRG_07826                                                            65.9       2e-11
H257_11306                                                            65.9       2e-11
PHYSO_524101                                                          65.5       2e-11
H310_05438                                                            65.9       2e-11
PHYRA_83500                                                           65.9       2e-11
PHYCA_6388                                                            65.1       3e-11
PYAP_19712                                                            64.7       3e-11
PYIW_19601                                                            64.3       3e-11
HYAP_01683                                                            65.1       3e-11
PHYCA_562062                                                          63.9       4e-11
PHYCA_19612                                                           65.5       4e-11
PHYKE_6077                                                            64.7       4e-11
HYAP_14170                                                            64.3       5e-11
PHYSO_324715                                                          64.3       5e-11
PPTG_18166                                                            65.1       5e-11
PPTG_03138                                                            64.3       5e-11
SDRG_00972                                                            64.7       5e-11
PHYKE_6078                                                            64.3       5e-11
SPRG_07825                                                            64.7       6e-11
PPTG_03144                                                            64.3       6e-11
PYU1_G006404                                                          63.9       6e-11
PITG_21641                                                            64.3       6e-11
PHYRA_77293                                                           63.9       6e-11
PHYCA_123316                                                          63.9       7e-11
PHYCA_10471                                                           63.9       7e-11
PHYCA_14559                                                           63.2       8e-11
PHYRA_84947                                                           63.5       8e-11
PYU1_G001524                                                          63.5       9e-11
PPTG_01152                                                            63.2       1e-10
PYIW_24289                                                            62.0       1e-10
PHYKE_6079                                                            63.5       1e-10
PYIW_21964                                                            63.2       1e-10
PHYSO_337515                                                          63.2       1e-10
PYVX_21297                                                            62.8       1e-10
PPTG_01148                                                            63.2       1e-10
H257_11264                                                            62.8       2e-10
PYIW_23030                                                            62.4       2e-10
PHYCA_15124                                                           62.8       2e-10
PHYCA_15126                                                           63.2       2e-10
PHYKE_9023                                                            62.4       2e-10
PHYRA_86751                                                           60.5       2e-10
PPTG_10073                                                            60.8       2e-10
PHYSO_374025                                                          62.4       2e-10
PHYSO_246481                                                          62.4       3e-10
PYIR_17978                                                            61.6       3e-10
PYIW_15526                                                            61.6       3e-10
CCA17179                                                              60.5       3e-10
PHYSO_426658                                                          60.8       3e-10
PHYCA_120062                                                          60.8       4e-10
PHYCA_132255                                                          58.9       4e-10
PHYCA_14560                                                           62.0       4e-10
PYU1_G005866                                                          60.5       4e-10
PYAP_18221                                                            60.8       4e-10
PITG_08895                                                            60.5       4e-10
PITG_01966                                                            62.0       4e-10
PYIR_15187                                                            60.5       4e-10
PYAR_24818                                                            60.5       5e-10
PHYSO_329293                                                          61.6       5e-10
PHYSO_488921                                                          61.6       5e-10
PHYCA_18729                                                           62.0       5e-10
CCI47381                                                              60.5       5e-10
PITG_11937                                                            61.6       5e-10
PYU1_G005869                                                          60.8       6e-10
HYAP_11923                                                            62.0       6e-10
PYAP_22462                                                            60.1       6e-10
PYAR_21940                                                            60.8       6e-10
PYVX_20783                                                            60.8       6e-10
PPTG_04617                                                            61.6       7e-10
PHYRA_78167                                                           60.8       7e-10
PHYSO_255975                                                          59.7       8e-10
H310_05432                                                            60.8       9e-10
H257_11265                                                            60.5       9e-10
PYIW_18794                                                            60.1       9e-10
PHYCA_103479                                                          60.8       1e-09
PHYKE_10296                                                           61.2       1e-09
PPTG_03153                                                            60.5       1e-09
PPTG_04803                                                            60.1       1e-09
PYVX_19277                                                            60.5       1e-09
PYIR_19612                                                            59.7       2e-09
PHYCA_19598                                                           60.1       2e-09
PHYSO_525076                                                          60.1       2e-09
PHYRA_77291                                                           59.3       2e-09
PYAR_16493                                                            59.3       2e-09
PPTG_07511                                                            58.2       2e-09
PYU1_G005985                                                          58.5       2e-09
PHYRA_78161                                                           60.1       2e-09
PPTG_03156                                                            60.1       2e-09
PYIR_20483                                                            59.3       2e-09
PHYRA_78164                                                           59.3       2e-09
PYU1_G005867                                                          58.2       3e-09
PYU1_G001527                                                          59.3       3e-09
PYU1_G001523                                                          59.3       3e-09
PYIW_18065                                                            59.3       3e-09
PYIR_22134                                                            59.3       3e-09
PITG_01969                                                            58.9       3e-09
PYVX_22510                                                            59.7       3e-09
PYIW_24288                                                            58.2       3e-09
PYVX_22508                                                            58.9       3e-09
SPRG_07795                                                            58.9       4e-09
PHYRA_80632                                                           58.5       5e-09
PYIW_26655                                                            58.2       6e-09
PHYKE_7446                                                            58.5       6e-09
PHYRA_86201                                                           58.2       6e-09
PHYCA_552912                                                          58.5       6e-09
PYIR_16437                                                            58.2       7e-09
PYU1_G001475                                                          57.8       7e-09
PHYSO_257305                                                          57.0       7e-09
PYAP_18226                                                            57.4       8e-09
PPTG_03161                                                            58.2       9e-09
PPTG_01147                                                            57.8       9e-09
PPTG_01153                                                            57.8       9e-09
PHYCA_19608                                                           57.8       1e-08
PHYSO_374518                                                          54.7       1e-08
PPTG_04801                                                            57.4       1e-08
PYIR_24421                                                            56.6       1e-08
PYU1_G001526                                                          57.4       1e-08
PHYRA_78162                                                           57.8       1e-08
PHYSO_318693                                                          57.8       1e-08
PYAR_15391                                                            55.8       1e-08
PHYSO_525121                                                          56.2       2e-08
PYAR_17163                                                            54.3       2e-08
PHALS_02041                                                           57.0       2e-08
PPTG_03148                                                            57.0       2e-08
PYIR_22135                                                            57.0       2e-08
PHYRA_77290                                                           57.0       2e-08
PHYKE_6076                                                            56.6       2e-08
PYAR_14261                                                            55.1       2e-08
PYIW_17867                                                            57.0       2e-08
PHYSO_256017                                                          54.7       2e-08
PYAP_16347                                                            55.5       2e-08
PHYRA_78168                                                           56.6       2e-08
PPTG_03145                                                            56.6       3e-08
PHYRA_78177                                                           56.2       3e-08
PHYCA_12944                                                           54.7       3e-08
PYAR_21271                                                            55.5       3e-08
PHYSO_454780                                                          54.7       3e-08
PITG_11944                                                            56.2       3e-08
PHALS_01460                                                           55.8       4e-08
PYAR_17166                                                            53.1       4e-08
HYAP_01682                                                            55.8       4e-08
PYAP_14265                                                            55.8       4e-08
PHALS_02295                                                           55.8       4e-08
PHYSO_489485                                                          53.9       4e-08
PYVX_21643                                                            55.5       4e-08
PHYRA_78172                                                           56.2       5e-08
PPTG_03140                                                            55.8       5e-08
PYU1_G005871                                                          55.5       5e-08
PYU1_G005872                                                          55.5       6e-08
PYIW_18790                                                            52.0       6e-08
PYAP_16994                                                            55.1       6e-08
SPRG_07797                                                            55.5       6e-08
PYIW_16208                                                            55.1       6e-08
PHALS_02044                                                           54.7       6e-08
PYAR_25093                                                            54.3       7e-08
PHYRA_78169                                                           55.5       7e-08
PHYCA_123476                                                          55.1       7e-08
PITG_11942                                                            55.1       8e-08
PYVX_16673                                                            55.5       8e-08
PYU1_G001525                                                          55.1       9e-08
PHYRA_95184                                                           55.5       9e-08
PHYSO_375794                                                          52.4       9e-08
PHYRA_87941                                                           53.1       1e-07
PHYRA_79881                                                           54.3       1e-07
PYAP_16338                                                            54.3       1e-07
PHYRA_86151                                                           53.1       1e-07
PHYKE_6069                                                            54.3       1e-07
PYU1_G006672                                                          50.1       1e-07
PYU1_G001519                                                          53.9       2e-07
PHYRA_78165                                                           54.3       2e-07
PHYKE_7445                                                            54.3       2e-07
SDRG_16534                                                            53.9       2e-07
PYU1_G001518                                                          53.9       2e-07
PYIR_23689                                                            53.1       2e-07
PHYSO_339832                                                          53.5       2e-07
PITG_11957                                                            53.9       2e-07
PPTG_20376                                                            52.4       2e-07
PYU1_G005878                                                          49.7       2e-07
PYAP_23672                                                            53.1       3e-07
H310_05433                                                            53.5       3e-07
H257_11271                                                            53.5       3e-07
PPTG_00483                                                            52.8       3e-07
PPTG_03147                                                            53.1       4e-07
PYVX_23997                                                            52.0       4e-07
PYIR_24935                                                            52.8       4e-07
PYU1_G003057                                                          52.4       4e-07
PYIR_26867                                                            51.2       4e-07
PYIW_25463                                                            52.0       6e-07
PYU1_G005873                                                          51.6       6e-07
PHYCA_10470                                                           52.4       6e-07
PHALS_02296                                                           52.0       7e-07
PPTG_03143                                                            52.4       7e-07
PYVX_22511                                                            52.0       8e-07
PYAP_23455                                                            52.4       8e-07
PPTG_03160                                                            52.4       8e-07
PHALS_05110                                                           50.8       9e-07
SDRG_16535                                                            52.0       9e-07
PYAR_24113                                                            50.8       1e-06
PYU1_G001514                                                          52.0       1e-06
PHYKE_6066                                                            51.6       1e-06
PHALS_01293                                                           51.6       1e-06
PPTG_06106                                                            51.2       1e-06
PHYSO_318683                                                          51.6       1e-06
PITG_19818                                                            49.7       1e-06
PYIR_22133                                                            51.6       1e-06
PYU1_G001516                                                          51.2       1e-06
PHYSO_324755                                                          51.2       1e-06
SPRG_07796                                                            51.2       2e-06
PYVX_22509                                                            51.2       2e-06
PYIR_25999                                                            51.2       2e-06
PHYCA_558591                                                          48.1       2e-06
PYIR_20850                                                            49.7       3e-06
PHYRA_75781                                                           50.1       3e-06
PYU1_G001520                                                          50.4       3e-06
PYAP_23673                                                            50.1       4e-06
PITG_11946                                                            49.7       4e-06
PYIW_16810                                                            49.3       4e-06
PYAP_18584                                                            48.9       5e-06
PYIW_24287                                                            49.7       5e-06
PYU1_G001517                                                          49.7       6e-06
PHYCA_19606                                                           49.3       6e-06
PYIW_20715                                                            49.3       7e-06
PHALS_08575                                                           48.9       8e-06
PYU1_G001528                                                          48.5       1e-05
PYVX_22889                                                            47.0       1e-05
PPTG_09880                                                            47.8       1e-05
PHYCA_559281                                                          46.6       2e-05
PITG_11943                                                            47.0       2e-05
PYU1_G003056                                                          47.4       2e-05
PPTG_22744                                                            46.6       2e-05
PYVX_21644                                                            47.4       2e-05
PHYRA_77292                                                           47.0       2e-05
PYU1_G005862                                                          47.0       2e-05
PYVX_21438                                                            47.8       2e-05
PHALS_02036                                                           47.8       2e-05
PYIW_15528                                                            47.8       3e-05
PHYKE_8104                                                            44.7       3e-05
PYVX_24274                                                            47.0       3e-05
PYAP_16337                                                            47.0       3e-05
PYAR_15390                                                            46.2       3e-05
PYIW_14247                                                            47.0       3e-05
PPTG_13879                                                            47.0       4e-05
PHYSO_342361                                                          45.4       4e-05
PHYCA_19599                                                           47.0       5e-05
PHYKE_9025                                                            46.6       5e-05
PYIR_25334                                                            46.2       6e-05
PYIW_21963                                                            46.6       6e-05
PHALS_02037                                                           46.6       6e-05
PYAP_24338                                                            45.8       7e-05
PITG_11951                                                            45.1       8e-05
PYAR_22574                                                            43.5       8e-05
PYAP_20077                                                            45.4       8e-05
PYIR_25275                                                            45.1       1e-04
PYAR_22058                                                            45.1       1e-04
PYAP_16351                                                            45.4       1e-04
PYU1_G007242                                                          45.4       1e-04
PYU1_G007254                                                          44.7       1e-04
PHYCA_97699                                                           45.4       1e-04

>HYAP_07096
Length=251

 Score = 525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%), Gaps = 0/251 (0%)

Query  1    MTLFPQIFSGKGNRAENRRSTADFQDAMSHNYFLVCTYRMTLVSITSKRRYVRSPSPPIT  60
            MTLFPQIFSGKGNRAENRRSTADFQDAMSHNYFLVCTYRMTLVSITSKRRYVRSPSPPIT
Sbjct  1    MTLFPQIFSGKGNRAENRRSTADFQDAMSHNYFLVCTYRMTLVSITSKRRYVRSPSPPIT  60

Query  61   LFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIE  120
            LFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIE
Sbjct  61   LFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIE  120

Query  121  AQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLD  180
            AQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLD
Sbjct  121  AQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLD  180

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYK  240
            GPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYK
Sbjct  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYK  240

Query  241  NCIGLGRNVTA  251
            NCIGLGRNVTA
Sbjct  241  NCIGLGRNVTA  251

>PHYCA_537323
Length=200

 Score = 275 bits (704),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 152/181 (84%), Gaps = 2/181 (1%)

Query  72   CVTGQR-LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGY  130
            CVTGQR L + L EGQVV +P P FIVD    QG ALAYLQEQG++TSIEAQSW ++HGY
Sbjct  21   CVTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGY  80

Query  131  VSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDT  190
             SLRAMLDD+SLY V+++AIF+CG TS  +ET Q IPTN + ++SGYTLDGPCEVW DDT
Sbjct  81   TSLRAMLDDESLYQVTEEAIFECGLTSPKTET-QPIPTNNSFQTSGYTLDGPCEVWLDDT  139

Query  191  QVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVT  250
            +V++GRNC TEFP GQHQVDYSSCG+SCTL WYWLGI+Y++GIYSWQVYKNC+GLG   T
Sbjct  140  KVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAAT  199

Query  251  A  251
            A
Sbjct  200  A  200

>PPTG_17123
Length=201

 Score = 270 bits (689),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 2/180 (1%)

Query  73   VTGQR-LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYV  131
            + GQR L + L EGQVVL+P P F+VD    QG ALAYLQEQG++TSIEAQSW Q+HGY 
Sbjct  23   IAGQRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYT  82

Query  132  SLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQ  191
            SLRAMLDD+SLY V+++AIF+CG TS  +ET Q IPTN + ++SGYTLDGPCEVW DDT+
Sbjct  83   SLRAMLDDESLYKVTEEAIFECGLTSPRTET-QPIPTNNSFQTSGYTLDGPCEVWLDDTK  141

Query  192  VTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVTA  251
            V+SGRNC TEFPHGQH+VDYSSCG +CTL WYWLGI+Y++GIYSWQVYKNC+GL    TA
Sbjct  142  VSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201

>PHYRA_81105
Length=201

 Score = 269 bits (688),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 2/180 (1%)

Query  73   VTGQR-LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYV  131
            + GQR L + L EGQ+VL+P P FIVD    QG ALAYLQEQG++TSIEAQ W Q+HGY 
Sbjct  23   IAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYA  82

Query  132  SLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQ  191
            SLR+MLDD+SLY V+++AIFDCG TS  +ET Q IPTN + +SSGYTLDGPCEVW DDT+
Sbjct  83   SLRSMLDDESLYQVTEEAIFDCGLTSPKTET-QLIPTNSSFQSSGYTLDGPCEVWLDDTK  141

Query  192  VTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVTA  251
              +GRNC TEFPHGQHQ+DYS+CG +C LRWYWLGI+Y++G YSWQVYKNCI LG+  TA
Sbjct  142  AAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201

>PITG_18452
Length=856

 Score = 280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 165/215 (77%), Gaps = 4/215 (2%)

Query  38   YRMTLVSITSKRRYVRSPSPPITLFHLLALSLSVCVTGQR-LTSDLSEGQVVLYPSPHFI  96
            Y  T + I++  R   S S P + F LL   L  CV GQR L + L EGQ+VL+P P F+
Sbjct  645  YFRTSIFISTNMRL--SGSFPCSTFLLLLALLPACVAGQRRLDAGLGEGQIVLHPPPFFV  702

Query  97   VDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFT  156
            VD    QG ALAYLQEQGI+TSIEAQSW Q+ GY SLRAMLDD+SLY V+++AIF+CG T
Sbjct  703  VDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLT  762

Query  157  SLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGD  216
            S  +ET Q IPTN + ++SGYTLDGPCE+W DDT+V SGRNC TEFPHGQHQVDYSSCG 
Sbjct  763  SPRTET-QPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGG  821

Query  217  SCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVTA  251
            SC L WYWLGI+Y++GIYSWQVYKNC+GL +N TA
Sbjct  822  SCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856

>PHYSO_353401
Length=146

 Score = 237 bits (605),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 127/146 (87%), Gaps = 1/146 (1%)

Query  106  ALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQD  165
            ALAYLQEQG++TSIEAQSW QEHGY SLRAMLDD+SLY V+++A+FDCG TS  +ET Q 
Sbjct  2    ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTET-QP  60

Query  166  IPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWL  225
            IP+N + ++SGYTLDGPCEVW DDT+V +GRNC T+FPHGQH++DYS+CGDSCTL WYWL
Sbjct  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120

Query  226  GIQYMDGIYSWQVYKNCIGLGRNVTA  251
            GI+Y++G YSWQVYKNC+ L +  TA
Sbjct  121  GIKYVEGAYSWQVYKNCVALSKTATA  146

>PYVX_18173
Length=500

 Score = 224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 130/180 (72%), Gaps = 1/180 (1%)

Query  66   ALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWK  125
            A ++ +C   +RL S L EGQVVLYP P F+VD    +G  +AYL++QG+ T+IEAQ+W 
Sbjct  18   AGAVELCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWL  77

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEV  185
             E GY +LRA++DD  LY V+++ +FDCG T  P+   Q IPTNG+  +SGYTLDGPCE+
Sbjct  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLT-FPNTETQPIPTNGSFITSGYTLDGPCEI  136

Query  186  WFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            W D+T   +GRNC TEFP G H +DYS CG+SC + W+WLGI+Y    YSWQV+KNCI L
Sbjct  137  WIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196

 Score = 147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 99/158 (63%), Gaps = 2/158 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+V+ P+P + V+    + K LA+L+ Q   T+ +   +   +G+ SLRA +DD SLY V
Sbjct  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CGFT  P    Q IP +G + S+GYT DGPCEVW DDT+V    NC       
Sbjct  296  NASADFRCGFTD-PDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
             + +DYS+C  SCTL WYWLG++Y+  +YSWQVYK C+
Sbjct  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391

>PYU1_G001739
Length=266

 Score = 193 bits (491),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 116/165 (70%), Gaps = 1/165 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q++++P P F+VD    Q K LA+L+ QG++TS +   + ++ GY +LRA++DD+ LY V
Sbjct  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            + DA+F+CG+T  P+   Q IPT GT+ S+GYT DGPCEVW DD +V SG NC  +FP  
Sbjct  85   NTDALFECGYTD-PTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGK  143

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVT  250
               +DYSSC  SCTLRWYWLG++Y+   YSWQ+YK C+ L  N +
Sbjct  144  TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNAS  188

>PYU1_G001741
Length=199

 Score = 176 bits (445),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 117/191 (61%), Gaps = 6/191 (3%)

Query  56   SPPITLFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGI  115
            +P IT     +L     V+   L +     Q V+ P+P F V     Q   LA+L+ QG 
Sbjct  2    APSITK----SLVFGALVSSATLYNTADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGF  57

Query  116  DTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESS  175
            +T+ +  ++ +  GY +LRA +DD+  Y V+  A F+CG+T L   T Q IP  GT+ S+
Sbjct  58   ETTADFNAYYKAKGYKTLRAFMDDKKAYTVASGADFECGWTKLDG-TRQSIPA-GTIRST  115

Query  176  GYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYS  235
            GYT DGPCEVW D T+V  G NC TEF    H +DYSSC  SCTLRWYW+GI+++ G YS
Sbjct  116  GYTHDGPCEVWLDSTRVMKGNNCHTEFTGTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYS  175

Query  236  WQVYKNCIGLG  246
            WQVYKNC+ +G
Sbjct  176  WQVYKNCVPIG  186

>PYU1_G001738
Length=226

 Score = 175 bits (444),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 107/161 (66%), Gaps = 1/161 (1%)

Query  88   VLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSK  147
            VLYP P ++VD    Q   +A+L+EQGI TS +   + ++ GY +LRAMLDDQ LY+V+ 
Sbjct  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84

Query  148  DAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH  207
            DA+ +CG+T  P+   Q IP      S+GY L+GPCEVW DD +V S  NC T++P    
Sbjct  85   DALDECGYTD-PTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNF  143

Query  208  QVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRN  248
             +DYSSC  SC LRWYWLGIQ ++  YSWQVYK C+ L  N
Sbjct  144  MLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGN  184

>PYIR_25089
Length=262

 Score = 174 bits (442),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 116/179 (65%), Gaps = 2/179 (1%)

Query  66   ALSLSVCVTGQRL-TSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSW  124
            +L+L+  V+   L  + +   Q V+ P+P F V     Q   LA+L+ QG  T+ +  ++
Sbjct  8    SLALAAIVSSAALYDTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAY  67

Query  125  KQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCE  184
             +  GY +LRA +DD+S Y V+  A F+CG+T L + T Q IP+  T+ S+GYT DGPCE
Sbjct  68   YKAKGYKTLRAFMDDKSAYKVADGADFECGWTKL-AGTPQPIPSASTVRSTGYTHDGPCE  126

Query  185  VWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            VW D T+V  G NC +EFP    ++DYSSC  SC LRWYW+GI+++ G YSWQVYKNC+
Sbjct  127  VWLDKTRVLKGTNCHSEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCV  185

>PYU1_G001744
Length=213

 Score = 172 bits (437),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 106/161 (66%), Gaps = 2/161 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q V+ P+P F V     Q   LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  Y V
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKV  88

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CG+T L  +  Q IP  GT+ S+GYT DGPCEVW D+T V  G NC +EFP  
Sbjct  89   AAGADFQCGWTKLDGKR-QPIPA-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGT  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLG  246
             H++ Y+SC  SCTLRWYW+GI+++ G YSWQVYKNC+ +G
Sbjct  147  THKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG  187

>PYU1_G001742
Length=213

 Score = 171 bits (433),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 106/161 (66%), Gaps = 2/161 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q V+ P+P F V     Q   LA+L+ QG  T+++  ++ +  GY +LRA +DD   Y V
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKV  88

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CG+T L  +  Q IP  GT+ S+GYT DGPCEVW D T+V  G NC +EFP  
Sbjct  89   AAGADFQCGWTKLDGKR-QPIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGT  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLG  246
              ++DYSSC  SCTLRWYW+GI+++ G YSWQVYKNC+ +G
Sbjct  147  TFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG  187

>PPTG_10635
Length=199

 Score = 168 bits (426),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 102/160 (64%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  +D   +   LA+L+ QG  T  + +SW+ E+GY SLR  +D ++ Y V
Sbjct  12   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEV  70

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CGFT  P  T Q IP    + S+GYT DGPCEVW DDT V  G NC  +FP  
Sbjct  71   TSGADFSCGFTD-PKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  129

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + VDYSSC  SCTLRWYWLG++++   YSWQVYK CI L
Sbjct  130  DYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPL  169

>PHYRA_85631
Length=228

 Score = 169 bits (427),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 102/160 (64%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            QVVL P P +  DD   +   LA+L+ +G  T  +  SW+ E+GY SLR  +D+ + Y+V
Sbjct  29   QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CGFT  P  T Q IP    + S+GYT DGPCEVW DDT V  G NC  +FP  
Sbjct  88   ADGADFSCGFTD-PKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + VDYSSC  +CTLRWYWLGI+++   YSWQVYK CI L
Sbjct  147  DYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPL  186

>PPTG_10636
Length=246

 Score = 168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 112/181 (62%), Gaps = 3/181 (2%)

Query  66   ALSLSVCVTGQRLTSDLSEG-QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSW  124
            AL+++  ++   L + +++  Q+VL P P +  +D   +   LA+L+ QG  T  +  SW
Sbjct  8    ALAVATTLSSMALLAPMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSW  67

Query  125  KQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCE  184
            + E+ Y SLR  +D+ + Y V+  A F CGFT  P  T Q IP    + S+GYT DGPCE
Sbjct  68   RNENNYKSLRDFMDN-AKYEVTSGADFSCGFTD-PKGTPQPIPAGNAMRSTGYTHDGPCE  125

Query  185  VWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
            VW DDT V  G NC  +FP   + VDYSSC  +CTLRWYWLGI+++   YSWQVYK CI 
Sbjct  126  VWLDDTMVLDGENCHEKFPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIP  185

Query  245  L  245
            L
Sbjct  186  L  186

>PHYRA_84190
Length=206

 Score = 166 bits (421),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 102/160 (64%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  DD   +   LA+L+ +G  T  +  +W+ E+GY SLR  +D+ + Y V
Sbjct  12   QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSV  70

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CGFT  P  T Q IP +  + S+GYT DGPCEVW DDT V  G NC  +FP  
Sbjct  71   TNGADFSCGFTD-PKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGK  129

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + VDYSSC  +CTLRWYW+G++++   YSWQVYK CI L
Sbjct  130  DYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPL  169

>PHYSO_536424
Length=197

 Score = 166 bits (419),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 107/170 (63%), Gaps = 2/170 (1%)

Query  76   QRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRA  135
            +R   D++  Q+VL P P +  +D   +   LA+L+ +G  T  +  +W++E+GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  136  MLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSG  195
             +D ++ Y V+  A F CGFT  P  T Q IP    + S+GYT DGPCEVW DDT V  G
Sbjct  74   FMD-RAKYDVTSGADFSCGFTD-PKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDG  131

Query  196  RNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             NC  +FP   + VDYSSC  +CTLRWYWLG++++   YSWQVYK CI L
Sbjct  132  DNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  181

>PHYSO_507031
Length=197

 Score = 166 bits (419),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 107/170 (63%), Gaps = 2/170 (1%)

Query  76   QRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRA  135
            +R   D++  Q+VL P P +  +D   +   LA+L+ +G  T  +  +W++E+GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  136  MLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSG  195
             +D ++ Y V+  A F CGFT  P  T Q IP    + S+GYT DGPCEVW DDT V  G
Sbjct  74   FMD-RAKYDVTSGADFSCGFTD-PKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDG  131

Query  196  RNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             NC  +FP   + VDYSSC  +CTLRWYWLG++++   YSWQVYK CI L
Sbjct  132  DNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  181

>PHYSO_341599
Length=185

 Score = 165 bits (417),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 102/160 (64%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  +D   +   LA+L+ QG  T  +  +W++E+GY SLR  +D ++ Y V
Sbjct  12   QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDV  70

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CGFT  P  T Q IP    + S+GYT DGPCEVW DDT V  G NC  +FP  
Sbjct  71   TSGADFSCGFTD-PKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  129

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + VDYSSC  +CTLRWYWLG++++   YSWQVYK CI L
Sbjct  130  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  169

>PHYCA_14369
Length=248

 Score = 167 bits (422),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 101/161 (63%), Gaps = 2/161 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  +D   +   LA+L+ QG  T  +  +W+ E+GY SLR  +D ++ Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CGFT  P  T Q IP    + S+GYT DGPCEVW DDT V  G NC  +FP  
Sbjct  88   TNGADFSCGFTD-PKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLG  246
             + VDYSSC  +CTLRWYWLG++++   YSWQVYK CI L 
Sbjct  147  DYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLA  187

>PYIW_18788
Length=244

 Score = 166 bits (421),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 107/165 (65%), Gaps = 2/165 (1%)

Query  88   VLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSK  147
            V YP P F++D       ++A L++Q + TS +   + ++ GY SLRAMLDD++LY V+ 
Sbjct  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89

Query  148  DAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH  207
            D+IF+CG+T  P+   Q IPTNG L  +GY  DGPCE+W DD ++ S  NC+ +FP    
Sbjct  90   DSIFECGYTD-PTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148

Query  208  QVDYSSCGDSCTLRWYWLGI-QYMDGIYSWQVYKNCIGLGRNVTA  251
            ++DYSSC   CTLRWY L + +   G YSW+VYKNC+ L    TA
Sbjct  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSDEPTA  193

>PYU1_G001740
Length=206

 Score = 164 bits (416),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 107/162 (66%), Gaps = 3/162 (2%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+V+ P+P F V     +   LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  Y V
Sbjct  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            + +A F+CG+T+  +   Q IP N    ++GYT DGPCEVW D+T+V SG NC  +FP  
Sbjct  89   NSNADFECGYTN-KNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGK  145

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGR  247
             H + Y++C  SCTLRWYW+GI+++ G +SWQVYK C+ LGR
Sbjct  146  THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGR  187

>PYIR_26626
Length=212

 Score = 162 bits (410),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 115/183 (63%), Gaps = 4/183 (2%)

Query  66   ALSLSVCVTGQRLT-SDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSW  124
            +L+L+  V+   L  S +   Q V+ P+P F   D  +    LA+L+ QG  T+ +   +
Sbjct  8    SLALAAIVSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGY  67

Query  125  KQEHGYVSLRAMLDDQSLYHV-SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPC  183
             +  GY +LRA +DD+  Y V +  A F+CG+T++  +  Q IP  GT+ S+GYT DGPC
Sbjct  68   IKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKR-QPIPA-GTIRSTGYTHDGPC  125

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            EVW D+T+V SG NC  +FP   H + Y+SC  SCTLRWYW+G++++   +SWQVYK C+
Sbjct  126  EVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185

Query  244  GLG  246
             +G
Sbjct  186  PIG  188

>PHYCA_102624
Length=195

 Score = 161 bits (408),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 100/160 (63%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            QVVL P P +  D+   Q K L +L+  G  T  +  +W++E+GY SLR  +D+ + Y V
Sbjct  29   QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN-AKYPV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            S+ A F CGFT  P+ T Q IP    + S+GYT DGPCEVW DDT V  G NC  +FP  
Sbjct  88   SEGADFKCGFTD-PNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGK  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + +DYS C   CTL WYWLG++++   YSWQVYK CI L
Sbjct  147  DYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPL  186

>PPTG_10634
Length=208

 Score = 162 bits (409),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 100/160 (63%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  +D   +   LA+L+ +G  T  +  +W++E+GY SLR  LD+   Y V
Sbjct  29   QIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK-YPV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CGFT  P  T Q IP    + S+GYT DGPCEVW DDT V  G NC  +FP  
Sbjct  88   TDGADFKCGFTD-PKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + VDYSSC  +CTL WYWLG++++   YSWQVYK CI L
Sbjct  147  DYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PPTG_10643
Length=250

 Score = 162 bits (410),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 111/181 (61%), Gaps = 3/181 (2%)

Query  66   ALSLSVCVTGQRLTSDLSEG-QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSW  124
            A +++  ++G  L    ++  Q+VL P P +  +D   +   LA+L+ QG     +  +W
Sbjct  8    ACAVAATLSGMALVLPTTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAW  67

Query  125  KQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCE  184
             +E+GY SLR  +D ++ Y V+  A F CGFT+ P  T Q IP  G + S+GYT DGPCE
Sbjct  68   SKENGYKSLRDFMD-RAKYEVTPGADFSCGFTN-PKGTPQPIPAQGIMRSTGYTHDGPCE  125

Query  185  VWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
            V+ DDT V  G NC  +FP     +DYSSC  +CTLRWYWLGI+++   YSWQVYK CI 
Sbjct  126  VYLDDTLVLQGDNCHEKFPGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIP  185

Query  245  L  245
            L
Sbjct  186  L  186

>PHYCA_102852
Length=195

 Score = 159 bits (403),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 102/160 (64%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  +D   +   LA+L+ +G  T  +  +W+ E+GY SLR  +D ++ Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            ++ A F CGFT  P+ T Q IP    + S+GYT DGPCEVW DDT V  G NC  +FP  
Sbjct  88   TEGADFKCGFTD-PNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGK  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + +DYSSC  +CTL W+WLG++++   YSWQVYK CI L
Sbjct  147  GYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPL  186

>PHALS_00498
Length=199

 Score = 159 bits (402),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 110/172 (64%), Gaps = 2/172 (1%)

Query  78   LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAML  137
            L  +++  Q+VL P P +  +D   +   LA+L+ Q   T+ +AQ++ +++ + +LR  +
Sbjct  21   LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  80

Query  138  DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRN  197
            D+ + Y V K A   CGFT  P+ T Q IP N  + S+GYT DGPCEVW ++T+V S  N
Sbjct  81   DN-AKYTVVKGADPACGFTD-PNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASN  138

Query  198  CRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNV  249
            C  +FP   + +DYSSC D+C LRWYWLG++++   YSWQVYK CI L R+ 
Sbjct  139  CHEKFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSA  190

>PHYRA_81107
Length=202

 Score = 158 bits (400),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 109/180 (61%), Gaps = 4/180 (2%)

Query  66   ALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWK  125
            +LS  + ++   L +D    QVVL P+P +  DD   +   LA+L++QG  T  +  +W+
Sbjct  8    SLSAGIVLSSAALLADAH--QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWR  65

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEV  185
            +E+GY SLRA  DD + Y VS  A F CGFT +  +  Q IP    + S+GYT DGPCEV
Sbjct  66   EENGYDSLRA-FDDGASYTVSDGADFTCGFTDINGDV-QAIPDGNAMRSTGYTHDGPCEV  123

Query  186  WFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            W DDT V    NC        + +DYSSC  +CTL W+W+G++Y++  YSWQVYK C+ L
Sbjct  124  WLDDTMVMQYDNCHEVISGKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPL  183

>PPTG_10048
Length=190

 Score = 158 bits (399),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 115/194 (59%), Gaps = 9/194 (5%)

Query  58   PITLFHLLALSLSVCVTGQRLTSDLSEG-QVVLYPSPHFIVDDPTIQGKALAYLQEQGID  116
            P+T   L  LS +       L   L+E  QVVL+P+P +I D+   Q   LA+L+ QG  
Sbjct  3    PLTFIKLCGLSAAA------LAWPLTEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFK  56

Query  117  TSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSG  176
            T  + +SW+ ++GY +LR  ++  + Y V++ A F CG+T+ P  T Q IP  G + S+G
Sbjct  57   TQEDFKSWRIQNGYKTLRDFME-HAKYTVTEGADFSCGWTN-PKGTPQPIPAGGIMRSTG  114

Query  177  YTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSW  236
            YT +GPCE+W  DTQV    NC    P  ++ +DYS C  +C L WYWLG++++   YSW
Sbjct  115  YTHEGPCEMWVADTQVYQADNCHVSLPGKEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSW  174

Query  237  QVYKNCIGLGRNVT  250
            QVYK CI L  N T
Sbjct  175  QVYKECIPLTTNST  188

>PHYKE_8388
Length=205

 Score = 158 bits (399),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 98/160 (61%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            QVVL PSP +  DD   +   LA+L++QG  T  +  +W+ ++GY SLRA  DD S Y V
Sbjct  29   QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS-YTV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            S  A F CGFT +     Q IP +  + S+GYT DGPCEVW DDT V    NC       
Sbjct  88   SDGADFTCGFTDINGAA-QPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGK  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + +DYSSC  +CTL W+W+G++Y+   YSWQVYK C+ L
Sbjct  147  DYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPL  186

>PHYCA_102550
Length=268

 Score = 159 bits (402),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 99/161 (61%), Gaps = 2/161 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            QVVL P+P +  D+   Q   LA+L+ QG  T  +  +W+ E+GY SLR  +D ++ Y V
Sbjct  29   QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
               A F CG+T  P+ T Q IP    + S+GYT DGPCEVW DDT V  G NC  +FP  
Sbjct  88   RNGADFKCGYTD-PNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGK  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLG  246
             + +DYS C   CTL WYWLG++++   YSWQVYK CI L 
Sbjct  147  GYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLA  187

>PHYKE_3446
Length=199

 Score = 155 bits (393),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 116/191 (61%), Gaps = 7/191 (4%)

Query  56   SPPITLFHLLALSLSVCVTGQRLTSDLSEG-QVVLYPSPHFIVDDPTIQGKALAYLQEQG  114
            +PP+     +  +LS    G  + + +++  Q+VL P P +  D   I+   LA+L+ QG
Sbjct  2    APPLASVFTVVAALS----GAAVIAPITDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQG  57

Query  115  IDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLES  174
              T  +A +W++++GY +LRA +D  + Y V++ A + CG+T  P+ T Q IP  G + S
Sbjct  58   FATQEDANAWRRDNGYKTLRAFMD-MAKYQVTEGADYFCGWTD-PNGTAQPIPEGGAMRS  115

Query  175  SGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
            +GYT DGPCEVW D+T+V    NC        + +DYS+C  +C LRWYWLG++++   Y
Sbjct  116  TGYTHDGPCEVWIDNTRVLESGNCHETITGKDYTIDYSACQGTCMLRWYWLGVRFLKNSY  175

Query  235  SWQVYKNCIGL  245
            SWQVYK CI L
Sbjct  176  SWQVYKACIPL  186

>PHYKE_8389
Length=204

 Score = 155 bits (391),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 112/183 (61%), Gaps = 3/183 (2%)

Query  64   LLALSLSVCVTGQRLTSDLSEG-QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQ  122
            L +LS++  ++   L +  ++  QVVL P+P +  DD   +   LA+L+ QG +T  +  
Sbjct  5    LASLSVAAVLSSAALLAPTADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFN  64

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGP  182
            +W++ +GY +LRA +D    Y V+  A + CGFT+  +   Q IP+   + S+GYT DGP
Sbjct  65   AWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAP-QAIPSGNAMRSTGYTHDGP  122

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNC  242
            CEVW D T+V +  NC        + +DYSSC  +CTLRWYWLG++++   YSWQVYK C
Sbjct  123  CEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKAC  182

Query  243  IGL  245
            + L
Sbjct  183  VPL  185

>PHYSO_284086
Length=204

 Score = 154 bits (389),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 102/160 (64%), Gaps = 3/160 (2%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            QVVL P+P +  DD   +   LA+L+ QG +T  +  +W+++ GY +LRA +D  S Y V
Sbjct  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A + CGFT +     Q IP +GT+ S+GYT DGPCEVW D T+V    NC   F   
Sbjct  88   ADGADYYCGFTDIKGVA-QPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGK  145

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + +DYSSC  SCTLRWYWLG++++   YSWQVYK C+ L
Sbjct  146  TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185

>PHYRA_82864
Length=193

 Score = 153 bits (387),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 118/188 (63%), Gaps = 4/188 (2%)

Query  59   ITLFHLLALSLSVCVTGQRLTSDLSEG-QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDT  117
            +TL  +  L+++  +    L +  ++  QVVL P P +  D+   +   LA+L+ QG  T
Sbjct  1    MTLSLVPTLAVATGLASAALLAPTADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFAT  60

Query  118  SIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGY  177
              +  +W++++GY +LR  +D ++ Y V++ A + CG+T  P+ T Q IP  G + S+GY
Sbjct  61   QGDFNAWRRDNGYKTLRDFMD-RAKYTVTEGADYFCGWTD-PNGTPQPIPA-GNMRSTGY  117

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQ  237
            T DGPCEVW D+T+V  G NC  +FP   + +DYSSC  +CTL WYW+G++++   YSWQ
Sbjct  118  THDGPCEVWLDNTRVLQGDNCHEQFPDKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQ  177

Query  238  VYKNCIGL  245
            VYK CI L
Sbjct  178  VYKECISL  185

>PHYSO_477820
Length=202

 Score = 153 bits (387),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 108/180 (60%), Gaps = 4/180 (2%)

Query  66   ALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWK  125
            +LS +  ++G  L +     QVVL P+P +  DD   +   LA+L++QG  T  +  +W+
Sbjct  8    SLSAAAVLSGAALLA--GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWR  65

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEV  185
             ++GY SLRA  +D + Y V+  A F CGFT+   E  Q IP +  + S+GYT DGPCEV
Sbjct  66   TDNGYDSLRA-FNDGASYTVADGADFTCGFTNTNGEV-QPIPDDNAMRSTGYTHDGPCEV  123

Query  186  WFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            W DDT V    NC        + +DYSSC  +CTL W+WLG++Y+   YSWQ+YK C+ L
Sbjct  124  WLDDTMVMQYDNCHESISGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  183

>PHYCA_511409
Length=204

 Score = 152 bits (383),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 99/160 (62%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            QVVL P+P +  DD   +   LA+L++QG  T  +  +W+Q++GY SLRA  +D + Y V
Sbjct  28   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTV  86

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            S  A F CGFT+   +  Q IP    + S+GYT DGPCEVW DDT V    NC       
Sbjct  87   SDGADFTCGFTNKNGDV-QAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGK  145

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + +DYSSC  +CTL W+WLG++Y+   YSWQ+YK C+ L
Sbjct  146  DYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  185

>PPTG_15264
Length=194

 Score = 150 bits (380),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 107/183 (58%), Gaps = 4/183 (2%)

Query  65   LALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSW  124
            L  +L+V  T           Q+VL P P +  D+  I+   LA+L+ QG  T  +  +W
Sbjct  5    LVSTLAVAATLSCAVLSTDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAW  64

Query  125  KQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCE  184
            ++++GY +LR  +D ++ Y V++ A + CG+T  P  T Q IP  G + S+GYT DGPCE
Sbjct  65   RRDNGYKTLRDFMD-RAKYTVTEGADYFCGWTD-PKGTPQPIPAGGAMRSTGYTHDGPCE  122

Query  185  VWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDS--CTLRWYWLGIQYMDGIYSWQVYKNC  242
            VW DD +V  G NC    P   + +DYSSC     C LRWYWLG++++   YSWQVYK C
Sbjct  123  VWLDDVRVLEGGNCHESIPGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKEC  182

Query  243  IGL  245
            I L
Sbjct  183  IPL  185

>PPTG_17366
Length=194

 Score = 150 bits (380),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 107/183 (58%), Gaps = 4/183 (2%)

Query  65   LALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSW  124
            L  +L+V  T           Q+VL P P +  D+  I+   LA+L+ QG  T  +  +W
Sbjct  5    LVSTLAVAATLSCAVLSTDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAW  64

Query  125  KQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCE  184
            ++++GY +LR  +D ++ Y V++ A + CG+T  P  T Q IP  G + S+GYT DGPCE
Sbjct  65   RRDNGYKTLRDFMD-RAKYTVTEGADYFCGWTD-PKGTPQPIPAGGAMRSTGYTHDGPCE  122

Query  185  VWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDS--CTLRWYWLGIQYMDGIYSWQVYKNC  242
            VW DD +V  G NC    P   + +DYSSC     C LRWYWLG++++   YSWQVYK C
Sbjct  123  VWLDDVRVLEGGNCHESIPGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKEC  182

Query  243  IGL  245
            I L
Sbjct  183  IPL  185

>PHYKE_7718
Length=220

 Score = 151 bits (382),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 96/160 (60%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  DD   +   LA+L+ +G     +  +W+ E+GY SLR  +D+   Y V
Sbjct  33   QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAK-YSV  91

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A   CGFT  P+ T Q IP    + S+GYT DGPCEVW DDT      NC   FP  
Sbjct  92   TSGADSACGFTD-PNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGK  150

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + +DYS+C  +CTLRWYWLG++++   YSWQVYK CI L
Sbjct  151  DYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPL  190

>PPTG_17121
Length=202

 Score = 150 bits (378),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 110/183 (60%), Gaps = 4/183 (2%)

Query  63   HLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQ  122
            H+ +LS +V ++   L ++    QVVL  +P +  DD   +   LA+L++QG  T  +  
Sbjct  5    HVSSLSTAVVLSSATLLANAH--QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFT  62

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGP  182
            +W++++GY SLRA  +D + Y VS  A   CGFT++  +  Q IP    + S+GYT DGP
Sbjct  63   AWRKDNGYDSLRA-FNDGASYTVSDGADLTCGFTNINGDV-QPIPDGNAMRSTGYTHDGP  120

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNC  242
            CEVW DDT V    NC        + +DYSSC  +CTL W+WLG++Y+   YSWQ+YK C
Sbjct  121  CEVWLDDTMVMQYDNCHEAISGKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKAC  180

Query  243  IGL  245
            + L
Sbjct  181  VPL  183

>PPTG_17122
Length=204

 Score = 149 bits (377),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 4/183 (2%)

Query  64   LLALSLSVCVTGQRLTSDLSEG-QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQ  122
            L +LS++  ++   L +  S   QVVL P+P +  D+   +   LA+L+ QG +T  +  
Sbjct  6    LSSLSVAAVLSSAALLAPTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFN  65

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGP  182
             W++ +GY +LR  +D ++ Y V+  A + CGFT++ +   Q IP +GT+ S+GYT DGP
Sbjct  66   GWRRNNGYKTLRDFMD-RAKYTVTDGADYYCGFTNVNAAP-QPIP-DGTMRSTGYTHDGP  122

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNC  242
            CEVW D  +V    NC        + +DYSSC  +CTLRWYWLG++Y+   YSWQ+YK C
Sbjct  123  CEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKAC  182

Query  243  IGL  245
            I L
Sbjct  183  IPL  185

>PHYCA_129425
Length=204

 Score = 149 bits (377),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 99/160 (62%), Gaps = 3/160 (2%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            QVVL P+P +  D+   +   LA+L+ QG  T  +   W++ +GY +LRA +D    Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-YTV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A + CGFT+  +   Q IP +GT+ S+GYT DGPCEVW D T+V    NC   FP  
Sbjct  88   TDGADYYCGFTNAKAAP-QPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + +DYSSC  SC LRWYWLG +++   +SWQVYK CI L
Sbjct  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185

>PHYRA_81106
Length=202

 Score = 145 bits (367),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 99/160 (62%), Gaps = 2/160 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            QVVL P+P +  D    +   LA+L+ QG +T  +  +W++ +GY +LRA +D  + Y V
Sbjct  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMD-GAKYTV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A + CGFT+  + T Q IP    + S+GYT DGPCEVW D T+V +  NC       
Sbjct  88   ADGADYYCGFTNADA-TPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  146

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + +DYSSC  +CTL WYW+G++Y+   YSWQVYK C+ L
Sbjct  147  DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186

>PHYKE_8390
Length=130

 Score = 143 bits (360),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 1/108 (1%)

Query  76   QRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRA  135
            +RL ++L EGQ+VL P P FIVD    QG ALAYLQEQG++TSIE Q W   HGY SLRA
Sbjct  21   RRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRA  80

Query  136  MLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPC  183
            MLDD++LY V+++A+FDCG TS  +ET Q IPTN T ++SGYT+DGPC
Sbjct  81   MLDDEALYKVTEEALFDCGLTSPKTET-QLIPTNSTFQTSGYTMDGPC  127

>PYIW_18791
Length=194

 Score = 144 bits (362),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 3/161 (2%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q V  P P++ V         L++L++ G+ TS     + ++ GY +LRA++DD  LY  
Sbjct  23   QAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLYKT  82

Query  146  SKDA-IFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPH  204
            + +A  F CG+T  PS+  Q IP + T+ ++GYT  GPCEVW DD +V +G NC  +  +
Sbjct  83   NSNADNFLCGYTD-PSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQVSN  141

Query  205  GQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
               +VDYS+C   CT+RWYWLG++Y+   +SWQVYKNCI L
Sbjct  142  -TTKVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIAL  181

>PITG_18450
Length=203

 Score = 143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 110/186 (59%), Gaps = 7/186 (4%)

Query  60   TLFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSI  119
            ++F  L ++ +V  +G+ L    +  QVVL PSP +  DD   +   L +L+ QG +T  
Sbjct  4    SVFSSLVVA-AVLSSGELLAPTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVE  62

Query  120  EAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTL  179
            +   W++ +GY +LR  ++    Y V+  A + CGFT++ +   Q  P +G + S+GYT 
Sbjct  63   DFNGWRRNNGYKTLRDFME----YTVADGADYYCGFTNVNAAP-QPNP-DGAMRSTGYTH  116

Query  180  DGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVY  239
            DGPCEVW D T+V    NC        + +DYSSC  +CTLRWYWLG++++   YSWQ+Y
Sbjct  117  DGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIY  176

Query  240  KNCIGL  245
            K CI L
Sbjct  177  KACIPL  182

>PHALS_03284
Length=188

 Score = 142 bits (357),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 100/170 (59%), Gaps = 2/170 (1%)

Query  78   LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAML  137
            L  ++   Q++L P P +  +D   +   LA+L+ Q   TS +   + +++ Y SLR  L
Sbjct  7    LAPNVIAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFL  66

Query  138  DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRN  197
              ++ Y V++ A  DCGFT  P+ T Q IP    +  +GYT DG CE+W DDT+V SG N
Sbjct  67   K-RANYTVTEGADRDCGFTD-PNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSN  124

Query  198  CRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGR  247
            C  +FP     VDYSSC D+C + WYWL ++ +   YSWQVYK CI L R
Sbjct  125  CHNDFPGKDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTR  174

>PYVX_18176
Length=201

 Score = 137 bits (346),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 99/160 (62%), Gaps = 3/160 (2%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q V+ P+P +  DD  +    LA+L++QG  T  +  +W+ ++GY SLRA +D  S Y V
Sbjct  26   QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-YTV  84

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A   CG+T+    T Q +P +G + S+GYT  GPCEVW DDT V    NC       
Sbjct  85   TDGADQTCGWTN-KDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGK  142

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             + +DYSSC  +CTL W+W+G++Y++  YSWQVYKNC+ L
Sbjct  143  TYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPL  182

>PYAP_22273
Length=268

 Score = 137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 100/188 (53%), Gaps = 5/188 (3%)

Query  61   LFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIE  120
            LF +L  +    +T   +   +   Q V +P   + + D        A L+ QG  T+ +
Sbjct  4    LFAVLGATAIAALTAPSVL--VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKD  61

Query  121  AQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLD  180
              ++   +GY +LR  +D    Y  +K A  +CG+T  P+   Q IPTNG   +SGYT +
Sbjct  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTD-PNAPPQPIPTNGEFRTSGYTHE  120

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQ--HQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQV  238
            GPCE+W DD  V SG+NC  +        ++DYS+C   C L+WYWLGI+ M   YSWQ+
Sbjct  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180

Query  239  YKNCIGLG  246
            YK CI L 
Sbjct  181  YKACIPLA  188

>PHYCA_510817
Length=188

 Score = 131 bits (330),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 103/187 (55%), Gaps = 7/187 (4%)

Query  64   LLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGK-----ALAYLQEQGIDTS  118
            L +LS    +    L       QVV  PSP +   + T + +      L++L+++G  T 
Sbjct  2    LSSLSTLAVIGSSMLLQSTEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQ  61

Query  119  IEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYT  178
                 ++ ++GY SLR  ++ ++ Y VS  A   CG++  P    Q IP++GT+ +SGYT
Sbjct  62   ENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSD-PKGIPQQIPSDGTMRTSGYT  119

Query  179  LDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQV  238
             DGPCE+W  D    S  NC    P    ++DYS CGDSC L WYWLG++ + G YSWQV
Sbjct  120  HDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQV  179

Query  239  YKNCIGL  245
            YK CI L
Sbjct  180  YKECIPL  186

>PYVX_18174
Length=204

 Score = 131 bits (330),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 96/161 (60%), Gaps = 5/161 (3%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q V+ P P +   D  +    LA+L++QG +T  +  +W++ +GY +LRA +D Q+ Y V
Sbjct  29   QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMD-QASYTV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A   CGFT +   T Q IP N    S+GYT DGPCE+W D T+V +  NC       
Sbjct  88   TDGADQTCGFTEIDG-TPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGK  144

Query  206  QHQVDYSSCGD-SCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
               +DYS     +CTL WYW+G++Y++  YSWQVYKNC+ L
Sbjct  145  DTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPL  185

>PPTG_14255
Length=268

 Score = 128 bits (322),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 102/187 (55%), Gaps = 7/187 (4%)

Query  64   LLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPT-----IQGKALAYLQEQGIDTS  118
            +L    SV V    L       QVV  PSP +   + T     +    L++L+++G  T 
Sbjct  1    MLTTFTSVAVLSSTLLLQTQAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQ  60

Query  119  IEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYT  178
                 ++ ++GY SLR  +D+ + Y V+  A   CG+T  P    Q IP +GT+ +SGYT
Sbjct  61   ENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTD-PKGVPQQIPEDGTMRTSGYT  118

Query  179  LDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQV  238
             DGPCE++  DT   S  NC         ++DYS+CGDSC L WYWLG++Y+   YSWQV
Sbjct  119  HDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQV  178

Query  239  YKNCIGL  245
            YK CI L
Sbjct  179  YKECIPL  185

>PYIR_26546
Length=239

 Score = 127 bits (319),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 96/171 (56%), Gaps = 4/171 (2%)

Query  78   LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQ-GIDTSIEAQSWKQEHGYVSLRAM  136
            L S     Q+V+ P P + ++    Q + +AYL+ Q G   + +   +    G+ ++R  
Sbjct  21   LDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREF  80

Query  137  LDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGR  196
            +D+  LY    DA F CG+T L  E  Q IP N  + ++GYT +GPCE+W DD +V  G+
Sbjct  81   MDNDKLYRPVSDADFKCGYTKLDGEP-QPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGK  139

Query  197  NCRTEFPHGQH--QVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            NC  +   G +  ++D+SSC   CT+ WYW+GI+      SWQ+YK CI L
Sbjct  140  NCHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHYKE_9185
Length=281

 Score = 127 bits (319),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 104/184 (57%), Gaps = 8/184 (4%)

Query  68   SLSVCVTGQRLTSDLSEG-QVVLYPSPHFIVDDPTIQGK-----ALAYLQEQGIDTSIEA  121
            SL+V  +   L    +E  QVV  PSP +   + T + +      L++L+++GI T    
Sbjct  7    SLAVLGSAALLQYSTTEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENF  66

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDG  181
              ++ ++ Y SLR  +D ++ Y VS  A   CG+T  P    Q IP +GT+ +SGYT DG
Sbjct  67   TQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTD-PKGIPQQIPEDGTMRTSGYTHDG  124

Query  182  PCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKN  241
            PCE++  D    S  NC         ++DYS+CGDSC L WYWLG++ + G YSWQ+YK 
Sbjct  125  PCEIYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKE  184

Query  242  CIGL  245
            CI L
Sbjct  185  CIPL  188

>PPTG_14254
Length=188

 Score = 124 bits (311),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 103/180 (57%), Gaps = 8/180 (4%)

Query  70   SVCVTGQRLTSDLSEG-QVVLYPSPHFIVDDPTIQGK-----ALAYLQEQGIDTSIEAQS  123
            ++ V G  +    +E  QVV  P+P +   + T + +      L++L+++G  T      
Sbjct  7    TLAVLGSSMLLHATEAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQ  66

Query  124  WKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPC  183
            ++ ++GY SLR  +D ++ Y V++ A   CG+T  P    Q IP +GT+ ++GYT DGPC
Sbjct  67   FQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTD-PKGIPQKIPEDGTMRTTGYTHDGPC  124

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            E++  +    S  NC    P    ++DYS CGDSC L WYWLG++ + G YSWQVYK CI
Sbjct  125  EIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECI  184

>PHYSO_499978
Length=174

 Score = 123 bits (309),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 83/139 (60%), Gaps = 2/139 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  +D   +   LA+L+ QG  T  + + W+ ++GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +K A F CG+T  P  T Q IP    + S+GYT DGPCEVW D+T+V  G NC  +    
Sbjct  88   TKGADFSCGWTD-PKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADK  146

Query  206  QHQVDYSSCGDSCTLRWYW  224
             + +DYS+C  +CTLRWYW
Sbjct  147  GYTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 123 bits (309),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 83/139 (60%), Gaps = 2/139 (1%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  +D   +   LA+L+ QG  T  + + W+ ++GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +K A F CG+T  P  T Q IP    + S+GYT DGPCEVW D+T+V  G NC  +    
Sbjct  88   TKGADFSCGWTD-PKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADK  146

Query  206  QHQVDYSSCGDSCTLRWYW  224
             + +DYS+C  +CTLRWYW
Sbjct  147  GYTIDYSACKGTCTLRWYW  165

>PYAR_24096
Length=227

 Score = 125 bits (313),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 88/162 (54%), Gaps = 3/162 (2%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q V  P   + V +        A L++QG  T+ +  ++ + + Y +LR  +D    Y  
Sbjct  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F+CGFT  P    Q IP +G   +SGYT +GPCE+W DD +V  G NC  +    
Sbjct  88   NSGATFECGFTD-PKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146

Query  206  Q--HQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
                ++DYS+C  +C L+WYWLGI+     YSWQ+YK CI L
Sbjct  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188

>PYAP_22279
Length=223

 Score = 124 bits (310),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 99/166 (60%), Gaps = 9/166 (5%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q +  P+P    D  T     LA+L+ QG+  + +   + ++ G  +LR  +D+++ Y V
Sbjct  23   QRITIPAPTLTTDRNTAT-NPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKV  81

Query  146  -SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQV---TSGRNCRTE  201
             +  A F+CG+T  P+   Q IP+NG + S+GYT DGPCEVW D+T+V   TSG +C  +
Sbjct  82   EAAGATFECGYTD-PNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSG-DCHKD  139

Query  202  FPHG--QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
               G   +++D+S C  +C LRWYWL  + +   +SWQVYK C+ L
Sbjct  140  IGQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

>PHYSO_262732
Length=188

 Score = 121 bits (304),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 96/185 (52%), Gaps = 21/185 (11%)

Query  64   LLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGK-----ALAYLQEQGIDTS  118
            +L   +S+ V G  L       QVV  PSP +   + T   +      LA+L+ QG  T 
Sbjct  1    MLTFLMSLAVVGSALVLQAEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQTH  60

Query  119  IEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYT  178
                          LR  +D+   Y V++ A   CG+T  P    Q IP++GT+ +SGYT
Sbjct  61   --------------LRDFMDNAK-YTVTEGADQACGWTD-PKGIAQQIPSDGTMRTSGYT  104

Query  179  LDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQV  238
             DGPCE++  D    S  NC         ++DYS CGDSCTL WYWLG+++++  YSWQV
Sbjct  105  HDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQV  164

Query  239  YKNCI  243
            YK CI
Sbjct  165  YKECI  169

>PYAP_22278
Length=289

 Score = 124 bits (310),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 102/172 (59%), Gaps = 7/172 (4%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q V  P+P F  +D  +    LA+L+ QG+    +   + +  G  +LR  +D+++ Y +
Sbjct  26   QRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKI  85

Query  146  -SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSG--RNCRTEF  202
             ++ A F+CG+T+ P+   Q IP NG + S+GYT DGPCEVW D+T+V      NC  + 
Sbjct  86   EARGASFECGYTN-PNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDV  144

Query  203  PHG--QHQVDYSSCGDSCTLRWYWLGIQYMDG-IYSWQVYKNCIGLGRNVTA  251
             +    +++D+S C  +C LRWYWLG + + G  +SWQ+YK C+ L  + TA
Sbjct  145  GNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSGTA  196

>PITG_13520
Length=171

 Score = 120 bits (301),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 77/129 (60%), Gaps = 2/129 (2%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +   D   +   LA+L+ QG  T  + ++W+ E+GY SLR  +D ++ Y V
Sbjct  29   QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDV  87

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CGFT  P  T Q IP  G + S+GYT DGPCEVW DD  V  G NC  +FP  
Sbjct  88   TSGADFSCGFTD-PKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGK  146

Query  206  QHQVDYSSC  214
             + VDYSSC
Sbjct  147  DYTVDYSSC  155

>PHYCA_536934
Length=983

 Score = 129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 104/193 (54%), Gaps = 8/193 (4%)

Query  58   PITLFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPT-----IQGKALAYLQE  112
            PI    L + + S+ V G  L       QVV  PSP +   + T     +    L++L++
Sbjct  13   PIDSVMLTSFT-SIAVLGSALLLQTEAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEK  71

Query  113  QGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTL  172
            +G  T      ++ ++GY +LR  +D+   Y V+  A   CG++  P+   Q IP +GT+
Sbjct  72   EGYTTQENFTQYQVDNGYKNLRDFMDNAK-YAVTDGADQACGWSD-PNGIPQQIPEDGTM  129

Query  173  ESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDG  232
             +SGYT DGPCE+W  D    S  NC         ++DYS CGDSC L WYWLG++Y+  
Sbjct  130  RTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGVRYLKK  189

Query  233  IYSWQVYKNCIGL  245
             YSWQVYK CI L
Sbjct  190  KYSWQVYKECIPL  202

>PHYSO_417649
Length=185

 Score = 120 bits (300),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 101/184 (55%), Gaps = 10/184 (5%)

Query  70   SVCVTGQRL---TSDLSEGQVVLYPSPHFIVDDPTIQGK-----ALAYLQEQGIDTSIEA  121
            S+ V G  L   +  +   QVV  PSP +   + T   +      L++L+++G  T    
Sbjct  3    SIAVIGSALALQSLSVEAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENF  62

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDG  181
              ++ ++GY SLR  ++ ++ Y ++  A   CG+T  P    Q IP +GT+ +SGYT DG
Sbjct  63   TQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTD-PKGIPQQIPEDGTMRTSGYTHDG  120

Query  182  PCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKN  241
            PCE++  D    S  NC         ++DYS CGDSC L WYWLG++ + G +SWQVYK 
Sbjct  121  PCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKE  180

Query  242  CIGL  245
            CI L
Sbjct  181  CIPL  184

>PPTG_08820
Length=250

 Score = 120 bits (300),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 103/193 (53%), Gaps = 9/193 (5%)

Query  61   LFHLLALSLSVCVT---GQRLTSDLSEGQVVLYPSPHFI--VDDPTIQGKALAYLQEQGI  115
            + H L  +L+V V       LT  +   Q++L P P +   ++D   + + LA+L+ QG 
Sbjct  1    MAHALVSTLTVVVALFGSALLTLTVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGF  60

Query  116  DTSIEAQSWKQEHGYVSLRAMLDDQSLY-HVSKDAIFDCGFTSLPSETWQDIPTNGTLES  174
                +   W+ + GY +LR  +D       V+  A   CG T L     + IP +G ++S
Sbjct  61   PCQADFNGWRAQSGYKNLRDFMDRAKYTTSVTPGADQTCGLTELKGPP-RPIPKDGMMKS  119

Query  175  SGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDS--CTLRWYWLGIQYMDG  232
            +GYT DGPC V+ DD  V    NC  + P   +++DYSSC     CTL W+WLGI+++  
Sbjct  120  TGYTHDGPCAVYLDDELVLEYDNCHEKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKS  179

Query  233  IYSWQVYKNCIGL  245
             +SWQVYK C+ L
Sbjct  180  RWSWQVYKECVPL  192

>PHYSO_343376
Length=172

 Score = 113 bits (283),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 5/151 (3%)

Query  77   RLTSDLSEGQVVLYPSP---HFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSL  133
            R  + L+  +  L   P    +  +D   +   LA+L+ QG  T  + ++W+ ++GY +L
Sbjct  15   RKQASLAAVRAALRGRPVAAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTL  74

Query  134  RAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVT  193
            R  +D    Y V+K A F CG+T  P  T Q IP    + S+GYT DGPCEVW D+T+V 
Sbjct  75   RDFMD-HGKYTVTKGADFSCGWTD-PKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVL  132

Query  194  SGRNCRTEFPHGQHQVDYSSCGDSCTLRWYW  224
             G NC  +     + +DYS+C  +CTLRWYW
Sbjct  133  QGDNCHEKIADKGYTIDYSACKGTCTLRWYW  163

>PHYSO_340369
Length=200

 Score = 109 bits (273),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 95/194 (49%), Gaps = 24/194 (12%)

Query  60   TLFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGK-----ALAYLQEQG  114
            +LF    + L   V    +T      QVV  P+P +   + T   +      LAY ++QG
Sbjct  3    SLFSSFVVLLGAFVLHPAITR---ANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQG  59

Query  115  IDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLES  174
             +TS     W+  +G+ +LR  +D+ + Y V+                 Q IP +  + +
Sbjct  60   FNTSSNFTQWQLTNGFKTLRDFMDNGN-YSVTSP---------------QQIPDDNIMRT  103

Query  175  SGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
             GYT DGPCE+W D+T   S  +C    P+  + +DYS CG SC + WY LG+   D +Y
Sbjct  104  YGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTLGVAKPDRVY  163

Query  235  SWQVYKNCIGLGRN  248
            SW+VYK CI L  N
Sbjct  164  SWEVYKECIPLYMN  177

>PITG_10499
Length=323

 Score = 109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 84/152 (55%), Gaps = 4/152 (3%)

Query  97   VDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQS-LYHVSKDAIFDCGF  155
            ++D   + + LA+L+ QG     +   W+ ++GY  LR  +D    +  V+  A   CG 
Sbjct  12   INDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTPGADQTCGL  71

Query  156  TSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCG  215
            T L     + IP +G + S+GYT DGPC ++ DD  V    NC    P   +++D+SSC 
Sbjct  72   TELKGPP-RPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYKIDFSSCQ  130

Query  216  DS--CTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
                CTL W+WLGI+++   +SWQVYK CI L
Sbjct  131  KKGGCTLYWFWLGIRFVKSRWSWQVYKECISL  162

>PHYSO_254168
Length=170

 Score = 105 bits (262),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 96/183 (52%), Gaps = 28/183 (15%)

Query  65   LALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSW  124
            LA +L++    +R  S  S G  V         +D   +   LA+L+ QG  T     + 
Sbjct  5    LASTLALRSPSRRTPSRSSAGAAV---------EDKDTKYNPLAFLEGQGFATQEGFDAR  55

Query  125  KQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCE  184
            ++++GY +LR  +D +  Y V++ A + CG+T+ P  T Q IP      S+GYT DGPCE
Sbjct  56   RRDNGYKTLRDFMD-RGKYTVTQGADYFCGWTN-PKGTPQPIP-----RSTGYTHDGPCE  108

Query  185  VWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDS--CTLRWYWLGIQYMDGIYSWQVYKNC  242
            +W DD +V                +DYSSC     CT+ WYWLG++++   YSWQVYK C
Sbjct  109  IWLDDVRVL----------ERSPTIDYSSCEKKGGCTMHWYWLGVRFLKNSYSWQVYKEC  158

Query  243  IGL  245
            I L
Sbjct  159  IPL  161

>PHYSO_527908
Length=174

 Score = 103 bits (258),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 93/172 (54%), Gaps = 10/172 (6%)

Query  70   SVCVTGQRL---TSDLSEGQVVLYPSPHFIVDDPTIQG-----KALAYLQEQGIDTSIEA  121
            S+ V G  L   +  +   QVV  P+P +   + T        K LA+L+ QG  T    
Sbjct  4    SIAVLGSALMLQSLSVDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANF  63

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDG  181
              +  ++GY SLR  +D+ + Y V+K A   CG+T  P+   Q IP +GT+ +SG+T D 
Sbjct  64   TQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTD-PNGIPQQIPEDGTMRTSGFTHDD  121

Query  182  PCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGI  233
            PCE++  D    S  NC         ++DYS+CGDSC L WYWLG++++ GI
Sbjct  122  PCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLGVRFIKGI  173

>PHYCA_14368
Length=219

 Score = 101 bits (251),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 84/188 (45%), Gaps = 50/188 (27%)

Query  61   LFHLLALSLSVCVTGQRLT---SDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDT  117
            + H  AL+ +V  T   L    S     Q+VL P P +  +D   +   LA+L+ QG  T
Sbjct  1    MVHSFALTFAVASTLSSLALLDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKT  60

Query  118  SIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGY  177
              +  SW+ E+ Y SLR  +D+ + Y V+  A F CGFT                +   Y
Sbjct  61   QQDFASWRTENNYKSLRDFMDN-AKYTVTDGADFSCGFT----------------DPKDY  103

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQ  237
            T                              VDYSSC  +CTLRWYWLGI+++   YSWQ
Sbjct  104  T------------------------------VDYSSCKGTCTLRWYWLGIRFLKNQYSWQ  133

Query  238  VYKNCIGL  245
            VYK CI L
Sbjct  134  VYKACIPL  141

>PHALS_06480
Length=159

 Score = 97.4 bits (241),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 1/73 (1%)

Query  72   CVTG-QRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGY  130
            C+ G +RL + L EGQVVLYP+P ++VD    QG ALAYL+EQGI+TSIE QSW ++H Y
Sbjct  20   CIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAY  79

Query  131  VSLRAMLDDQSLY  143
             SLRAMLDD  LY
Sbjct  80   NSLRAMLDDDMLY  92

>PHYSO_341596
Length=231

 Score = 97.4 bits (241),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 67/109 (61%), Gaps = 6/109 (6%)

Query  107  LAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDI  166
            LA+L+ QG +T  +  SW+ ++GY SLR  +D ++ Y V+  A F CGFT  P  T Q I
Sbjct  42   LAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTVTSGADFSCGFTD-PKGTPQPI  99

Query  167  PTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCG  215
            P    + S+GYT DGPCEVW DDT+V  G NC  +FP      DY++ G
Sbjct  100  PAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPG----KDYTTGG  144

>PHYRA_74651
Length=344

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 73/133 (55%), Gaps = 17/133 (13%)

Query  123  SWKQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            S K+ +GY  +R +LD D SLY        DCGFT  P+ T +D P+ G    S G    
Sbjct  71   SLKESNGYSDIRTLLDSDTSLYGA------DCGFTD-PNATPKDPPSTGDATFSRGMVHA  123

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSC-GDSCTLRWYWLGIQYMDG  232
            GPCE+W DDT+V S  NC   +  G  +       VDYSSC    CTLR+YWL  Q +D 
Sbjct  124  GPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDS  183

Query  233  IYSWQVYKNCIGL  245
               WQVYKNC+ L
Sbjct  184  STVWQVYKNCVPL  196

>PHYRA_73607
Length=343

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 71/133 (53%), Gaps = 17/133 (13%)

Query  123  SWKQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            S K  +GY  +R +LD D SLY        DCGFT+ P  T +D PT G    S G    
Sbjct  71   SLKSSNGYSDIRTLLDSDTSLYGA------DCGFTN-PDATAKDPPTTGDATFSRGMVHV  123

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDG  232
            GPCE+W DDT+V S  NC   +  G          VDYSSC  S C LR+YWL  Q +D 
Sbjct  124  GPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  233  IYSWQVYKNCIGL  245
               WQVYKNC+ L
Sbjct  184  SMVWQVYKNCVPL  196

>PHYRA_73584
Length=287

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 74/133 (56%), Gaps = 17/133 (13%)

Query  123  SWKQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            S K+ +GY  +R +LD D +LY        +CGFT+ P  T +D PT G    S G    
Sbjct  68   SLKKSNGYSDIRTLLDSDTTLYGA------NCGFTN-PDATAKDPPTTGDATFSRGMVHA  120

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDG  232
            GPCE+W DDT V S  +C+T +  G  +       VDYSSC  S C LR+YWL  Q +D 
Sbjct  121  GPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  180

Query  233  IYSWQVYKNCIGL  245
               WQVYK+C+ L
Sbjct  181  KTVWQVYKDCVPL  193

>PHYCA_130365
Length=266

 Score = 94.0 bits (232),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 69/127 (54%), Gaps = 16/127 (13%)

Query  128  HGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEVW  186
            + Y  +R+M+D  S+Y        DCGFT  P+ T  D PT+GT   S G    GPCE+W
Sbjct  73   NNYKDVRSMMDGNSVYGE------DCGFTD-PNGTPVDPPTDGTATFSRGIVHAGPCEIW  125

Query  187  FDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIYSWQV  238
             DD  V    +C++ +  G          VDYSSC    C LR+YWLG+Q +DG   WQ 
Sbjct  126  LDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQA  185

Query  239  YKNCIGL  245
            YKNCI L
Sbjct  186  YKNCIPL  192

>PPTG_04622
Length=273

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 71/133 (53%), Gaps = 17/133 (13%)

Query  123  SWKQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            S K+ +GY  +RA+LD D  LY        +CGFT  P  T +D PT G    S G    
Sbjct  71   SLKESNGYSDIRALLDSDTDLYGA------NCGFTD-PDATPKDPPTTGDATFSRGMVHA  123

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCG-DSCTLRWYWLGIQYMDG  232
            GPCE+W DDT V S  +C+T +  G          VDYSSC    C LR+YWL  Q +D 
Sbjct  124  GPCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDS  183

Query  233  IYSWQVYKNCIGL  245
               WQVYK+C+ L
Sbjct  184  KMVWQVYKDCVPL  196

>PHYSO_342364
Length=194

 Score = 91.7 bits (226),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 72/133 (54%), Gaps = 16/133 (12%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNG-TLESSGYTLD  180
             S K  H Y  LR +LD+ ++Y        +CG+T+ P+ T Q IPTNG  + S G    
Sbjct  67   NSLKTSHNYKDLRTLLDNTAVYGP------NCGYTN-PNGTPQPIPTNGKAIFSRGLIHT  119

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHG------QHQVDYSSCG--DSCTLRWYWLGIQYMDG  232
            GPCE+W DD +V +  +C +++ H       +  VDYS C     C +R+YWLG Q +  
Sbjct  120  GPCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGK  179

Query  233  IYSWQVYKNCIGL  245
               WQ YKNCI L
Sbjct  180  KTVWQTYKNCIPL  192

>PHYCA_534473
Length=1050

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 73/133 (55%), Gaps = 17/133 (13%)

Query  123  SWKQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            S K+ +GY  +R +LD D  LY        +CGFT  P  T +D PT G    S G    
Sbjct  843  SLKESNGYSDIRTLLDSDTDLYGA------NCGFTD-PDVTAKDPPTTGDATFSRGMVHA  895

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDG  232
            GPCE+W DDT+V S  +C+T +  G  +       VDYSSC  S C LR+YWL  Q +D 
Sbjct  896  GPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  955

Query  233  IYSWQVYKNCIGL  245
               WQVYK+C+ L
Sbjct  956  KIVWQVYKDCVPL  968

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 62/131 (47%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K+ +    +R M+D D  LY        DCG T  P    +D P+ G    S G    GP
Sbjct  540  KKSNNVKDIRTMIDADPKLYGE------DCGNTD-PKAKPKDPPSTGDATFSRGIVHAGP  592

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCG-DSCTLRWYWLGIQYMDGIY  234
            CE+W DD  V    +C++ +  G          VDYSSC    C  R+YWL +Q  D   
Sbjct  593  CEIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKT  652

Query  235  SWQVYKNCIGL  245
             WQVYKNCI L
Sbjct  653  LWQVYKNCIPL  663

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 61/118 (52%), Gaps = 17/118 (14%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K  +    +R +LD D  LY        DCG+T+ P  T +D PT+GT   S G    GP
Sbjct  277  KASNNAKDIRTLLDSDTKLYGA------DCGYTN-PDVTPKDPPTDGTATFSRGIVHAGP  329

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGD-SCTLRWYWLGIQYMDG  232
            CE+W DD  V S  +C++ +  G  +       VDYSSC    C  R+YWL +Q +DG
Sbjct  330  CEIWLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDG  387

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 16/115 (14%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEV  185
            ++ Y  +R ++D   +Y        DCGFT  P  T  D PT+GT   S G    GPCE+
Sbjct  73   KNNYKDVRTLMDGNPVYGE------DCGFTD-PKGTPVDPPTDGTATFSRGIVHAGPCEI  125

Query  186  WFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGD-SCTLRWYWLGIQYMDG  232
            W DD  V    +C+  +  G  +       VDYSSC    C LR+YWL +Q + G
Sbjct  126  WLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKG  180

>PHYSO_484051
Length=285

 Score = 91.7 bits (226),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 72/131 (55%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDG-P  182
            K+ +GY  +R +LD D SLY        DCGFT+ P  + +D PT G    S   +   P
Sbjct  73   KESNGYSDIRTLLDSDTSLYGA------DCGFTN-PDASPKDPPTTGDPTFSRCMVHASP  125

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIY  234
            CE+W DDT V S  +C+T +  G  +       VDYSSC  S C LR+YWL  Q +D   
Sbjct  126  CEIWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKM  185

Query  235  SWQVYKNCIGL  245
             WQVYK+C+ L
Sbjct  186  VWQVYKDCVPL  196

>PHYKE_2937
Length=366

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 71/133 (53%), Gaps = 17/133 (13%)

Query  123  SWKQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            S K  +GY  +R +LD D SLY        DCG+T+ P  T +D PT G    S G    
Sbjct  75   SLKSSNGYSDIRTLLDSDTSLYGA------DCGYTN-PDATAKDPPTTGDATFSRGMVHV  127

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDG  232
            GPCE+W DDT V S  +C T +  G          VDYSSC  S C LR+YWL  Q +D 
Sbjct  128  GPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  187

Query  233  IYSWQVYKNCIGL  245
               WQVYK+C+ L
Sbjct  188  SMVWQVYKDCVPL  200

>PITG_04948
Length=232

 Score = 90.1 bits (222),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 71/131 (54%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K  +    +R +LD D SLY        DCG+T+ P  + +D PT+GT   S G    GP
Sbjct  71   KASNNAKDIRTLLDSDTSLYGA------DCGYTN-PDVSPKDPPTDGTATFSRGIVHAGP  123

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIY  234
            CE+W DD  V    +C++ +  G  +       VDYSSC    C LR+YWL +Q +DG  
Sbjct  124  CEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKT  183

Query  235  SWQVYKNCIGL  245
             WQVYKNCI L
Sbjct  184  YWQVYKNCIPL  194

>PPTG_04619
Length=276

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 70/131 (53%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K  +    +R +LD D SLY        DCG+T+ P  T +D PT+GT   S G    GP
Sbjct  71   KASNNAKDIRTLLDSDTSLYGA------DCGYTN-PDVTPKDPPTDGTATFSRGIVHAGP  123

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIY  234
            CE+W DD  V    +C++ +  G  +       VDYSSC    C  R+YWL +Q +DG  
Sbjct  124  CEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKT  183

Query  235  SWQVYKNCIGL  245
             WQVYKNCI L
Sbjct  184  YWQVYKNCIPL  194

>PHYSO_485524
Length=278

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 95/201 (47%), Gaps = 20/201 (10%)

Query  56   SPPITLFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVD-DPTIQGKALAYLQEQG  114
            SP   L   LA++LSV         +  E +     S  +IV  DP  +G       ++G
Sbjct  3    SPASILAATLAVALSVNTVQAHGYVEKPESEFKDKISSEWIVQIDPQWKGDWDGAKGDEG  62

Query  115  IDTSIEAQSWKQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE  173
            +      +  K  +    +R +LD D  LY        +CG+T+ P  T +D PT+GT  
Sbjct  63   LVALY--KELKDSNNAKDIRTLLDSDTKLYGA------NCGYTN-PDATPEDPPTDGTAT  113

Query  174  -SSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYW  224
             S G    GPCE+W DD  V    +C++ +  G  +       VDYSSC    C  R+YW
Sbjct  114  FSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYW  173

Query  225  LGIQYMDGIYSWQVYKNCIGL  245
            L +Q +DG   WQVYKNCI L
Sbjct  174  LALQRLDGKTYWQVYKNCIPL  194

>PPTG_04647
Length=327

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 69/131 (53%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K  +GY  +R +LD D  LY        DCG+T+ P  T +D PT G    S G    GP
Sbjct  72   KSSNGYSDIRTLLDSDTDLYGA------DCGYTN-PDATAKDPPTTGDATFSRGMVHVGP  124

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQ-------HQVDYSSCGDS-CTLRWYWLGIQYMDGIY  234
            CE+W DDT V S  NC T +  G          VDYSSC  S C LR+YWL  Q +D   
Sbjct  125  CEIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKM  184

Query  235  SWQVYKNCIGL  245
             WQVYK+C+ L
Sbjct  185  VWQVYKDCVPL  195

>PHYRA_73606
Length=366

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 70/131 (53%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K  +GY  +R +LD D SLY        DCG+T+ P  T +D PT G    S G    GP
Sbjct  73   KSSNGYSDIRTLLDSDTSLYGA------DCGYTN-PDATAKDPPTTGDATFSRGMVHVGP  125

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIY  234
            CE+W DDT V S  +C T +  G          VDYSSC  S C LR+YWL  Q +D   
Sbjct  126  CEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEI  185

Query  235  SWQVYKNCIGL  245
             WQVYK+C+ L
Sbjct  186  VWQVYKDCVPL  196

>PYVX_14662
Length=540

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 72/134 (54%), Gaps = 18/134 (13%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            +S   E G   +R++LDD S+Y        DCGFT  P  T QDIPT+G    S G    
Sbjct  68   KSLAAEKGVTEIRSLLDDTSIYGQ------DCGFTD-PDGTAQDIPTDGKATFSRGMVHV  120

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSC--GDSCTLRWYWLGIQYMD  231
            GPCE+W DDT V    +C + +  G  Q       VDYSSC  G    +R+YWL  Q +D
Sbjct  121  GPCEIWLDDTMVLHDDDCYSTY-GGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVD  179

Query  232  GIYSWQVYKNCIGL  245
            G   WQVYKNCI L
Sbjct  180  GDTVWQVYKNCIPL  193

>PYAP_24689
Length=252

 Score = 88.6 bits (218),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 76/136 (56%), Gaps = 14/136 (10%)

Query  115  IDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-  173
            I T  +  + +++HG  +LRA L+       SK  +  CG T+ P+   + IP +G ++ 
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLE-------SKGPV--CGSTN-PNAKRKPIPRDGLIKF  107

Query  174  SSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDG  232
             S     GPCE+WFD+T+V    +C   F    Q ++DYS C   C LR+YWLG+Q  DG
Sbjct  108  GSSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DG  165

Query  233  IYSWQVYKNCIGLGRN  248
               WQ YKNC+ LG +
Sbjct  166  GKRWQSYKNCVPLGND  181

>PYAP_18131
Length=226

 Score = 87.8 bits (216),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 8/120 (7%)

Query  137  LDDQSLYHV-SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSG  195
            +DD++ Y V +  A F+CG T  P+   Q IP NG + S+G+T DG   VW D+T+V   
Sbjct  1    MDDKANYKVEAAGATFECGNTD-PNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGS  57

Query  196  R--NCRTEFPHG--QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVTA  251
            +  NC      G   +++D+S C   C +RWYWLG++ +   +SWQVYK CI +  + TA
Sbjct  58   KLGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGTA  117

>PHYKE_2809
Length=291

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 67/131 (51%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K  +    +R MLD D  LY        DCGFT  P  T +D PT+G    S G    GP
Sbjct  58   KAANNVKDIRTMLDSDTKLYGQ------DCGFTD-PKATPKDPPTDGAATFSRGIVHAGP  110

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCG-DSCTLRWYWLGIQYMDGIY  234
            CE+W DD  V    +C++ +  G  +       VDYSSC    C  R+YWL +Q +DG  
Sbjct  111  CEIWLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKK  170

Query  235  SWQVYKNCIGL  245
             WQVYKNC+ L
Sbjct  171  FWQVYKNCVPL  181

>PYAP_18711
Length=210

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 74/132 (56%), Gaps = 14/132 (11%)

Query  117  TSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SS  175
            T  +  + +++ G  +LRA L+ +           +CG T+ P+   + IP++G ++  S
Sbjct  57   TGAQYDAERKKRGIKNLRAFLESKGP---------ECGRTN-PNAKRKPIPSDGLIKFGS  106

Query  176  GYTLDGPCEVWFDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
                 GPCEVWFD+T V S  +C   F    Q ++DYS C  +C LR+YWLG+Q  DG  
Sbjct  107  SMEHPGPCEVWFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGK  164

Query  235  SWQVYKNCIGLG  246
             WQ YKNC+ +G
Sbjct  165  RWQSYKNCVPIG  176

>PHYCA_531163
Length=314

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 71/133 (53%), Gaps = 17/133 (13%)

Query  123  SWKQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            S K  +GY  +R +LD D SLY        DCG+T+  + T +D P+ G    S G    
Sbjct  71   SLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNADA-TAKDPPSTGDATFSRGMVHV  123

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDG  232
            GPCE+W DDT V S  +C T +  G          VDYSSC  S C LR+YWL  Q +D 
Sbjct  124  GPCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  233  IYSWQVYKNCIGL  245
               WQVYK+C+ L
Sbjct  184  AIVWQVYKDCVPL  196

>PHYSO_533903
Length=208

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 76/139 (55%), Gaps = 18/139 (13%)

Query  118  SIEA-QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNG-TLESS  175
            S+E  +S K  + +  L+ MLDD SLY        DCGFT  P+ T Q IPT+G  + S 
Sbjct  63   SVEVFKSLKVANNFKDLKTMLDDTSLYGP------DCGFTD-PNGTPQPIPTDGKAVFSR  115

Query  176  GYTLDGPCEVWFDDTQVTSGRNCRTEFPHG------QHQVDYSSC--GDSCTLRWYWLGI  227
            G    GPCE W DD +V    +C +E+ H       +  +DYSSC  G    +R+YWLG 
Sbjct  116  GLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGF  175

Query  228  QYMDGIYS-WQVYKNCIGL  245
            Q +D   + WQ YK+CI L
Sbjct  176  QALDDKKTVWQTYKDCIPL  194

>PPTG_04618
Length=326

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 68/128 (53%), Gaps = 16/128 (13%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEV  185
            ++ Y  +R+++D   +Y        DCGFT  P  T  + P++GT   S G    GPCE+
Sbjct  73   KNNYKDVRSLMDGNPVYGE------DCGFTD-PKGTPSEPPSDGTATFSRGIVHAGPCEI  125

Query  186  WFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIYSWQ  237
            W DD  V    +C++ +  G  +       VDYSSC    C LR+YWL +Q +DG   WQ
Sbjct  126  WLDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQ  185

Query  238  VYKNCIGL  245
             YKNCI L
Sbjct  186  AYKNCIPL  193

>PHYKE_3913
Length=321

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 73/142 (51%), Gaps = 21/142 (15%)

Query  124  WKQEHGYVSLRAMLDDQSLYHVSKD--AIFD---------CGFTSLPSETWQDIPTNGTL  172
            W    G  +L A+  +  + + +KD   +FD         CGFT+ P  T +D PT+GT 
Sbjct  81   WAGAKGDEALVALYKELKVANNAKDIRTLFDSDTSLYGENCGFTN-PDATPKDPPTDGTA  139

Query  173  E-SSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCG-DSCTLRWY  223
              S G    GPCE+W DD  V    +C++ +  G  +       VDYSSC    C  R+Y
Sbjct  140  TFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFY  199

Query  224  WLGIQYMDGIYSWQVYKNCIGL  245
            W+ +Q +DG   WQVYKNC+ L
Sbjct  200  WMALQRLDGKTYWQVYKNCVPL  221

>PHYKE_6001
Length=289

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 70/130 (54%), Gaps = 16/130 (12%)

Query  125  KQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPC  183
            K+ + YV L+ ++DD S+Y        DCGFT  P+ T Q IP++G    S      GPC
Sbjct  70   KKANNYVDLKTLMDDTSVYGA------DCGFTD-PNGTPQPIPSDGKATYSRAIQHVGPC  122

Query  184  EVWFDDTQVTSGRNCRTEFPHGQ------HQVDYSSC-GDSCT-LRWYWLGIQYMDGIYS  235
            E+W DD  V S  +C  ++ +          VDYSSC G  C  +R+YWL  Q +DG   
Sbjct  123  EIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTV  182

Query  236  WQVYKNCIGL  245
            WQ YKNCI L
Sbjct  183  WQSYKNCIPL  192

>PYIR_16435
Length=304

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 15/123 (12%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCE  184
            +E GY +LR+ ++D+            CG T+ P  T + IP++ T++ S      GPCE
Sbjct  72   KEKGYSTLRSYIEDKGTL---------CGRTN-PDATPKAIPSDNTVKFSRAIVHPGPCE  121

Query  185  VWFDDTQVTSGRNCRTEFPHG--QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNC  242
            +W DD +V    NC   F       ++D+SSC  SC LRW+WLG+Q  D    WQVYKNC
Sbjct  122  LWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQVYKNC  179

Query  243  IGL  245
            + L
Sbjct  180  VPL  182

>PHALS_05392
Length=367

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 66/127 (52%), Gaps = 16/127 (13%)

Query  128  HGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEVW  186
            + +  +R+++D   +Y        DCG+T  P+ T    P+NG    S G    GPCE+W
Sbjct  157  NNFKDVRSLMDGNPVYGE------DCGYTD-PNGTPVAPPSNGEATFSRGIVHAGPCEIW  209

Query  187  FDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCG-DSCTLRWYWLGIQYMDGIYSWQV  238
             DD  V    +C+  +  G  +       VDYSSC  D C LR+YWL +Q +DG   WQ 
Sbjct  210  LDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQA  269

Query  239  YKNCIGL  245
            YKNCI L
Sbjct  270  YKNCIPL  276

>PYU1_G005323
Length=251

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 14/120 (12%)

Query  128  HGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEVW  186
             GY  L++ L+D+            CG  SLP    + IP++G ++ +S     GPCEVW
Sbjct  67   KGYKDLKSFLEDKGPV---------CG-NSLPDAKAKPIPSDGVIKLASTIEHAGPCEVW  116

Query  187  FDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            FDD +     +C   F      +VD+S+C  SC LR+YWLG+Q  DG   WQ YKNCI L
Sbjct  117  FDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPL  174

>PHYRA_73582
Length=326

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 64/127 (50%), Gaps = 17/127 (13%)

Query  128  HGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEVW  186
            + Y  L+ ++D             DCGFT  P+ T  D PT+GT   S G    GPCE+W
Sbjct  74   NNYKDLKTLMDGPEFGE-------DCGFTD-PNGTPSDPPTDGTATFSRGIVHAGPCEIW  125

Query  187  FDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCG-DSCTLRWYWLGIQYMDGIYSWQV  238
             DD  V    +C++ +  G  +       VDYS C    C LR+YWL +Q +DG   WQ 
Sbjct  126  LDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQS  185

Query  239  YKNCIGL  245
            YKNCI L
Sbjct  186  YKNCIPL  192

>PHYSO_483955
Length=320

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 65/127 (51%), Gaps = 16/127 (13%)

Query  128  HGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEVW  186
            + Y  +R+++D   +Y        DCGFT  P       PT+GT   S G    GPCE+W
Sbjct  74   NNYKDVRSLMDGNPVYGE------DCGFTD-PKGKPVAPPTDGTATFSRGIVHAGPCEIW  126

Query  187  FDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIYSWQV  238
             DD  V    +C++ +  G  +       VDYSSC    C LR+YWL +Q +DG   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQA  186

Query  239  YKNCIGL  245
            YKNCI L
Sbjct  187  YKNCIPL  193

>H310_06362
Length=197

 Score = 82.4 bits (202),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 73/145 (50%), Gaps = 28/145 (19%)

Query  120  EAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNG--------T  171
            +A S +   G+ +LRAMLD             DCG+T L +   + IPT+G        T
Sbjct  42   KAFSDQMATGFKTLRAMLDPHGP---------DCGYTKL-NVPAKPIPTDGKVVWQNPDT  91

Query  172  LESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPH---GQHQVDYSSCGDSCTLRWYWLGIQ  228
             E    +  GPCE+W D+T+V    NC   FP     Q  VD+SSC  SCT+R+YWL + 
Sbjct  92   GEGFVPSHTGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH  151

Query  229  YMDGIYSWQVYKNC---IGLGRNVT  250
                   WQVYKNC   +GL  + T
Sbjct  152  E----DLWQVYKNCAPLVGLAASPT  172

>PYIR_16375
Length=262

 Score = 82.8 bits (203),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 7/118 (6%)

Query  129  GYVSLRAM-LDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWF  187
            GY SLR + L +Q +Y  S D   +CG T+L       +P +G +  SG+T  GPCE+W 
Sbjct  77   GYTSLRDLILANQDMYDESTDK--ECGLTTLDEAKRTTMPASGNITFSGFTHPGPCELWC  134

Query  188  DDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            DD ++T   NC   +P G+   D + C  +   R +W+G+        WQVY NC+ L
Sbjct  135  DDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGVHGS----PWQVYTNCVYL  188

>PYU1_G007364
Length=316

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 78/164 (48%), Gaps = 28/164 (17%)

Query  94   HFIVD-DPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFD  152
            +FI   DP   GK     Q   +DT  +A  ++    Y SLR +L              D
Sbjct  55   NFIAKMDPAFPGKFNDNPQAN-VDTFTKA--FQASGKYASLRDLLQGHGE---------D  102

Query  153  CGFTSLPSETWQDIPTNGTLE------SSGYTLD--GPCEVWFDDTQVTSGRNCRTEFP-  203
            CG T L   T + IP++G +       + G+     GPCE+W DDT V    NC   FP 
Sbjct  103  CGNTKL-DATPKPIPSDGMVSWQNPDTNEGFVPSHTGPCEIWLDDTPVLKEENCAGRFPG  161

Query  204  -HGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLG  246
               Q +VD+SSC   C +R+YWL +Q      +WQ+YKNCI L 
Sbjct  162  NPAQMKVDFSSCTGKCVMRFYWLTLQEP----AWQIYKNCIPLA  201

>SDRG_08137
Length=282

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 72/141 (51%), Gaps = 26/141 (18%)

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SSG  176
            ++K +  + +LR ML+ Q            CG  SLP+ + + IP++GT+         G
Sbjct  128  AFKAQSQFKTLRDMLEPQGPA---------CG-NSLPNASKKTIPSDGTMTWRNPDTGEG  177

Query  177  Y--TLDGPCEVWFDDTQVTSGRNCRTEFPH---GQHQVDYSSC-GDSCTLRWYWLGIQYM  230
            +  +  GPCEVW DD +V    +C T FP        VDYSSC GD C LR+YWL +   
Sbjct  178  FISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALHQP  237

Query  231  DGIYSWQVYKNCIGLGRNVTA  251
                 WQVYKNC+ L  N  A
Sbjct  238  Q----WQVYKNCVPLQGNGQA  254

>PHYCA_534296
Length=309

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 72/133 (54%), Gaps = 16/133 (12%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            +S K  + +  L+ ++DD S+Y        DCGFT+ PS T Q IPT+G    S      
Sbjct  41   KSLKSANNFKDLKTLMDDTSVYGA------DCGFTN-PSGTAQPIPTDGKATFSRALVHV  93

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWYWLGIQYMDG  232
            GPCE+W DDT+V    +C +++ +          VDYSSC  G    +R+YWL  Q +DG
Sbjct  94   GPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDG  153

Query  233  IYSWQVYKNCIGL  245
               WQ YK+CI L
Sbjct  154  KTVWQSYKDCIPL  166

>PHYSO_459106
Length=223

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 63/131 (48%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K+ +    +R M+D D  LY        DCGFT  P    QD PT G    S G    GP
Sbjct  71   KKANNVKDIRTMIDSDTKLYGE------DCGFTD-PKGKPQDPPTTGDATFSRGIVHAGP  123

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGD-SCTLRWYWLGIQYMDGIY  234
            CE+W DD  V    +C++ +  G          VDYSSC    C  R+YWL +Q  D   
Sbjct  124  CEIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKT  183

Query  235  SWQVYKNCIGL  245
             WQVYKNCI L
Sbjct  184  YWQVYKNCIPL  194

>PYIR_24743
Length=357

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 86/179 (48%), Gaps = 28/179 (16%)

Query  78   LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAML  137
            ++S L+E +  + P+ +     P  QGK     Q   +DT  +A   + E  + +LR +L
Sbjct  38   VSSPLAEFKDGVMPTKYTATMSPAFQGKFNDNPQAN-VDTFTKAFQGQSE--FKTLRDLL  94

Query  138  DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNG--------TLESSGYTLDGPCEVWFDD  189
             D            DCG  S P  + + IP +G        T E    +  GPCE+W DD
Sbjct  95   KDHGA---------DCG-DSKPDASRKAIPGDGKVVWQNPDTGEGFVPSHTGPCEIWLDD  144

Query  190  TQVTSGRNCRTEF---PHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             +V S  NC   F   P  +  VD+SSC ++C LR+YWL +       +WQVYKNC+ L
Sbjct  145  KRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLALHEP----TWQVYKNCVPL  199

>SDRG_07565
Length=278

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 72/141 (51%), Gaps = 26/141 (18%)

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SSG  176
            ++K +  + +LR ML+ Q            CG  SLP+ + + IP++GT+         G
Sbjct  126  AFKAQSQFKTLRDMLEPQGPA---------CG-NSLPNASKKTIPSDGTMTWLNPDTGEG  175

Query  177  Y--TLDGPCEVWFDDTQVTSGRNCRTEFPH---GQHQVDYSSCGDS-CTLRWYWLGIQYM  230
            +  +  GPCEVW DD +V    +C T FP        VDYSSCG S C LR+YWL +   
Sbjct  176  FISSHTGPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWLALHQP  235

Query  231  DGIYSWQVYKNCIGLGRNVTA  251
                 WQVYKNC+ L  N  A
Sbjct  236  Q----WQVYKNCVPLQGNGQA  252

>SDRG_08129
Length=218

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 71/141 (50%), Gaps = 26/141 (18%)

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SSG  176
            ++K +  + +LR ML+ Q            CG  SLP+ + + IP++G +         G
Sbjct  64   AFKVQSQFKTLRDMLEPQGPA---------CG-NSLPNASKKTIPSDGAMTWRNPDTGEG  113

Query  177  Y--TLDGPCEVWFDDTQVTSGRNCRTEFPH---GQHQVDYSSC-GDSCTLRWYWLGIQYM  230
            +  +  GPCEVW DD +V    +C T FP        VDYSSC GD C LR+YWL +   
Sbjct  114  FISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALHQP  173

Query  231  DGIYSWQVYKNCIGLGRNVTA  251
                 WQVYKNC+ L  N  A
Sbjct  174  Q----WQVYKNCVPLQGNGQA  190

>PYAP_18709
Length=235

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 67/119 (56%), Gaps = 14/119 (12%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEVWF  187
            G+  LR+ L+D+            CG  SLP+ + + IP++GT++ +S     GPCEVW 
Sbjct  68   GFKDLRSFLEDKGPT---------CG-NSLPNASPKPIPSDGTIKLASTIEHAGPCEVWL  117

Query  188  DDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            D+T+     +C   F      ++D+ +C  SC LR+YWLG+Q  DG   WQ YKNCI L
Sbjct  118  DNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPL  174

>PHYRA_78689
Length=296

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 73/142 (51%), Gaps = 19/142 (13%)

Query  113  QGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTL  172
            Q +DT    +S K  + +  L+ ++DD S+Y        DCGFT  P  T Q IPT+G  
Sbjct  61   QSVDT---FKSLKTANNFKDLKTLMDDTSVYGA------DCGFTD-PDGTPQPIPTDGKA  110

Query  173  E-SSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWY  223
              S      GPCE+W DDT+V    +C +++ +          VDYSSC  G    +R+Y
Sbjct  111  TFSRALVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFY  170

Query  224  WLGIQYMDGIYSWQVYKNCIGL  245
            WL  Q +D    WQ YK+CI L
Sbjct  171  WLAFQGLDSKTVWQSYKDCIPL  192

>PHYSO_340332
Length=295

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 75/138 (54%), Gaps = 17/138 (12%)

Query  118  SIEA-QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSG  176
            S++A ++ K  + +  L+ ++DD S+Y        DCGFT  P+ T Q IPT+G    S 
Sbjct  62   SVDAFKALKTANNFKDLKTLMDDTSVYGA------DCGFTD-PNGTPQPIPTDGKATFSR  114

Query  177  YTLD-GPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWYWLGI  227
              +  GPCE+W DD +V    +C +++ +          VDYSSC  G    +R+YWL  
Sbjct  115  AIVHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAF  174

Query  228  QYMDGIYSWQVYKNCIGL  245
            Q +DG   WQ YK+CI L
Sbjct  175  QGVDGKTVWQSYKDCIPL  192

>H257_13550
Length=266

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 25/132 (19%)

Query  125  KQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTL------ESSGYT  178
            +Q  G+ +LRAMLD Q           DCG++ L     + IP++G +         G+ 
Sbjct  102  QQATGFKTLRAMLDPQGP---------DCGYSKL-DVPAKPIPSDGNVVWQNPDSGEGFV  151

Query  179  LD--GPCEVWFDDTQVTSGRNCRTEFPH---GQHQVDYSSCGDSCTLRWYWLGIQYMDGI  233
                GPCE+W D+T+V    +C T FP        VD++SC  SCT+R+YW+ + + D  
Sbjct  152  PSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIAL-HQD--  208

Query  234  YSWQVYKNCIGL  245
              WQVYKNC  L
Sbjct  209  -LWQVYKNCAPL  219

>PHYSO_340333
Length=284

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 75/138 (54%), Gaps = 17/138 (12%)

Query  118  SIEA-QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSG  176
            S++A ++ K  + +  L+ ++DD S+Y        DCGFT  P+ T Q IPT+G    S 
Sbjct  62   SVDAFKALKTANNFKDLKTLMDDTSVYGA------DCGFTD-PNGTPQPIPTDGKATFSR  114

Query  177  YTLD-GPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWYWLGI  227
              +  GPCE+W DD +V    +C +++ +          VDYSSC  G    +R+YWL  
Sbjct  115  AIVHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAF  174

Query  228  QYMDGIYSWQVYKNCIGL  245
            Q +DG   WQ YK+CI L
Sbjct  175  QGVDGKTVWQSYKDCIPL  192

>PHYRA_73583
Length=630

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K  +    +R +LD D +LY        +CG+T+ P  + +D P+ G    S G    GP
Sbjct  71   KASNNAKDIRTLLDSDTTLYGA------NCGYTN-PDASPKDPPSTGDATFSRGIVHAGP  123

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIY  234
            CE+W DD  V    +C++ +  G  +       VDYSSC    C  R+YWL +Q +DG  
Sbjct  124  CEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKT  183

Query  235  SWQVYKNCIGL  245
             WQVYKNCI L
Sbjct  184  WWQVYKNCIPL  194

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 63/131 (48%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K  +    +R M+D D  LY        DCGFT  P  T +D P+ G    S G    GP
Sbjct  372  KASNNIKDIRTMIDSDTKLYGA------DCGFTD-PKATPKDPPSTGDATFSRGMVHAGP  424

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSC-GDSCTLRWYWLGIQYMDGIY  234
            CEVW DD  V    +C++ +  G          +DYSSC    C  R++WL +Q  D   
Sbjct  425  CEVWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKT  484

Query  235  SWQVYKNCIGL  245
             WQVYKNC+ L
Sbjct  485  WWQVYKNCVPL  495

>PITG_04949
Length=337

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 16/128 (13%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEV  185
            ++ +  +R+++D   ++        +CGFT  P     + P++GT   S G    GPCE+
Sbjct  73   KNNFKDVRSLMDGNPVFGE------ECGFTD-PKGKPSEPPSDGTATFSRGIVHAGPCEI  125

Query  186  WFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCG-DSCTLRWYWLGIQYMDGIYSWQ  237
            W DD  V    +C++ +  G  Q       VDYSSC    C LR+YWL +Q + G   WQ
Sbjct  126  WLDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQ  185

Query  238  VYKNCIGL  245
             YKNCI L
Sbjct  186  AYKNCIPL  193

>PHYSO_533747
Length=206

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (53%), Gaps = 18/138 (13%)

Query  118  SIEA-QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNG-TLESS  175
            S+E  +S K  + +  L+ MLDD SLY        DCGFT  P+ T Q IPT+G  + S 
Sbjct  63   SVEVFKSLKVANNFKDLKTMLDDTSLYGP------DCGFTD-PNGTPQPIPTDGKAVFSR  115

Query  176  GYTLDGPCEVWFDDTQVTSGRNCRTEFPHG------QHQVDYSSC--GDSCTLRWYWLGI  227
            G    GPCE W DD +V    +C +E+ H       +  +DYSSC  G    +R+YWLG 
Sbjct  116  GLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGF  175

Query  228  QYMDGIYS-WQVYKNCIG  244
            Q +D   + WQ Y   +G
Sbjct  176  QALDDKKTVWQTYSTLLG  193

>SPRG_19916
Length=305

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 69/139 (50%), Gaps = 26/139 (19%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SS  175
            +++K +  + +LR MLD Q           DCG T L +   + IPTNG +         
Sbjct  65   KAFKAQTQFKTLRDMLDPQGP---------DCGNT-LTNGAKKAIPTNGMMTWQNPDTGE  114

Query  176  GYTLD--GPCEVWFDDTQVTSGRNCRTEF---PHGQHQVDYSSC-GDSCTLRWYWLGIQY  229
            G+     GPCEVW DD +V    +C T F   P     +DYSSC GD C LR+YWL +  
Sbjct  115  GFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLALHE  174

Query  230  MDGIYSWQVYKNCIGLGRN  248
                  WQVYKNC+ L  N
Sbjct  175  P----MWQVYKNCVPLEGN  189

>SPRG_19917
Length=241

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 69/136 (51%), Gaps = 26/136 (19%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SS  175
            +++K +  Y +LRA+LD             DCG T L +   ++IP+NG +         
Sbjct  65   KAFKAQSKYKTLRALLDQHGP---------DCGNT-LTNVARKEIPSNGKMTFQNPDTGE  114

Query  176  GYTLD--GPCEVWFDDTQVTSGRNCRTEF---PHGQHQVDYSSCG-DSCTLRWYWLGIQY  229
            G+ L   GPCEVW D+ +V    +C T F   P     VDYSSCG   C LR+YW+ +  
Sbjct  115  GFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIALHS  174

Query  230  MDGIYSWQVYKNCIGL  245
                  WQVYKNC+ L
Sbjct  175  P----RWQVYKNCVPL  186

>PHYSO_438103
Length=238

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 70/133 (53%), Gaps = 16/133 (12%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            +S K  + +  L+ ++DD S+Y        DCGFT  P+ T Q IPT+G    S      
Sbjct  66   KSLKSANNFKDLKTLMDDTSVYGQ------DCGFTD-PNGTPQPIPTDGKATFSRALVHV  118

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWYWLGIQYMDG  232
            GPCE+W D+T+V    +C +++ +          VDYSSC  G    +R+YWL  Q +D 
Sbjct  119  GPCEIWLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDS  178

Query  233  IYSWQVYKNCIGL  245
               WQ YK+CI L
Sbjct  179  KTVWQSYKDCIPL  191

>PITG_05271
Length=278

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 69/133 (52%), Gaps = 16/133 (12%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            ++ K  + +  L+ ++DD S+Y        DCGFT  P+   Q IP +G    S      
Sbjct  67   KALKTANKFKDLKTLMDDTSVYGA------DCGFTD-PNGKAQPIPKDGKATFSRALVHV  119

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWYWLGIQYMDG  232
            GPCE+W DDT+V    +C +++ +          VDYSSC  G    +R+YWL  Q +DG
Sbjct  120  GPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDG  179

Query  233  IYSWQVYKNCIGL  245
               WQ YK+CI L
Sbjct  180  KTVWQSYKDCIPL  192

>SDRG_17318
Length=241

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 69/136 (51%), Gaps = 26/136 (19%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SS  175
            +++K +  Y +LRAMLD             DCG T L +   ++IP+NG +         
Sbjct  65   KAFKAQSKYKTLRAMLDPHGP---------DCGNT-LTNVARKEIPSNGKMTFQNPDTGE  114

Query  176  GY--TLDGPCEVWFDDTQVTSGRNCRTEFPH---GQHQVDYSSCG-DSCTLRWYWLGIQY  229
            G+  +  GPCEVW D+ +V    +C T FP        VDYSSCG   C LR+YW+ +  
Sbjct  115  GFIPSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALHS  174

Query  230  MDGIYSWQVYKNCIGL  245
                  WQVYKNC+ L
Sbjct  175  P----RWQVYKNCVPL  186

>PYVX_18179
Length=147

 Score = 75.9 bits (185),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 66/160 (41%), Gaps = 61/160 (38%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q V+ P P +  +D  +    LA+L++QG  T  +  SW+  +GY +LRA +D       
Sbjct  29   QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD-------  81

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
                                                         Q  SG++   +    
Sbjct  82   ---------------------------------------------QAVSGKDTAVD----  92

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
                 YSSC  SCTL W+W+G++Y+ G YSWQVYKNC+ L
Sbjct  93   -----YSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127

>PYU1_G007476
Length=195

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 64/124 (52%), Gaps = 18/124 (15%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTL----ESSGYTLDG  181
            ++ GY +LR+ L+++            CG+T  P+ T + IP +G +     + G+   G
Sbjct  71   KQKGYKTLRSFLENKGA---------SCGYTE-PNTTPRAIPRDGKVIFAHSNVGFVHPG  120

Query  182  PCEVWFDDTQVTSGRNCRTEFP--HGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVY  239
            PCE+W D+  +    NC+  FP       VD+SSC  +C LR YWLG Q  D    WQ Y
Sbjct  121  PCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQ--DQGQRWQTY  178

Query  240  KNCI  243
            K C+
Sbjct  179  KYCV  182

>PITG_04947
Length=298

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 64/131 (49%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K+ +    +R M+D D  LY        DCG T  P  T +D PT G    S G    GP
Sbjct  46   KKSNNIKDIRTMIDGDAKLYGE------DCGNTD-PKATPKDPPTTGDATFSRGIVHAGP  98

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIY  234
            CE+W DD  V    +C++ +  G  +       +DYSSC    C  R+YWL +Q  D   
Sbjct  99   CEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKT  158

Query  235  SWQVYKNCIGL  245
             WQVYKNCI L
Sbjct  159  LWQVYKNCIPL  169

>PHYSO_246676
Length=187

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 70/160 (44%), Gaps = 40/160 (25%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145
            Q+VL P P +  +D   +   LA+L+ QG  T  +  +W++E+GY +LR  + D++ Y V
Sbjct  12   QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFM-DKAKYDV  70

Query  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205
            +  A F CGFT  P  T Q IP    + S+GYT DG                        
Sbjct  71   TSGADFSCGFTD-PKGTPQPIPEGNKMRSTGYTHDG------------------------  105

Query  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
                          L    L +  M   YSW+VYK CI L
Sbjct  106  --------------LVHASLVLDGMKNSYSWKVYKACIPL  131

>SPRG_22161
Length=300

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 70/139 (50%), Gaps = 26/139 (19%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SS  175
            +++K +  + +LR MLD Q           DCG T L +   + IPTNG +         
Sbjct  65   KAFKAQTQFKTLRDMLDPQGP---------DCGNT-LTNGAKKAIPTNGMMTWQNPDTGE  114

Query  176  GY--TLDGPCEVWFDDTQVTSGRNCRTEF---PHGQHQVDYSSCG-DSCTLRWYWLGIQY  229
            G+  +  GPCEVW D+ +V    +C T F   P     VDYSSCG + C LR+YWL +  
Sbjct  115  GFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLALHE  174

Query  230  MDGIYSWQVYKNCIGLGRN  248
                  WQVYKNC+ L  N
Sbjct  175  P----MWQVYKNCVPLKGN  189

>PYU1_G014690
Length=295

 Score = 78.2 bits (191),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 19/125 (15%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCE  184
            +E G+ +LR+ ++D+            CG T  P+ T + IP++  +  S      GPCE
Sbjct  68   KEKGFDTLRSYIEDKGAL---------CGKTD-PNATPKAIPSDNKVHFSRPIVHPGPCE  117

Query  185  VWFDDTQVTSGRNCRTEFPHGQH----QVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYK  240
            +W DD +V    +C   F  G       +D+SSC  +C LR++WLG+Q  D    WQVYK
Sbjct  118  IWLDDKRVMQDDDCEATF--GDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYK  173

Query  241  NCIGL  245
            NC+ L
Sbjct  174  NCVPL  178

>PHYKE_10578
Length=239

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 60/118 (51%), Gaps = 24/118 (20%)

Query  147  KDAIFD------CGFTSLPSETWQDIPTNGTL-----ESSGYTLDGPCEVWFDDTQVTSG  195
            KD I D      CGFT   ++  Q +P++G L      ++G+T  GPCEV+ DD  V  G
Sbjct  74   KDVILDMVKDKKCGFTRADADP-QPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHG  132

Query  196  RNCRTEFPHGQHQ--------VDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             NC  E+P G  +        +DYSSC   C L +YWLG Q       WQ Y NC+ L
Sbjct  133  DNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGFQN----EQWQSYVNCVPL  186

>PHYSO_533682
Length=278

 Score = 77.8 bits (190),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDG  181
            S+K  + +  L+ ++DD S+Y        DCGFT  P+ T Q IPT+G    S G    G
Sbjct  68   SFKSVNNFKDLKTLMDDTSVYGQ------DCGFTD-PNGTPQPIPTDGKATFSRGLIHVG  120

Query  182  PCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWYWLGIQYMDGI  233
            PCE+W DD +V S  +C +++ +          VDYSSC  G    +R Y LG Q +   
Sbjct  121  PCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDK  180

Query  234  YSWQVYKNCIGL  245
              WQ YKNCI L
Sbjct  181  TVWQSYKNCIPL  192

>PPTG_04620
Length=342

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 64/131 (49%), Gaps = 17/131 (13%)

Query  125  KQEHGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            K+ +    +R M+D D  LY        DCG T  P  T +D P+ G    S G    GP
Sbjct  73   KKSNNVKDIRTMIDGDAKLYGE------DCGNTD-PKATPKDPPSTGDATFSRGIVHAGP  125

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDS-CTLRWYWLGIQYMDGIY  234
            CE+W DD  V    +C++ +  G  +       +DYSSC    C  R+YWL +Q  D   
Sbjct  126  CEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKT  185

Query  235  SWQVYKNCIGL  245
             WQVYKNCI L
Sbjct  186  LWQVYKNCIPL  196

>PYVX_16138
Length=559

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 76/151 (50%), Gaps = 21/151 (14%)

Query  99   DPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSL  158
            DP  +        +  +DT +   S  +E G   +R++LDD S+Y        DCG+T  
Sbjct  48   DPQWESDGWNGNSQDSVDTYV---SLAEEKGVTQIRSLLDDTSIYGA------DCGYTD-  97

Query  159  PSETWQDIPTNGTLE-SSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VD  210
            P  T QDIPT+ T   S G    GPCE+W DDT V    +C + +  G  Q       VD
Sbjct  98   PDGTAQDIPTDSTATFSRGMVHVGPCEIWLDDTMVLHDDDCYSTY-GGDDQDVKSVFPVD  156

Query  211  YSSCGDS-CT-LRWYWLGIQYMDGIYSWQVY  239
            YSSC  S C+ +R+YWL  Q +D    WQVY
Sbjct  157  YSSCDTSGCSMMRFYWLAFQGVDDETVWQVY  187

>PHYCA_69583
Length=224

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 67/133 (50%), Gaps = 20/133 (15%)

Query  126  QEHGYVS-LRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            +E GY + +R +LD D +LY        +CGF++ P    +D P++GT     G    GP
Sbjct  73   KEAGYANNIRKLLDSDTNLYGA------NCGFSN-PDAKAKDPPSDGTATFERGLAHHGP  125

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQ--------VDYSSCGDS-CTLRWYWLGIQ-YMDG  232
            CE+W DD  V    +C   F    +         +DYSSC  S C  R+YWL  Q    G
Sbjct  126  CEIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSG  185

Query  233  IYSWQVYKNCIGL  245
             Y WQ+YK+CI L
Sbjct  186  KYVWQIYKDCIPL  198

>PYAR_20617
Length=254

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 63/136 (46%), Gaps = 14/136 (10%)

Query  112  EQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGT  171
            E    T  +  +  +  G   LR  L+D+            CG  SL   T + IP +G 
Sbjct  52   EGTFKTGAQYAAKAKAEGIPDLRTFLEDKGPV---------CG-NSLKDATPKAIPASGK  101

Query  172  LE-SSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQY  229
            +  +S     GPCEVWFDD       +C   F       VD+S C  SC LR+YWLG+Q 
Sbjct  102  ISLASTIEHAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQ-  160

Query  230  MDGIYSWQVYKNCIGL  245
             DG   WQ YKNC+ L
Sbjct  161  -DGGKRWQSYKNCVPL  175

>PHYCA_127270
Length=279

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 72/142 (51%), Gaps = 19/142 (13%)

Query  113  QGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTL  172
            Q +DT    +S K  + +  L+ ++DD S+Y        DCGFT  P+ T Q IPT+G  
Sbjct  61   QSVDT---FKSLKAANNFKDLKTLMDDTSVYGA------DCGFTD-PNGTPQPIPTDGKA  110

Query  173  E-SSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWY  223
              S      GPCE+W DD +V    +C +++ +          VDYSSC  G    +R+Y
Sbjct  111  TFSRALVHVGPCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFY  170

Query  224  WLGIQYMDGIYSWQVYKNCIGL  245
            WL  Q +     WQ YK+CI L
Sbjct  171  WLAFQGLSKKTVWQSYKDCIPL  192

>PHYSO_255056
Length=269

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 64/124 (52%), Gaps = 16/124 (13%)

Query  126  QEHGYVS-LRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGP  182
            +E GY + +R +LD D +LY        DCGF++ P    +D PT+GT     G    GP
Sbjct  74   KEAGYANNIRKLLDSDTNLYGA------DCGFSN-PDAKPKDPPTDGTATFERGLAHHGP  126

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQ-YMDGIYSWQVYKN  241
            CE+W DDT V    +C   F       DY S  + C  R+YWL  Q    G Y WQ+YKN
Sbjct  127  CEIWLDDTMVLHNDDCAKAF----SVEDYMSI-NGCMFRFYWLAFQGSTSGKYVWQIYKN  181

Query  242  CIGL  245
            CI L
Sbjct  182  CIPL  185

>PHYKE_6002
Length=197

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 64/123 (52%), Gaps = 17/123 (14%)

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDG  181
            S K+ + +V L+ ++DD S+Y        DCGFT  PS T Q IP++G    S      G
Sbjct  68   SLKKANNFVDLKTLMDDTSVYGA------DCGFTD-PSGTPQPIPSDGKATFSRAMQHVG  120

Query  182  PCEVWFDDTQVTSGRNCR--TEFPHGQHQVDYSSC--GDSCTLRWYWLGIQYMDGIYSWQ  237
            PCE+W D T+  S  NC     FP     VDYSSC  G    +R+YWL  Q +D    WQ
Sbjct  121  PCEIWLDSTKAFSKDNCADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQ  175

Query  238  VYK  240
             Y+
Sbjct  176  SYR  178

>PHYRA_86016
Length=236

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 60/120 (50%), Gaps = 20/120 (17%)

Query  141  SLYHVSKDAIFD--CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVT  193
            S+  V  D + D  CG+T    +  Q IPT+G ++       G+T  GPCE++ DDT V 
Sbjct  8    SVRDVVLDMVKDKKCGYTRTDVDP-QPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVL  66

Query  194  SGRNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             G +C  E+P G        +  VDYSSC   CTL  YWL  Q       WQ Y NC+ L
Sbjct  67   HGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  122

>PYAP_24691
Length=145

 Score = 73.2 bits (178),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 3/68 (4%)

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVY  239
            GPCE+WFD+T+V    +C   F    Q ++DYS C  +C LR+YWLG+Q  DG   WQ Y
Sbjct  5    GPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQSY  62

Query  240  KNCIGLGR  247
            KNC+ +G 
Sbjct  63   KNCVPIGN  70

>PPTG_03139
Length=320

 Score = 75.9 bits (185),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 68/129 (53%), Gaps = 14/129 (11%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIP------TNGTLESSGYTLDGPC  183
            Y SL+  + D+ +  VSKD   +CG+T+ P ET Q +P      ++G+ E    + +GPC
Sbjct  78   YSSLKEFMTDK-MVLVSKDFTKECGYTN-PDETPQPVPETYVEWSHGSGEGFTASHEGPC  135

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQV--DYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKN  241
            EVW DDT+V    NC   FP    ++  D+ +C  S  L  YW+ +       SWQVY N
Sbjct  136  EVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALHSP----SWQVYIN  191

Query  242  CIGLGRNVT  250
            C  L +  +
Sbjct  192  CAALEKTTS  200

>PHYRA_86752
Length=300

 Score = 75.9 bits (185),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 62/132 (47%), Gaps = 20/132 (15%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFD--CGFTSLPSETWQDIPTNGTLE-----SSGYTLDG  181
            G     A     S+  V  D + D  CG+T    +  Q IPT+G ++       G+T  G
Sbjct  60   GKYKTMAAEKKMSVRDVVLDMVKDKKCGYTRTDVDP-QPIPTDGKVKWWGNGGGGFTHTG  118

Query  182  PCEVWFDDTQVTSGRNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGI  233
            PCE++ DDT V  G +C  E+P G        +  VDYSSC   CTL  YWL  Q     
Sbjct  119  PCEIYIDDTMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNA---  175

Query  234  YSWQVYKNCIGL  245
              WQ Y NC+ L
Sbjct  176  -QWQAYVNCVPL  186

>PYU1_G005324
Length=191

 Score = 73.6 bits (179),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 14/121 (12%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEV  185
            + GY  L++ LD +            CG T L +   + IP +G L+ +S     GPCE+
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNT-LSNAKAKAIPKDGMLKFASSMEHPGPCEI  116

Query  186  WFDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
            W  +T+     +C   F      ++D+S+C  +C LR+YWLG+Q  DG   WQ YKNC+ 
Sbjct  117  WLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

Query  245  L  245
            L
Sbjct  175  L  175

>PYU1_G005326
Length=191

 Score = 73.6 bits (179),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 14/121 (12%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEV  185
            + GY  L++ LD +            CG T L +   + IP +G L+ +S     GPCE+
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNT-LSNAKAKAIPKDGMLKFASSMEHPGPCEI  116

Query  186  WFDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
            W  +T+     +C   F      ++D+S+C  +C LR+YWLG+Q  DG   WQ YKNC+ 
Sbjct  117  WLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

Query  245  L  245
            L
Sbjct  175  L  175

>PYU1_G005328
Length=191

 Score = 73.6 bits (179),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 14/121 (12%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEV  185
            + GY  L++ LD +            CG T L +   + IP +G L+ +S     GPCE+
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNT-LSNAKAKAIPKDGMLKFASSMEHPGPCEI  116

Query  186  WFDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
            W  +T+     +C   F      ++D+S+C  +C LR+YWLG+Q  DG   WQ YKNC+ 
Sbjct  117  WLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

Query  245  L  245
            L
Sbjct  175  L  175

>PHYCA_12942
Length=353

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 57/113 (50%), Gaps = 19/113 (17%)

Query  147  KDAIFD------CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVTSG  195
            KD I D      CG+T +     Q IP++G ++       G+T  GPCE++ DD  V  G
Sbjct  72   KDVILDMVKDKKCGYT-VADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHG  130

Query  196  RNCRTEFPHG---QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             NC  EF  G     ++DYSSC  +C L  YWLG Q       WQ Y NC+ L
Sbjct  131  DNCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGFQNA----QWQAYVNCVPL  179

>PYU1_G005325
Length=207

 Score = 73.6 bits (179),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 63/121 (52%), Gaps = 14/121 (12%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEV  185
            + GY  L++ LD +            CG T L +   + IP +G L+ +S     GPCE+
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNT-LSNAKAKAIPKDGMLKFASSMEHPGPCEI  116

Query  186  WFDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
            W  +T+     +C   F      ++D+S+C  +C LR+YWLG+Q  DG   WQ YKNCI 
Sbjct  117  WLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCIP  174

Query  245  L  245
            L
Sbjct  175  L  175

>PYAR_14260
Length=212

 Score = 73.6 bits (179),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 65/121 (54%), Gaps = 14/121 (12%)

Query  128  HGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEVW  186
             G+ +LR+ L+ +            CG  SL S   + IP++G ++ +S     GPCE+W
Sbjct  44   KGFKNLRSFLESKGPT---------CG-NSLSSAKPKPIPSDGMVKFASTLEHPGPCEIW  93

Query  187  FDDTQVTSGRNCRTEFPHGQH-QVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             D+T      +C  +F      +V++S+C  SC LR+YWLG+Q  D    WQ YKNC+ L
Sbjct  94   LDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPL  151

Query  246  G  246
            G
Sbjct  152  G  152

>PPTG_14221
Length=275

 Score = 74.7 bits (182),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 67/133 (50%), Gaps = 16/133 (12%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            +S K  + +  L+ ++DD S+Y        DCGFT+ P+ T Q IPT+G    S      
Sbjct  67   KSLKAANNFKDLKTLMDDTSVYGA------DCGFTN-PNGTPQPIPTDGKATFSRALVHH  119

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWYWLGIQYMDG  232
            GPC +W DD  V    +C  ++ +          VDYSSC  G    +R+YWL  Q ++ 
Sbjct  120  GPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNK  179

Query  233  IYSWQVYKNCIGL  245
               WQ YK+CI L
Sbjct  180  KTVWQSYKDCIPL  192

>SDRG_17317
Length=122

 Score = 70.9 bits (172),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 58/111 (52%), Gaps = 21/111 (19%)

Query  152  DCGFT-------SLPSE---TWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTE  201
            DCG T       S+PS+   TWQ+ P  G      +T  GPCEVW DD +V    +C T 
Sbjct  8    DCGNTLTTGAKKSIPSDGTMTWQN-PDTGEGFVPSHT--GPCEVWLDDKRVFQNDDCATN  64

Query  202  F---PHGQHQVDYSSC-GDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRN  248
            F   P     +DYSSC GD C LR+YWL +        WQVYKNC+ L  N
Sbjct  65   FPAKPAAHLPIDYSSCSGDGCMLRFYWLALHEP----MWQVYKNCVPLEGN  111

>PPTG_07521
Length=281

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 57/119 (48%), Gaps = 25/119 (21%)

Query  147  KDAIFD-------CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVTS  194
            KD + D       CG T L   T Q IP++G  +       G+T  GPCE++ DD  V  
Sbjct  73   KDVVLDMVGAGKECGHT-LADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLH  131

Query  195  GRNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            G NC  E+P G           VDYSSC + CTL  YWL  Q  +    WQ Y NC+ L
Sbjct  132  GDNCEDEYPGGDVGSTVTSDMPVDYSSCTEDCTLTIYWLAFQNAN----WQAYINCVPL  186

>PHYRA_83499
Length=473

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 62/132 (47%), Gaps = 20/132 (15%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFD--CGFTSLPSETWQDIPTNGTLE-----SSGYTLDG  181
            G     A     S+  V  D + D  CG+T    +  Q IPT+G ++       G+T  G
Sbjct  60   GKYKTMAAEKKMSVRDVVLDMVKDKKCGYTRTDVDP-QPIPTDGKVKWWGNGGGGFTHTG  118

Query  182  PCEVWFDDTQVTSGRNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGI  233
            PCE++ DDT V  G +C  E+P G        +  VDYSSC   CTL  YWL  Q     
Sbjct  119  PCEIYIDDTMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNA---  175

Query  234  YSWQVYKNCIGL  245
              WQ Y NC+ L
Sbjct  176  -QWQAYVNCVSL  186

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 36/72 (50%), Gaps = 12/72 (17%)

Query  176  GYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQ--------VDYSSCGDSCTLRWYWLGI  227
            G  + GPCE++ DDT +  G NC  E+  G           +DYSSC  +CTL  YWLG 
Sbjct  346  GTGISGPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF  405

Query  228  QYMDGIYSWQVY  239
            Q       WQ Y
Sbjct  406  QN----EQWQAY  413

>PHYCA_98479
Length=276

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 57/119 (48%), Gaps = 25/119 (21%)

Query  147  KDAIFD-------CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVTS  194
            KD + D       CG T L   + Q +PT+G  +       G+T  GPCE++ DDT V  
Sbjct  73   KDVVLDMVGSGKECGHT-LADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLH  131

Query  195  GRNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            G NC  E+P G           VDYSSC   CTL  YWLG Q       WQ Y NC+ L
Sbjct  132  GDNCEDEYPGGDVGSTVTSDMPVDYSSCKGDCTLTIYWLGFQNA----QWQAYINCVPL  186

>PHYRA_77971
Length=230

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 52/106 (49%), Gaps = 18/106 (17%)

Query  153  CGFTSLPSETWQDIPTNGTL-----ESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH  207
            CGFT    +  Q +PTNG       +  GYT  GPCE++ DD  V    NC+ ++P G +
Sbjct  87   CGFTRTDVDP-QPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  208  Q--------VDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
                     VDYSSC   CT   YWLG Q       WQ Y NC+ L
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNA----QWQAYINCVPL  187

>PHYRA_85794
Length=230

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 52/106 (49%), Gaps = 18/106 (17%)

Query  153  CGFTSLPSETWQDIPTNGTL-----ESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH  207
            CGFT    +  Q +PTNG       +  GYT  GPCE++ DD  V    NC+ ++P G +
Sbjct  87   CGFTRTDVDP-QPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  208  Q--------VDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
                     VDYSSC   CT   YWLG Q       WQ Y NC+ L
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNA----QWQAYINCVPL  187

>PYU1_G005868
Length=267

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 63/130 (48%), Gaps = 32/130 (25%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFT----------SLPSETWQ-DIPTNGTLESSGYT  178
            Y SLR MLD          A+ DCGFT          SL S  WQ D    G ++S    
Sbjct  75   YKSLREMLDS---------AVPDCGFTLTDGTPVDVSSLKSMKWQNDQEQKGFIDSH---  122

Query  179  LDGPCEVWFDDTQVTSGRNCR---TEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYS  235
              GPCE+W DDT++    +CR   T +P  +  VDYS C   C L +YWL +   +    
Sbjct  123  -HGPCELWIDDTKIMHSDDCRADYTAYP-AEIPVDYSVCKGKCQLTFYWLALHEPN----  176

Query  236  WQVYKNCIGL  245
            WQ+YK C+ +
Sbjct  177  WQIYKQCVPI  186

>PPTG_07507
Length=299

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 57/118 (48%), Gaps = 24/118 (20%)

Query  147  KDAIFD------CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVTSG  195
            KD + D      CG+T    +  + IP +G ++       G+T  GPCE++ DD  V  G
Sbjct  73   KDVVLDMVKDKKCGYTRTDVDP-KPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHG  131

Query  196  RNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             NC  +FP G        +  VD+SSC   CTL  YWLG Q       WQ Y NC+ L
Sbjct  132  DNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNA----QWQAYVNCVPL  185

>PPTG_07509
Length=299

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 57/118 (48%), Gaps = 24/118 (20%)

Query  147  KDAIFD------CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVTSG  195
            KD + D      CG+T    +  + IP +G ++       G+T  GPCE++ DD  V  G
Sbjct  73   KDVVLDMVKDKKCGYTRTDVDP-KPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHG  131

Query  196  RNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             NC  +FP G        +  VD+SSC   CTL  YWLG Q       WQ Y NC+ L
Sbjct  132  DNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNA----QWQAYVNCVPL  185

>PHYCA_97965
Length=288

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 82/197 (42%), Gaps = 27/197 (14%)

Query  64   LLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQS  123
            L  ++LS  +       D +    +  P   F    PT++   L       ID   +  S
Sbjct  4    LAGIALSSAIALVAFAPDANAHGNLKQPEATFKDGAPTVEWVTL-------IDNYWDIGS  56

Query  124  WKQEHGYVSLRAMLDDQSLYHVSKDAIFD--CGFTSLPSETWQDIPTNGTLE-----SSG  176
               + G     A     S+  V  D + D  CG+T    +  Q IP++G ++       G
Sbjct  57   GGDQVGKFKTMAKEKGMSVKDVVLDMVKDKKCGYTRTDVDP-QPIPSDGIVKWWGNGGGG  115

Query  177  YTLDGPCEVWFDDTQVTSGRNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQ  228
            +T  GPCE++ DD  V  G +C  EFP G        +  VD+SSC   CTL  YWL  Q
Sbjct  116  FTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIYWLAFQ  175

Query  229  YMDGIYSWQVYKNCIGL  245
                   WQ Y NC+ L
Sbjct  176  N----EQWQSYVNCVPL  188

>PHYRA_86241
Length=195

 Score = 71.2 bits (173),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 62/126 (49%), Gaps = 20/126 (16%)

Query  127  EHGYVS-LRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPC  183
            E GY + +R +LD D SLY        DCGF+  P+   +D P++GT     G    GPC
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGFSD-PNAKAKDPPSDGTATFERGLAHHGPC  126

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQ--------VDYSSCGDS-CTLRWYWLGIQ-YMDGI  233
            E+W DDT V    +C   F    +         +DYSSC  S C  R+YWL  Q    G 
Sbjct  127  EIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGK  186

Query  234  YSWQVY  239
            Y WQ+Y
Sbjct  187  YVWQIY  192

>PYAR_14256
Length=199

 Score = 71.2 bits (173),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 17/123 (14%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLD--GPCE  184
            + G+ +LRA L+D+            CG T LP+   +  P    L     T++  GPCE
Sbjct  63   DKGFKNLRAFLEDKGP---------TCGNT-LPNA--KPKPXXXXLIKLASTIEHPGPCE  110

Query  185  VWFDDTQVTSGRNCRTEFPHG-QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            +W DD+      +C  +F      +VD+S+C  SC LR+YWLG+Q  +    WQ YKNCI
Sbjct  111  IWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCI  168

Query  244  GLG  246
             LG
Sbjct  169  PLG  171

>PYIR_16443
Length=275

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 66/121 (55%), Gaps = 16/121 (13%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCE  184
            ++ G+ +LR+ ++D+            CG T+ P+ + + IP++  ++ S      GPCE
Sbjct  69   KQKGFETLRSYIEDKGAL---------CGRTN-PNASPKAIPSDSVVKFSRAIVHPGPCE  118

Query  185  VWFDDTQVTSGRNCRTEFPHG--QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVY-KN  241
            +W DD +V    NC   F       ++D+SSC  SC LRW+WLG+Q  D    WQVY K+
Sbjct  119  IWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKS  176

Query  242  C  242
            C
Sbjct  177  C  177

>PYVX_20789
Length=290

 Score = 72.4 bits (176),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 85/198 (43%), Gaps = 37/198 (19%)

Query  66   ALSLSVCVTGQRLTSDLSEGQVVL------------YPSPHFIVDDPTIQGKALAYLQEQ  113
            AL ++V V    +   L  G ++L            Y  P   +D P I G ++     Q
Sbjct  5    ALLVAVTVQATLIVGTLGHGNIILPKPTGDSDHVYYYGGPAGTIDMPEIIGDSIYSEYYQ  64

Query  114  GIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE  173
            G+        W  E+G  SL+        Y      I +CG T     T Q +P++G  E
Sbjct  65   GV------ADWFTENGISSLKE-------YXXXXTNISECGNTE-KDGTAQPVPSDGYAE  110

Query  174  SS--GYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH----QVDYSSCGDSCTLRWYWLGI  227
                G +  GPCE+W DDT+V +  NC T+F  GQ      +D ++C  S    +YWL +
Sbjct  111  HDTLGNSHPGPCEIWCDDTRVFNSTNCVTDF-SGQSPAMIPIDVATCTASSEFVFYWLAL  169

Query  228  QYMDGIYSWQVYKNCIGL  245
                    WQVY NC+ L
Sbjct  170  HAQ----PWQVYINCVAL  183

>PYIR_16444
Length=182

 Score = 70.5 bits (171),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 15/121 (12%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCE  184
            ++ G+ +LR+ +++       K AI  CG T+    T + IP++G +  S      GPCE
Sbjct  69   KQKGFPTLRSYIEN-------KGAI--CGKTNA-KATPKPIPSDGKVHFSRAIVHPGPCE  118

Query  185  VWFDDTQVTSGRNCRTEFPHGQH--QVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNC  242
            +W D+ +V    NC   F       ++D+SSC  +C LR++WLG+Q  D    WQVYKNC
Sbjct  119  LWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNC  176

Query  243  I  243
            +
Sbjct  177  V  177

>PPTG_06256
Length=318

 Score = 72.4 bits (176),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 10/118 (8%)

Query  129  GYVSLRAML-DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWF  187
            G  SL A++  +Q LY  S D   DCG T+        +P +  LE +G+T  GPCEVW 
Sbjct  78   GGGSLGALIAKNQKLY--SSDVDPDCGLTTFKESARSKLPAS-QLEYTGFTHPGPCEVWC  134

Query  188  DDTQVTSGRNCRTEFPHGQHQVDY--SSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            DDT+V    +C+T+FP    ++ Y  S C ++  L  YWL +        WQVY +C+
Sbjct  135  DDTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAVHGEQ----WQVYSDCV  188

>PYU1_G006403
Length=252

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 63/123 (51%), Gaps = 10/123 (8%)

Query  127  EHGYVSLRAM-LDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTN---GTLESSGYTLDGP  182
            E G  SL+ + L++Q ++    D    CG+T L      ++PT    G  +  G+T  GP
Sbjct  78   ESGVASLKDLILENQVMWTSGLDEA--CGYTKLDEAKRSELPTEMKFGNGDVGGFTHPGP  135

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNC  242
            CE+W DDT+++   +C  ++P G   +D S C ++     YWL +        WQVY NC
Sbjct  136  CELWCDDTKLSYDNDCAAKYPSGLVPIDTSKCANANQFTVYWLAVH----ASMWQVYTNC  191

Query  243  IGL  245
            + L
Sbjct  192  VYL  194

>PHYRA_73581
Length=293

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 63/131 (48%), Gaps = 17/131 (13%)

Query  126  QEHGYVS-LRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPC  183
            +E GY + +R +LD D +LY        DCG++   ++            S G    GPC
Sbjct  79   KESGYENDVRKLLDSDANLYGA------DCGYSDPDADPKDPPTDGTATFSRGIAHHGPC  132

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQ--------VDYSSCGDS-CTLRWYWLGIQYMDGIY  234
            E+W DDT V    +C   F    +         +DYSSC  S C LR+YWL  Q  +  Y
Sbjct  133  EIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLRFYWLAFQGSNDGY  192

Query  235  SWQVYKNCIGL  245
             WQ+YK+C+ L
Sbjct  193  VWQIYKHCVPL  203

>PHYCA_12943
Length=287

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 57/118 (48%), Gaps = 24/118 (20%)

Query  147  KDAIFD------CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVTSG  195
            KD + D      CG+T    +  Q IP++G ++       G+T  GPCE++ DD  V  G
Sbjct  76   KDVVLDMVKDKKCGYTRTDVDP-QPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHG  134

Query  196  RNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             +C  EFP G        +  VD+SSC   CTL  YWL  Q       WQ Y NC+ L
Sbjct  135  DDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIYWLAFQN----EQWQSYVNCVPL  188

>SDRG_08782
Length=450

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 69/139 (50%), Gaps = 26/139 (19%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SS  175
            +++K +  + +LR MLD             DCG+T L +   + IP NG +         
Sbjct  64   KAFKAQSQFKTLRDMLDPHGP---------DCGYT-LTNVDKKAIPGNGQMTWKNPDTGE  113

Query  176  GY--TLDGPCEVWFDDTQVTSGRNCRTEFPHGQH---QVDYSSCG-DSCTLRWYWLGIQY  229
            G+  +  GPCEVW D+ +V    +C T FP        VDYSSCG + C LR+YWL +  
Sbjct  114  GFIPSHKGPCEVWIDNERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALHE  173

Query  230  MDGIYSWQVYKNCIGLGRN  248
                  WQVYKNC+ L  N
Sbjct  174  P----MWQVYKNCVPLKGN  188

>PYIR_22634
Length=269

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 61/120 (51%), Gaps = 7/120 (6%)

Query  127  EHGYVSLRAM-LDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEV  185
            + G  +LR + + +Q ++  + D    CG+T L       +P +G +  SG+T  GPCE+
Sbjct  74   DSGVTTLRDLIMKNQKMWAPTVDP--KCGYTILDEAKRTTMPASGKITFSGFTHPGPCEL  131

Query  186  WFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            W D+ ++    +C   +P  +   D + C ++     YW+G+Q       WQVY NC+ L
Sbjct  132  WCDNNKLAFANDCAATYPDAKVPFDAAKCANANQFTIYWIGVQGT----PWQVYTNCVYL  187

>PYIW_27477
Length=180

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 15/117 (13%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCE  184
            +E G+ +LR+ ++D+            CG T  P+   + IP++  ++ S      GPCE
Sbjct  46   KEKGFETLRSYIEDKGA---------KCGKTD-PNAKAKAIPSDNVVKFSRAIVHPGPCE  95

Query  185  VWFDDTQVTSGRNCRTEFPHG--QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVY  239
            +W DDT+V    NC   F       ++D+S+C   C LRW+WLG+Q  D    WQVY
Sbjct  96   LWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

>PHALS_05394
Length=288

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 16/127 (13%)

Query  128  HGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEVW  186
            + + S R+++D   +Y        DCG+T  P+ T  D P++GT   S      G CE+W
Sbjct  76   NNFKSARSLMDGNPVYGA------DCGYTD-PNGTPVDPPSDGTATFSRPMKHAGLCEIW  128

Query  187  FDDTQVTSGRNCRTEFPHGQHQ-------VDYSSC-GDSCTLRWYWLGIQYMDGIYSWQV  238
             +   V    +C++ +     +       +DYSSC GD C LR+YWL +Q +     WQ 
Sbjct  129  INKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQA  188

Query  239  YKNCIGL  245
            YKNCI +
Sbjct  189  YKNCISI  195

>SPRG_04679
Length=226

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 72/150 (48%), Gaps = 35/150 (23%)

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SSG  176
            ++K +  + +LR ML+ Q            CG  SLP+ + + IP++GT+         G
Sbjct  64   AFKAQSQFKTLRDMLEPQGPA---------CG-NSLPNASKKTIPSDGTMTWLNPDTGEG  113

Query  177  Y--TLDGPCEVWFDDTQVTSGRNCRTEFPH---GQHQVDYSSCGDS-CTLRWYWLGIQYM  230
            +  +  GPCEVW DD +V    +C T FP        VDYSSCG + C LR+YWL +   
Sbjct  114  FISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCGGAGCMLRFYWLALHQP  173

Query  231  DGIYSWQVY---------KNCIGLGRNVTA  251
                 WQVY         +NC+ L  N  A
Sbjct  174  Q----WQVYSQLKQPVWNENCVPLQGNGQA  199

>PYU1_G006405
Length=305

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 8/120 (7%)

Query  127  EHGYVSLRAM-LDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEV  185
            + GY +L+ + L +Q +Y  + D    CG+T L      D+P    +  SG+T  GPCE+
Sbjct  74   DSGYTTLKDLILANQDMYEDTIDK--QCGYTILDEAKRADMPAT-EITFSGFTHPGPCEL  130

Query  186  WFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            W DD ++    +C+T +  G+  VD S C  +   R +WL +        WQVY NC+ L
Sbjct  131  WCDDNKLAFDYDCQTTYASGKVPVDASKCSGANRFRIFWLALHSA----PWQVYTNCVYL  186

>SPRG_07627
Length=536

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 68/139 (49%), Gaps = 26/139 (19%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE------SS  175
            +++  +  Y +LR +LD             DCG T LP+   + IP++G +         
Sbjct  62   KAFAAQTQYKTLRDLLDLHGP---------DCGNT-LPNVAAKAIPSDGKMTWKNPDTGE  111

Query  176  GY--TLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQ---VDYSSCG-DSCTLRWYWLGIQY  229
            G+  +  GPCE+W D T+V    +C T FP        VDY+ CG + C LR+YWL +  
Sbjct  112  GFIPSHTGPCEIWLDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALHQ  171

Query  230  MDGIYSWQVYKNCIGLGRN  248
                  WQVYKNC+ L  N
Sbjct  172  PQ----WQVYKNCVPLQGN  186

>PHYRA_78175
Length=319

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 66/130 (51%), Gaps = 14/130 (11%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIP------TNGTLESSGYTLDGPC  183
            Y SL+  + D+ L  V+K+   +CG+T+ P E  Q +P      ++G  E    + +GPC
Sbjct  78   YSSLKEFMADK-LVLVNKEFTKECGYTN-PDEAAQPVPKTYVEWSHGDGEGFTASHEGPC  135

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQVDY--SSCGDSCTLRWYWLGIQYMDGIYSWQVYKN  241
            EVW DDT+V    NC   FP    ++ Y   +C  S  L  YW+ +       SWQVY N
Sbjct  136  EVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALHSA----SWQVYIN  191

Query  242  CIGLGRNVTA  251
            C  L +  ++
Sbjct  192  CAALEKTTSS  201

>PITG_08892
Length=309

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 10/119 (8%)

Query  128  HGYVSLRAML-DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVW  186
             G  SL A++  +Q LY    D   DCG T+        +P +  LE +G+T  GPCEVW
Sbjct  77   KGGGSLGALIAKNQKLYSSEVDP--DCGLTTFKDSARSKLPAS-QLEYTGFTHPGPCEVW  133

Query  187  FDDTQVTSGRNCRTEFPHGQHQV--DYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
             DDT+V    +C+T+FP    ++  D S C  +  L  YWL +        WQVY +C+
Sbjct  134  CDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVHGEQ----WQVYSDCV  188

>PYIW_19151
Length=248

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 15/129 (12%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCE  184
            +E G+ +LR+ L+D+            CGFT  P  + + IP + T+  S      GPCE
Sbjct  66   KEKGFSTLRSYLEDKGAV---------CGFTD-PKVSPRAIPADRTIRFSRDIPHPGPCE  115

Query  185  VWFDDTQVTSGRNCRTEFPH--GQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNC  242
            ++ DDT+V    +C + F        VD+S C   C +R+YWLG+Q       WQVYK+C
Sbjct  116  LYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQASG--TRWQVYKSC  173

Query  243  IGLGRNVTA  251
            + +  +  A
Sbjct  174  VPVSSSAVA  182

>PHYCA_112615
Length=196

 Score = 68.9 bits (167),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 68/126 (54%), Gaps = 21/126 (17%)

Query  118  SIEA-QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSG  176
            S++A ++ K  + +  L+ ++DD S+Y        DCGFT  P+   Q IP++G    S 
Sbjct  62   SVDAFKALKTANNFKDLKTLMDDTSVYGA------DCGFTD-PNGKAQPIPSDGKATFSR  114

Query  177  YTLD-GPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSC--GDSCTLRWYWLGIQYMDGI  233
              +  GPCE+W DDT     ++ ++ FP     VDYSSC  G    +R+YWL  Q +DG 
Sbjct  115  AIVHVGPCEIWLDDT-----KDIKSIFP-----VDYSSCDNGGCKEMRFYWLAFQGVDGK  164

Query  234  YSWQVY  239
              WQ Y
Sbjct  165  TVWQSY  170

>PPTG_07516
Length=294

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 62/132 (47%), Gaps = 26/132 (20%)

Query  133  LRAMLDDQSLYHVSKDAIFD------CGFTSLPSETWQDIPTNGTL-----ESSGYTLDG  181
             +AM  ++ +    KD + D      CG T L +   Q IP +G +     E  G+T  G
Sbjct  60   FKAMAKEKGMS--VKDVVLDMVKDQKCGNT-LENGDPQPIPADGKVKWHGNEGGGFTHTG  116

Query  182  PCEVWFDDTQVTSGRNCRTEF---PHGQHQ-----VDYSSCGDSCTLRWYWLGIQYMDGI  233
            PCE++ DD  V  G +C  EF   P+G  Q     VD+SSC   C L  YWL  Q     
Sbjct  117  PCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQNA---  173

Query  234  YSWQVYKNCIGL  245
              WQ Y NC+ L
Sbjct  174  -QWQTYVNCVPL  184

>PHALS_04411
Length=262

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 62/128 (48%), Gaps = 16/128 (13%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEV  185
            ++ Y ++R ++D    +        DCGFT  P     D P++GT   S G    GPCE+
Sbjct  73   KNNYKNVRTLMDGNPAFGE------DCGFTD-PKGKPVDPPSDGTATFSRGIVHAGPCEL  125

Query  186  WFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSC-GDSCTLRWYWLGIQYMDGIYSWQ  237
            W +D  +    +C++ +  G  Q       V YS C      LR+YWL +Q + G   WQ
Sbjct  126  WCNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQ  185

Query  238  VYKNCIGL  245
             YKNCI L
Sbjct  186  AYKNCIPL  193

>PPTG_07520
Length=294

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 62/132 (47%), Gaps = 26/132 (20%)

Query  133  LRAMLDDQSLYHVSKDAIFD------CGFTSLPSETWQDIPTNGTL-----ESSGYTLDG  181
             +AM  ++ +    KD + D      CG T L +   Q IP +G +     E  G+T  G
Sbjct  60   FKAMAKEKGMS--VKDVVLDMVKDQKCGNT-LENGDPQPIPADGKVKWHGNEGGGFTHTG  116

Query  182  PCEVWFDDTQVTSGRNCRTEF---PHGQHQ-----VDYSSCGDSCTLRWYWLGIQYMDGI  233
            PCE++ DD  V  G +C  EF   P+G  Q     VD+SSC   C L  YWL  Q     
Sbjct  117  PCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQNA---  173

Query  234  YSWQVYKNCIGL  245
              WQ Y NC+ L
Sbjct  174  -QWQTYVNCVPL  184

>PHYRA_80631
Length=320

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 63/122 (52%), Gaps = 10/122 (8%)

Query  127  EHGYVSLRAML-DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEV  185
            + GY SL A +  +Q LY    D   DCG T        ++P +  L  SG+T  GPCEV
Sbjct  76   DKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPAS-KLTYSGFTHTGPCEV  132

Query  186  WFDDTQVTSGRNCRTEFPHGQHQVDY--SSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            W DDT+V    +C+T++P     + Y  S C D+  L  YW+G+        WQVY +C+
Sbjct  133  WCDDTKVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGLHGD----PWQVYTDCV  188

Query  244  GL  245
             L
Sbjct  189  WL  190

>PYVX_24563
Length=254

 Score = 69.3 bits (168),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 86/201 (43%), Gaps = 39/201 (19%)

Query  61   LFHLLALSLSV-CVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSI  119
            +F L A SL++  V G    SD +        +  ++    TI        Q +  D S 
Sbjct  6    IFALTAASLTMQSVLGHGYMSDPAAQFYDTATATSYVT---TITAAVNGAFQGKKWDDSP  62

Query  120  EAQ-----SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSL---PSET-------WQ  164
            EA      S     GY SLRAM+D+         ++ DCG T     P +        WQ
Sbjct  63   EANTAMFTSTFPSTGYTSLRAMIDE---------SVSDCGNTRTDVSPVDMTGKKVLHWQ  113

Query  165  DIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCR---TEFPHGQHQVDYSSCGDSCTLR  221
            +        SS +   GPCEVW DD  VT   +CR   T +P      D+S C  SCTLR
Sbjct  114  NDQEGVGFVSSHH---GPCEVWIDDVMVTHQDDCRAVYTSYP-ANVDADFSKCSGSCTLR  169

Query  222  WYWLGIQYMDGIYSWQVYKNC  242
            +YWL +   +    WQ+YK C
Sbjct  170  FYWLALHEPN----WQIYKQC  186

>PYVX_18175
Length=147

 Score = 67.0 bits (162),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)

Query  172  LESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMD  231
            LE+ G+        W       + R+      +    +DYSSC  SCTL WYW+G++Y+ 
Sbjct  53   LENQGFKTQEDFSAWRRANGYKTLRSFMDSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLK  112

Query  232  GIYSWQVYKNCIGL  245
            G YSWQVYKNC+ L
Sbjct  113  GAYSWQVYKNCVPL  126

 Score = 42.0 bits (97),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLD  138
            Q V+ P P +   D  +    LA+L+ QG  T  +  +W++ +GY +LR+ +D
Sbjct  29   QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81

>PYIR_14463
Length=369

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 80/173 (46%), Gaps = 28/173 (16%)

Query  78   LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAML  137
            ++S L+E +  + P+ +     P  QGK     Q   +DT  +A + + E  + +LR +L
Sbjct  40   VSSPLAEFKDGVMPTKYTATMTPAFQGKFDDNPQ-ANVDTFTKAFNAQSE--FKTLRDLL  96

Query  138  DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTL------ESSGYTLD--GPCEVWFDD  189
             D            DCG  S P  + + IP +G +         G+     GPCEVW DD
Sbjct  97   KDHGA---------DCG-DSKPDASRKAIPGDGKVVWQNPDSGEGFVPSHTGPCEVWLDD  146

Query  190  TQVTSGRNCRTEF---PHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVY  239
             +V S  NC   F   P  +  VD+SSC   C LR+YWL +       +WQVY
Sbjct  147  KRVFSDENCAGHFTSKPKAELPVDFSSCKGDCMLRFYWLALHEP----TWQVY  195

>PYVX_21174
Length=95

 Score = 65.5 bits (158),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 35/64 (55%), Gaps = 8/64 (13%)

Query  173  ESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH--------QVDYSSCGDSCTLRWYW  224
            E  G+T  GPCE+WFDDT    G NC  E+P G           VDYS C   C LR+YW
Sbjct  8    EGGGFTHQGPCEIWFDDTLALRGDNCENEYPGGAVGSTDYSAIPVDYSLCKGDCVLRFYW  67

Query  225  LGIQ  228
            LG Q
Sbjct  68   LGFQ  71

>PHYKE_3912
Length=252

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 68/138 (49%), Gaps = 19/138 (14%)

Query  119  IEAQSWKQEHGYV-SLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SS  175
            IE Q W  E G +  +R + D D SLY        +CGFT  P+ T +D PT G    S 
Sbjct  46   IEPQ-WTGELGQLHDIRTLPDSDNSLYGA------NCGFTD-PNATPKDPPTIGDATFSC  97

Query  176  GYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCGDSC-TLRWYWLGI  227
            G    G CE+W DDT V S  +C+  +     +       +D S C  S   LR+YWL  
Sbjct  98   GMMHIGSCEIWLDDTMVLSSDDCQAAYRDDTQEKASVFTPIDCSLCSSSGYMLRFYWLAF  157

Query  228  QYMDGIYSWQVYKNCIGL  245
            Q +D    WQVYK+C+ L
Sbjct  158  QGVDSKVVWQVYKDCVPL  175

>PYIW_18792
Length=125

 Score = 66.2 bits (160),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 62/117 (53%), Gaps = 5/117 (4%)

Query  66   ALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWK  125
            +L L+V V+   L   +   Q V  P+P + V     Q   LA+L+ QG   + +  ++ 
Sbjct  8    SLVLAVAVSSAAL---VDAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYY  64

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGP  182
            +  GY +LR  +DD+  Y V     F+CG++SL   T Q IP  G L S+GYT DGP
Sbjct  65   KSKGYKNLRGFMDDKKAYKVD-GGNFECGWSSL-KGTPQPIPAGGALRSTGYTHDGP  119

>PHYCA_15125
Length=334

 Score = 69.7 bits (169),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 10/121 (8%)

Query  128  HGYVSLRAML-DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVW  186
             GY SL A +  +Q LY    D   DCG T         +P +  LE SG+T  GPCEVW
Sbjct  114  KGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPAS-ELEYSGFTHTGPCEVW  170

Query  187  FDDTQVTSGRNCRTEFPHGQHQVDY--SSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
             DDT+V    +C+T++P    ++ Y  S C ++  L  YW+G+        WQVY +C+ 
Sbjct  171  CDDTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGLHGD----PWQVYTDCVW  226

Query  245  L  245
            L
Sbjct  227  L  227

>PHYRA_80750
Length=275

 Score = 69.3 bits (168),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 69/133 (52%), Gaps = 17/133 (13%)

Query  118  SIEA-QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSG  176
            S++A ++ K  + +V L+ ++DD + +        DCGFT  PS T Q IP++G    S 
Sbjct  62   SVDAFKALKTANNFVDLKTLMDDTATFGA------DCGFTD-PSGTPQPIPSDGKATFSR  114

Query  177  YTLD-GPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC-GDSCT-LRWYWLGI  227
              +  GPCE+W DD +V    +C + + +          VDYS C G  C  +R+YWL  
Sbjct  115  AIVHVGPCEIWLDDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAF  174

Query  228  QYMDGIYSWQVYK  240
            Q +DG   WQ Y 
Sbjct  175  QGVDGKTVWQSYN  187

>PHYKE_9024
Length=299

 Score = 69.3 bits (168),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 10/121 (8%)

Query  128  HGYVSLRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVW  186
             GY SL A +  +Q LY  + DA  DCG T        ++P +  L  SG+T  GPCEVW
Sbjct  77   KGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPAS-KLTYSGFTHTGPCEVW  133

Query  187  FDDTQVTSGRNCRTEFPH--GQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
             DDT+V    +C+T++P        D S C ++  L  YW+G+        WQVY +C+ 
Sbjct  134  CDDTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGLHGD----PWQVYTDCVW  189

Query  245  L  245
            L
Sbjct  190  L  190

>PHALS_10635
Length=296

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 17/128 (13%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEV  185
            ++ +  LR++ +   +Y        +CG+T  P     D P +G    S G    G CE+
Sbjct  66   KNNFKDLRSLFEGNPIYGE------ECGYTD-PKGPPADRPNDGAATFSRGILHAGTCEI  118

Query  186  WFDDTQVTSGRNCRTEFPHGQHQ-------VDYSSCG-DSCTLRWYWLGIQYMDGIYSWQ  237
            WFDD  V    +C++ +  G  +       VDY  C  + C LR+YWL +Q +D    WQ
Sbjct  119  WFDDKMVLQNDDCQSAYGDGTKKTISVLKPVDYGLCAPEGCMLRFYWLALQRIDKTV-WQ  177

Query  238  VYKNCIGL  245
            VY+NCI L
Sbjct  178  VYRNCIPL  185

>PHYRA_83494
Length=224

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 49/106 (46%), Gaps = 18/106 (17%)

Query  153  CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG--  205
            CG T   S   Q +PT+G  +       G+T  GPCE++ DD  V  G NC  ++P G  
Sbjct  23   CGETDD-SAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDV  81

Query  206  ------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
                     VDYSSC   CT   YWL  Q       WQ Y NC+ L
Sbjct  82   GSTVTSDMPVDYSSCNGDCTFTIYWLAFQNA----QWQAYVNCVPL  123

>PHYCA_18657
Length=295

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 69/145 (48%), Gaps = 25/145 (17%)

Query  114  GIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTL-  172
            G D   + ++  +E G VS+R ++    L  V  D    CGFT    +  + +PTNG   
Sbjct  140  GGDQVGKYKTLAKEKG-VSVRDVI----LQMVGNDK--KCGFTRTDVDP-KPVPTNGKAV  191

Query  173  ----ESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQ--------VDYSSCGDSCTL  220
                +  G+T  GPCE++ DD  V    +C+ ++P G +         VDYSSC   CT 
Sbjct  192  WLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPNDSGIMSEMPVDYSSCNGDCTF  251

Query  221  RWYWLGIQYMDGIYSWQVYKNCIGL  245
              YWLG Q       WQ Y NC+ L
Sbjct  252  SIYWLGFQNA----QWQAYINCVPL  272

>PPTG_06253
Length=303

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 10/121 (8%)

Query  128  HGYVSLRAML-DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVW  186
             GY SL A +  +Q LY    D   DCG T        ++P +  LE +G+T  GPCEVW
Sbjct  77   KGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPAS-QLEYTGFTHTGPCEVW  133

Query  187  FDDTQVTSGRNCRTEFPHGQHQVDY--SSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
             DDT+V    +C+T++P    ++ Y  S C ++  L  YWL +        WQVY +C+ 
Sbjct  134  CDDTKVLFDYDCQTKYPDIPAKIPYDESKCANANRLTIYWLALHGD----PWQVYTDCVW  189

Query  245  L  245
            L
Sbjct  190  L  190

>PHYKE_2379
Length=285

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 88/203 (43%), Gaps = 36/203 (18%)

Query  61   LFHLLALSLSVCVTGQRLTSDLSEGQVVLYP------------SPHFIVDDPTIQGKALA  108
            +   +AL  ++      L +    G +++ P             P   +D P I G A  
Sbjct  1    MLKQVALVAALVTQAANLPTVFGHGNIIVPPPTGDSDHVYYFGGPAGTIDMPKIIGDASY  60

Query  109  YLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPT  168
                + +D       W  ++G  SL+  +   + Y  +   I +CG T L   T + IP+
Sbjct  61   GDYYEAVD------EWFTKNGISSLKEYI---TTYGTN---ISECGNT-LKDGTAEAIPS  107

Query  169  NGTLESS--GYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH----QVDYSSCGDSCTLRW  222
            +G  E    G +  GPCE+W DDT+V +  NC TEF  GQ      +D S+C  S    +
Sbjct  108  DGYAEHDTLGNSHPGPCEIWCDDTRVFNNTNCVTEF-SGQSPAKIPIDVSTCKASSEFVF  166

Query  223  YWLGIQYMDGIYSWQVYKNCIGL  245
            YWL +        WQVY NC+ L
Sbjct  167  YWLALHAQ----PWQVYINCVAL  185

>PHYRA_93650
Length=231

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 59/118 (50%), Gaps = 16/118 (14%)

Query  127  EHGYVS-LRAMLD-DQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPC  183
            E GY + +R +LD D SLY        DCGF S P+   +D P++GT     G    GPC
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGF-SDPNAKAKDPPSDGTATFERGLAHHGPC  126

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQ-YMDGIYSWQVYK  240
            E+W DDT V    +C   F       DY S  + C  R+YWL  Q    G Y WQ+YK
Sbjct  127  EIWLDDTMVLHNDDCAKAF----SVEDYMSI-NGCMFRFYWLAFQGSTSGKYVWQIYK  179

>PHYCA_19611
Length=531

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 65/129 (50%), Gaps = 14/129 (11%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIP------TNGTLESSGYTLDGPC  183
            Y SL+  ++D+ +  V+K+   +CG+T+ P E  Q +P      ++G  E    + +GPC
Sbjct  285  YTSLKEFMNDK-MVLVNKEFTKECGYTN-PKEAPQPVPKTYVEWSHGDGEGFTQSHEGPC  342

Query  184  EVWFDDTQVTSGRNCRTEFP--HGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKN  241
            EVW DDT+V    NC   FP    +   D  +C  S  L  YW+ +       SWQVY N
Sbjct  343  EVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALHSP----SWQVYIN  398

Query  242  CIGLGRNVT  250
            C  L +  +
Sbjct  399  CAALEKTTS  407

 Score = 38.5 bits (88),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYS--SCGDSCTLRWYWLGIQYMDGIYS  235
            T +GP  V      +T   NC   +P    +V Y   +C  +  L +YWL +       +
Sbjct  75   TSNGPTVVAKALPPLTKDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLALHSS----T  130

Query  236  WQVYKNCIGLGRNVT  250
            WQVY NC  L +  +
Sbjct  131  WQVYTNCAALEKTTS  145

>H257_11258
Length=371

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 91/199 (46%), Gaps = 28/199 (14%)

Query  66   ALSLSVCVTGQRLTSDLSEGQVVLYPSPHFI--VDDPT-----IQGKAL--AYLQEQGID  116
            ++++++ ++G  +   +     +L P+P F+    DP+     I G  L  A +  +  +
Sbjct  6    SIAMAMALSGAAVFPSVDAHGWILSPAPTFLDPYGDPSKFCGVINGNKLYPADVFNRSPE  65

Query  117  TSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE---  173
             + +A   + +  Y SL+   D         D   +CG T     T Q +P +G ++   
Sbjct  66   DNTKAFLARFKVDYTSLKQFFDKN-------DDCGECGITKF--GTAQKLPADGVVKWRN  116

Query  174  -SSGY--TLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYM  230
               G+  + +GPCEVW D+T V    NC    P G  Q+D + C  +  +   W+ +  +
Sbjct  117  GGEGFVSSHEGPCEVWCDNTVVFQNDNCARNVPSGNMQIDVAKCSGAKKMVVLWIALHAV  176

Query  231  DGIYSWQVYKNCIGLGRNV  249
            D    WQVYKNC+ L   V
Sbjct  177  D----WQVYKNCVALQDGV  191

>PYAP_22257
Length=247

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 72/154 (47%), Gaps = 23/154 (15%)

Query  99   DPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSL  158
            DP  +G+   Y  +   +     +++K +  + +L+ M++ Q            CG +S 
Sbjct  42   DPGFEGRK--YNNDPTSNVKAFTEAFKSQKTFKTLKDMVEKQ--------LKGSCGKSSG  91

Query  159  PS-----ETWQDIPTNGTLESSGY--TLDGPCEVWFDDTQVTSGRNCRTEFPH--GQHQV  209
                   E   D+    T E +G+  +  GPCE+W DDT+V    NC  +F     +  V
Sbjct  92   KGKPQSVEGLSDVHWENTEEKTGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPV  151

Query  210  DYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            +YS C   C LR+YWL +   +    WQVYKNC+
Sbjct  152  NYSVCKGECMLRFYWLALHEPE----WQVYKNCV  181

>PYAP_19707
Length=241

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 8/83 (10%)

Query  164  QDIPTNG--TLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGD-SCTL  220
            Q IPT+G  T + S   + GPCEVW D+T+V S + C  EFP+ + +VD++ C   SC L
Sbjct  79   QPIPTDGVLTFDISAVHI-GPCEVWLDNTKVASAKECWKEFPNKRIKVDFAKCKSGSCQL  137

Query  221  RWYWLGIQYMDGIYSWQVYKNCI  243
            RW W+          W+ + NC+
Sbjct  138  RWVWMATH----TSPWEFFDNCV  156

>PYAP_18138
Length=268

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 80/182 (44%), Gaps = 18/182 (10%)

Query  64   LLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQG-IDTSIEAQ  122
            L  + +S  +T   L+ D+     +  P P F      +        +  G I    E  
Sbjct  17   LNTIVVSTLLTAATLSEDVQAHTALKEPRPEFKPGKGGVGWVTHFNAEWPGKIPGGNEWA  76

Query  123  SWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIP-TNGTLESSGYTLDG  181
            +  ++HG   LR+ +D +         I +CG  SL   + + IP TN        T  G
Sbjct  77   AAAKQHGVKDLRSYIDAK---------ITECG-DSLKDVSPKPIPKTNTVTFERALTHKG  126

Query  182  PCEVWFDDTQVTSGRNCRTEFPHGQH-QVDYSSC-GDSCTLRWYWLGIQYMDGIYSWQVY  239
            PCE W DDT+V    +C   F       +DYS C G +C LR+YWLG+Q  D    WQVY
Sbjct  127  PCEFWIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGLQNSD----WQVY  182

Query  240  KN  241
            +N
Sbjct  183  RN  184

>PYIR_24867
Length=319

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 6/119 (5%)

Query  127  EHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVW  186
            E G      ++++Q ++    D +  CG T L       +P +G +  SG+T  GPCE+W
Sbjct  74   ESGGTMRDLIMENQKVWVEGVDPV--CGDTLLDEAKRTTMPASGKISFSGFTHPGPCELW  131

Query  187  FDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             DD ++    +C TE+P  +   D + C  +     YW+ +        WQVY NC+ L
Sbjct  132  CDDNKLAFANDCATEYPDNKVPFDAAKCAGANRFTLYWIAVHGT----PWQVYTNCVYL  186

>PHYCA_122958
Length=260

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 59/125 (47%), Gaps = 13/125 (10%)

Query  129  GYVSLRAMLDDQ-SLYHVSKDAIFDCGFTSLPSETWQ-DIPTNGTLESSGYTLDGPCEVW  186
            GY SLR MLD Q S    +K  +     + L    WQ D    G ++S      GPCEVW
Sbjct  77   GYSSLRNMLDQQVSDCANTKTDVSPVDVSGLTVMNWQNDQEQKGFIDSH----HGPCEVW  132

Query  187  FDDTQVTSGRNCRTEFPH---GQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
             DDT V    +C   +        + DYS C   CTLR+YWL +   +    WQ+YK C+
Sbjct  133  IDDTMVDHQDDCVATYGSSYPANVKADYSQCSGDCTLRFYWLALHEPN----WQIYKQCV  188

Query  244  GLGRN  248
             +  N
Sbjct  189  PIVNN  193

>PHALS_03179
Length=372

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 65/133 (49%), Gaps = 17/133 (13%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            QS K  + +  L+ +++  +L         +CGF S P    Q IP +G    S      
Sbjct  108  QSLKAANNFKDLKTLMETHALGP-------ECGF-SDPKGKPQPIPKDGKATLSRAIVHR  159

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQ------VDYSSC--GDSCTLRWYWLGIQYMDG  232
            GPCE+W D+ +V    +C  ++ +   +      VDYSSC  G    +R+YWL  Q + G
Sbjct  160  GPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKG  219

Query  233  IYSWQVYKNCIGL  245
            I  WQ YKNCI L
Sbjct  220  ITFWQSYKNCIPL  232

>PHYSO_476077
Length=268

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 60/129 (47%), Gaps = 31/129 (24%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFT----------SLPSETWQ-DIPTNGTLESSGY  177
            GY SLR MLD Q         + DC  T           L + +WQ D    G ++S   
Sbjct  80   GYSSLRDMLDQQ---------VTDCANTRTDVSPVDVSGLTTMSWQNDQEQKGFIDSH--  128

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHG---QHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
               GPCEVW DDT V    +C  ++  G   +   D+S C   CTLR+YWL +   +   
Sbjct  129  --HGPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALHEPN---  183

Query  235  SWQVYKNCI  243
             WQ+YK C+
Sbjct  184  -WQIYKQCV  191

>PHYSO_472009
Length=268

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 60/129 (47%), Gaps = 31/129 (24%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFT----------SLPSETWQ-DIPTNGTLESSGY  177
            GY SLR MLD Q         + DC  T           L + +WQ D    G ++S   
Sbjct  80   GYSSLRDMLDQQ---------VTDCANTRTDVSPVDVSGLTTMSWQNDQEQKGFIDSH--  128

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHG---QHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
               GPCEVW DDT V    +C  ++  G   +   D+S C   CTLR+YWL +   +   
Sbjct  129  --HGPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALHEPN---  183

Query  235  SWQVYKNCI  243
             WQ+YK C+
Sbjct  184  -WQIYKQCV  191

>SDRG_00948
Length=352

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 9/99 (9%)

Query  152  DCGFTSLPSETWQDIPT-----NGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQ  206
            +CG T L     Q +P+     +G  E    + +GPCE+W D+T+V    NC      G 
Sbjct  93   ECGITKLDPSKPQALPSVVRWRHGDNEGFTPSHEGPCELWCDNTRVYDNENCAKNIADGS  152

Query  207  HQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
              +D + C  + TLR++WL +       SWQVYKNC+ L
Sbjct  153  MPIDTAKCAGAKTLRFFWLALHSS----SWQVYKNCVAL  187

>PPTG_06249
Length=291

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 64/121 (53%), Gaps = 10/121 (8%)

Query  128  HGYVSLRAML-DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVW  186
             GY SL   +  +Q LY  S D   DCG+T        ++P    LE +G+T  GPCE+W
Sbjct  77   KGYDSLGQFIAKNQELY--SSDIDPDCGWTIYKDSARSELP-EAQLEYTGFTHPGPCEIW  133

Query  187  FDDTQVTSGRNCRTEFPHGQHQVDY--SSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
             DDT++    +C T++P    ++ Y  S C D+  L  YW+GI  +     WQ+Y +C+ 
Sbjct  134  CDDTKLLFDYDCWTKYPAIPAKIPYDKSKCADANRLTIYWIGIHGV----PWQIYTDCVW  189

Query  245  L  245
            L
Sbjct  190  L  190

>PHYKE_1913
Length=280

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 55/118 (47%), Gaps = 24/118 (20%)

Query  147  KDAIFD------CGFTSLPSETWQDIPTNGTL-----ESSGYTLDGPCEVWFDDTQVTSG  195
            KD + D      CG+T L     + +P++G          G+T  GPCEV+ +D  V  G
Sbjct  74   KDVVLDMVKDKTCGYT-LADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVLHG  132

Query  196  RNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             +C  E+P G        +  +DYSSC   CTL  YWL  Q       WQ Y NC+ L
Sbjct  133  DDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQNA----QWQAYINCVPL  186

>PYAR_18165
Length=261

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 6/68 (9%)

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGD--SCTLRWYWLGIQYMDGIYSWQV  238
            GPCE+W DDT+V S  +C  +FP  +  VD+S C +  SC LRW W+          W+ 
Sbjct  97   GPCEIWLDDTKVVSATDCWKQFPDKRIPVDFSKCANKASCELRWIWMATH----TSPWEF  152

Query  239  YKNCIGLG  246
            Y NC+ +G
Sbjct  153  YDNCVRVG  160

>PHYRA_78626
Length=473

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 66/165 (40%), Gaps = 52/165 (32%)

Query  86   QVVLYPSPHFIVDDPTIQG-----KALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQ  140
            QVV  PSP +   + +          L++L+++G +T      ++ ++GY SLR  LD  
Sbjct  281  QVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFLDK-  339

Query  141  SLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRT  200
                    A +    + L                                      NC  
Sbjct  340  --------AKYKLALSYL--------------------------------------NCHE  353

Query  201  EFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
                   ++DYS CGDSC L WYWLG +Y+ G YSWQVYK CI L
Sbjct  354  SITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  398

>SPRG_07799
Length=345

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 9/99 (9%)

Query  152  DCGFTSLPSETWQDIPT-----NGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQ  206
            +CG T L     Q +P+     +G  E    + +GPCE+W D+T+V    NC      G 
Sbjct  93   ECGITKLDPSKPQALPSVVRWRHGDNEGFTPSHEGPCELWCDNTRVYDNENCAKNIADGS  152

Query  207  HQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
              +D + C  + TLR++WL +       SWQVYKNC+ L
Sbjct  153  MAIDTTKCAGAKTLRFFWLALHSS----SWQVYKNCVAL  187

>PITG_08202
Length=191

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 62/121 (51%), Gaps = 20/121 (17%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            +S K  + +  LR ++DD S+Y        DCGFT+ P++T Q IP++G    S      
Sbjct  68   KSLKAANNFKDLRTLMDDTSVYGA------DCGFTN-PNDTPQPIPSDGKATFSRALVHH  120

Query  181  GPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSC--GDSCTLRWYWLGIQYMDGIYSWQV  238
            GPC +W DD       + ++ FP     VDYSSC  G    +R+YWL  Q ++    WQ 
Sbjct  121  GPCGIWLDDKM-----DIKSIFP-----VDYSSCSNGGCKQMRFYWLAFQGLNKKTVWQS  170

Query  239  Y  239
            Y
Sbjct  171  Y  171

>PHYKE_7717
Length=568

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)

Query  202  FPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
            FP   + +DYS+C  +CTLRWYWLG++++   YSWQVYK CI L
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  45

>PHYRA_78625
Length=434

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 66/165 (40%), Gaps = 52/165 (32%)

Query  86   QVVLYPSPHFIVDDPTIQG-----KALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQ  140
            QVV  PSP +   + +          L++L+++G +T      ++ ++GY SLR  LD  
Sbjct  242  QVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFLDK-  300

Query  141  SLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRT  200
                    A +    + L                                      NC  
Sbjct  301  --------AKYKLALSYL--------------------------------------NCHE  314

Query  201  EFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
                   ++DYS CGDSC L WYWLG +Y+ G YSWQVYK CI L
Sbjct  315  SITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  359

>PHYRA_79140
Length=424

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 59/124 (48%), Gaps = 24/124 (19%)

Query  147  KDAIFD------CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVTSG  195
            +D + D      CG T   S + Q IP++G  +       G+T  GPCE++ DDT V   
Sbjct  74   RDVVLDIVKGQKCGNTDD-SASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHS  132

Query  196  RNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGR  247
             NC+ ++P G           VDYSSC   CTL  YWL  Q       WQ Y NC+ L  
Sbjct  133  DNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPLSG  188

Query  248  NVTA  251
            + +A
Sbjct  189  SGSA  192

>PPTG_18176
Length=263

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 62/130 (48%), Gaps = 14/130 (11%)

Query  121  AQSWKQEHGYVSLRAMLDDQSL-YHVSKDAIFDCGFTSLPSETWQ-DIPTNGTLESSGYT  178
            A+ WK   GY SLR M+D  S  Y  S D       +      WQ D    G LES    
Sbjct  70   AEHWKAT-GYKSLRDMIDPISPGYGYSLDTAPPVDVSGYKEMWWQNDEYKEGFLESH---  125

Query  179  LDGPCEVWFDDTQVTSGRNCRTEFPHGQHQV--DYSSC-GDSCTLRWYWLGIQYMDGIYS  235
              GPCE W DDT+V    +C  EFP    ++  DYS+C GD C   +YWL +        
Sbjct  126  -HGPCEGWIDDTKVFHYDDCVAEFPSYPAKIPTDYSACKGDKCLFVFYWLALHSP----K  180

Query  236  WQVYKNCIGL  245
            WQ+YK C+ +
Sbjct  181  WQIYKQCVPI  190

>PHYRA_78176
Length=312

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 63/128 (49%), Gaps = 14/128 (11%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTN----GTLESSGYTL--  179
            +   Y SL+  +DD++   V+ DA   CG    P ET Q +P         +S G+T   
Sbjct  75   ESSSYSSLKEFIDDKATITVT-DATLTCGACD-PDETAQPLPETYVEWAHSDSEGFTASH  132

Query  180  DGPCEVWFDDTQVTSGRNCRTEFPHGQHQV--DYSSCGDSCTLRWYWLGIQYMDGIYSWQ  237
            +GPCEVW DD +V    +C  +F     Q+  D+ +C  S  L +YWL +       +WQ
Sbjct  133  EGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALHSS----TWQ  188

Query  238  VYKNCIGL  245
            VY NC  L
Sbjct  189  VYVNCAPL  196

>PHYKE_2454
Length=374

 Score = 67.4 bits (163),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 64/125 (51%), Gaps = 17/125 (14%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-----SSGYTL--DGP  182
            Y SL+A++DD++   VS  A   CG ++ PS   Q +P+  TLE     S G+T   +GP
Sbjct  76   YKSLKALIDDKAKITVSG-ATLTCG-SADPSAAAQPLPS--TLEWSHSDSEGFTPSHEGP  131

Query  183  CEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLR--WYWLGIQYMDGIYSWQVYK  240
            CE W DD +V    NC   FP    ++ Y S   S   R  +YW+ +       SWQVY 
Sbjct  132  CEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMHGP----SWQVYV  187

Query  241  NCIGL  245
            NC  L
Sbjct  188  NCAAL  192

>PYIR_23585
Length=240

 Score = 66.2 bits (160),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 63/121 (52%), Gaps = 15/121 (12%)

Query  128  HGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCEVW  186
             G+ + RA L+ +            CG T L + + + IP++ T++ S      GPCE+W
Sbjct  69   KGFATTRAFLESRGPT---------CGNT-LANASPKPIPSDNTVKFSRAIVHPGPCELW  118

Query  187  FDDTQVTSGRNCRTEFPHG--QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIG  244
             D+T+V    +C   F       ++D+S+C  SC LR+YWLG+Q  DG   +Q Y  C+ 
Sbjct  119  IDNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGARFQSYSKCLA  176

Query  245  L  245
            L
Sbjct  177  L  177

>PHYKE_5749
Length=300

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 53/118 (45%), Gaps = 24/118 (20%)

Query  147  KDAIFD------CGFTSLPSETWQDIPTNGTL-----ESSGYTLDGPCEVWFDDTQVTSG  195
            KD + D      CG T LP    Q IP++G       E  G+T  GPCE++ DD  V   
Sbjct  75   KDVVLDMVGSQTCGNT-LPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVLHS  133

Query  196  RNCRTEF---PHGQHQ-----VDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             +C  EF   P G  Q     VDYSSC   C    YWL  Q       WQ Y NC+ L
Sbjct  134  DDCEDEFKGGPVGSTQTSDMPVDYSSCNGKCLFTIYWLAFQNA----QWQTYINCVPL  187

>PITG_20631
Length=270

 Score = 66.6 bits (161),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 59/134 (44%), Gaps = 31/134 (23%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFT----------SLPSETWQ-DIPTNGTLESSGY  177
            GY SLR MLD Q         + DC  T           L    WQ D    G ++S   
Sbjct  80   GYSSLRDMLDQQ---------VADCANTRTDGSPVDVSGLSLMNWQNDEEQKGFIDSH--  128

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHG---QHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
               GPCEVW DDT V    +C   +  G     + D+S C   CTLR+YWL +   +   
Sbjct  129  --HGPCEVWIDDTMVDHQEDCVATYGTGYPANIKADFSKCSGDCTLRFYWLALHEPN---  183

Query  235  SWQVYKNCIGLGRN  248
             WQ+YK C+ +  N
Sbjct  184  -WQIYKQCVPIMNN  196

>PHYKE_10295
Length=292

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 62/129 (48%), Gaps = 30/129 (23%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFTSL----------PSETWQ-DIPTNGTLESSGYT  178
            + +LRA++D  +          DCG T+L           S  WQ D    G ++S    
Sbjct  75   FKTLRALMDTVAP---------DCGNTALTGSPVDVSALSSMKWQNDQEQKGFIDSH---  122

Query  179  LDGPCEVWFDDTQVTSGRNCRTEFPH--GQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSW  236
              GPCE W DDT+V    +CR ++P+   +  +DYSSC   CT  +YW+ +   +    W
Sbjct  123  -HGPCEAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMALHEPN----W  177

Query  237  QVYKNCIGL  245
            QVYK C  +
Sbjct  178  QVYKQCAPI  186

>PPTG_10186
Length=270

 Score = 66.6 bits (161),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 59/134 (44%), Gaps = 31/134 (23%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFT----------SLPSETWQ-DIPTNGTLESSGY  177
            GY SLR MLD Q         + DC  T           L    WQ D    G ++S   
Sbjct  80   GYSSLRDMLDQQ---------VTDCANTRTDVSPVDVSGLSVMNWQNDQEQKGFIDSH--  128

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHG---QHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
               GPCEVW DDT V    +C   +  G     + D+S C   CTLR+YWL +   +   
Sbjct  129  --HGPCEVWIDDTMVDHQDDCVAAYGTGYPASVKADFSKCSGDCTLRFYWLALHEPN---  183

Query  235  SWQVYKNCIGLGRN  248
             WQ+YK C+ +  N
Sbjct  184  -WQIYKQCVPIVNN  196

>PYAP_18713
Length=184

 Score = 65.1 bits (157),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 19/124 (15%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLDGPCE  184
            ++ G+  LR+ L+D+            CG T+ P+   +++P++  +  S      GPCE
Sbjct  68   KDKGFKDLRSFLEDKGPA---------CGKTN-PNAKPRNVPSDSKVVFSRPMVHRGPCE  117

Query  185  VWFDDTQVTSGRNCRTEFPHGQH----QVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYK  240
            +W DDT V    +C  EF  G+      VD+SSC   C LR+YWLG+Q  D    WQ Y 
Sbjct  118  LWIDDTMVYHNDDCELEF--GKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSGKRWQSYS  173

Query  241  NCIG  244
              I 
Sbjct  174  TYIA  177

>PHYSO_262844
Length=276

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 73/161 (45%), Gaps = 35/161 (22%)

Query  99   DPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFT--  156
            DP   G  L +      +T++  +S+     + +LRAM+D          A  DCG T  
Sbjct  47   DPAFAG--LKWNDNPEANTAMFTKSFPNSQ-FKTLRAMMDT---------AASDCGNTAL  94

Query  157  --------SLPSETWQ-DIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCR---TEFPH  204
                    SL S  WQ D    G ++S      GPCE W DDT+V    +CR   T +P 
Sbjct  95   TGSPVDVSSLSSMKWQNDQEQMGFIDSH----HGPCEAWIDDTRVFHSDDCRAAYTSYP-  149

Query  205  GQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245
             +  +DYS+C   CT  +YWL +   +    WQVYK C  +
Sbjct  150  AEIPIDYSACSGDCTFTFYWLALHEPN----WQVYKQCAPI  186

>PYIR_20481
Length=277

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 61/130 (47%), Gaps = 30/130 (23%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFT----------SLPSETWQ-DIPTNGTLESSGY  177
            GY SL+ MLD          ++  CGFT           L S  WQ D    G ++S   
Sbjct  74   GYKSLKEMLDL---------SVPGCGFTLTDGAPVDVSGLKSMKWQNDQEQKGFIDSH--  122

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPH--GQHQVDYSSCGDSCTLRWYWLGIQYMDGIYS  235
               GPCEVW D+T++    +CR ++     +  VDYS C   C L +YWL +   +    
Sbjct  123  --HGPCEVWIDNTKIMHSDDCRADYTAYPAEIPVDYSKCKGKCQLTFYWLALHEPN----  176

Query  236  WQVYKNCIGL  245
            WQ+YK C+ +
Sbjct  177  WQIYKQCVPI  186

>PITG_20312
Length=270

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 59/134 (44%), Gaps = 31/134 (23%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFT----------SLPSETWQ-DIPTNGTLESSGY  177
            GY SLR MLD Q         + DC  T           L    WQ D    G ++S   
Sbjct  80   GYSSLRDMLDQQ---------VADCANTRTDGSPVDVSGLSLINWQNDEEQKGFIDSH--  128

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHG---QHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
               GPCEVW DDT V    +C   +  G     + D+S C   CTLR+YWL +   +   
Sbjct  129  --HGPCEVWIDDTMVDHQEDCVATYGTGYPANIKADFSKCSGDCTLRFYWLALHEPN---  183

Query  235  SWQVYKNCIGLGRN  248
             WQ+YK C+ +  N
Sbjct  184  -WQIYKQCVPIMNN  196

>PHYRA_84732
Length=265

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 59/134 (44%), Gaps = 31/134 (23%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFT----------SLPSETWQ-DIPTNGTLESSGY  177
            GY SLR MLD Q         + DC  T           L    WQ D    G ++S   
Sbjct  80   GYSSLRDMLDQQ---------VTDCANTRTDVSPVDVSGLTVLNWQNDQEQKGFIDSHH-  129

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHG---QHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
               GPCEVW DDT+V    +C   +  G       D+S C   CTLR+YWL +   +   
Sbjct  130  ---GPCEVWIDDTKVDHQDDCVATYGSGYPASVSADFSKCSGDCTLRFYWLALHEPN---  183

Query  235  SWQVYKNCIGLGRN  248
             WQVYK C+ +  N
Sbjct  184  -WQVYKQCVPVVNN  196

>PHYRA_78174
Length=279

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 63/129 (49%), Gaps = 14/129 (11%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIP------TNGTLESSGYTLDGPC  183
            Y SL+ M+ D      S D   +CG+T+ P ET Q +P       +G+ E    + +GPC
Sbjct  77   YTSLKEMVSDLGKV-TSADFTMECGYTN-PDETAQPLPKTYVEWAHGSGEGFTSSHEGPC  134

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQV--DYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKN  241
            EVW DD +V    +C   +     +V  D+ +C  +  L +YWL +       +WQVY N
Sbjct  135  EVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLALHSS----TWQVYTN  190

Query  242  CIGLGRNVT  250
            C  L +  +
Sbjct  191  CAALEKTTS  199

>SDRG_17448
Length=262

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 50/91 (55%), Gaps = 11/91 (12%)

Query  162  TWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEF---PHGQHQVDYSSC-GDS  217
            TWQ+ P  G      +T  GPCEVW D+ +V    +C T F   P     VDYSSC GD 
Sbjct  2    TWQN-PDTGEGFIPSHT--GPCEVWLDNKRVFQNDDCATNFGDKPAAHLPVDYSSCAGDG  58

Query  218  CTLRWYWLGIQYMDGIYSWQVYKNCIGLGRN  248
            C LR+YW+ +   +    WQVYKNC+ L  N
Sbjct  59   CMLRFYWIALHQPE----WQVYKNCVPLQGN  85

>PITG_11936
Length=333

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 69/131 (53%), Gaps = 18/131 (14%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIP------TNGTLESSGYTL--DG  181
            Y SL+  ++D  +  V++D   +CG+T+ P  T Q +P      ++G  E  G+TL  +G
Sbjct  78   YKSLKEFMNDN-MVLVNEDFTKECGYTN-PDATPQPLPKTYVEWSHGAGE--GFTLSHEG  133

Query  182  PCEVWFDDTQVTSGRNCRTEFPHGQHQV--DYSSCGDSCTLRWYWLGIQYMDGIYSWQVY  239
            PCEV+ D+T+V    NC   FP    ++  D+ +C  S  L  YW+ +       SWQVY
Sbjct  134  PCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALHSP----SWQVY  189

Query  240  KNCIGLGRNVT  250
             NC  L +  +
Sbjct  190  INCAPLEKTTS  200

>SDRG_15426
Length=523

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 68/141 (48%), Gaps = 30/141 (21%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFT-------SLPSE---TWQDIPTNGT  171
            +++  +  Y +LR +LD             DCG T        +PS+   TWQ+ P  G 
Sbjct  38   KAFAAQSQYKTLRDLLDLSGP---------DCGNTRTNVAPKPIPSDGMMTWQN-PDTGE  87

Query  172  LESSGYTLDGPCEVWFDDTQVTSGRNCRTEF---PHGQHQVDYSSCG-DSCTLRWYWLGI  227
                 +T  GPCE+W D+ +V    NC T F   P  +  VDY+ CG + C LR+YWL +
Sbjct  88   GFIPSHT--GPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLAL  145

Query  228  QYMDGIYSWQVYKNCIGLGRN  248
                    WQVYKNC+ L  N
Sbjct  146  HQP----QWQVYKNCVPLQGN  162

>PHYSO_488139
Length=265

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 63/130 (48%), Gaps = 14/130 (11%)

Query  121  AQSWKQEHGYVSLRAMLDDQSL-YHVSKDAIFDCGFTSLPSETWQ-DIPTNGTLESSGYT  178
            A+ W Q  GY SLR M+D  S  Y  S D       +S     WQ D    G L S    
Sbjct  71   AEHW-QATGYKSLRDMIDPISPGYGKSLDTATPIDVSSYNEMWWQNDEYKEGFLGSH---  126

Query  179  LDGPCEVWFDDTQVTSGRNCRTEFPH--GQHQVDYSSC-GDSCTLRWYWLGIQYMDGIYS  235
              GPCE W DDT+V    +C  +FP    +  VDYS+C GD C   +YWL +   +    
Sbjct  127  -HGPCEGWIDDTKVFHYDDCVAKFPSYPAKIPVDYSACKGDKCLFVFYWLAVHSPE----  181

Query  236  WQVYKNCIGL  245
            WQ+YK C+ +
Sbjct  182  WQIYKQCVPI  191

>PHALS_03177
Length=259

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 69/138 (50%), Gaps = 18/138 (13%)

Query  118  SIEA-QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SS  175
            S++A QS K  + +  L+ ++D+  L         DCG+ S P+   Q IP +G    S 
Sbjct  62   SVKAFQSLKAANNFKDLKTLMDNPVLGR-------DCGY-SDPNGKPQPIPKDGKATFSR  113

Query  176  GYTLDGPCEVWFDDTQVTSGRNCRTEFPH------GQHQVDYSSC--GDSCTLRWYWLGI  227
                 GPCE+W D+ +V    +C +++ +          VDYSSC  G    +R+YWL  
Sbjct  114  AMVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAF  173

Query  228  QYMDGIYSWQVYKNCIGL  245
            Q ++G   WQ YK CI L
Sbjct  174  QGINGKTFWQSYKMCIPL  191

>PHYKE_2539
Length=258

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 60/137 (44%), Gaps = 31/137 (23%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFT----------SLPSETWQ-DIPTNGTLESSGY  177
            GY SLR MLD Q         + DC  T           L +  WQ D    G ++S   
Sbjct  67   GYSSLRDMLDQQ---------VTDCANTRTDVSPVDVSGLTTMNWQNDQEQKGFIDSHH-  116

Query  178  TLDGPCEVWFDDTQVTSGRNCRTEFPHG---QHQVDYSSCGDSCTLRWYWLGIQYMDGIY  234
               GPCEVW DDT V    +C   +  G       D+S C   CTLR+YW+ +   +   
Sbjct  117  ---GPCEVWIDDTLVDHQDDCVATYGSGYPASVNADFSKCSGDCTLRFYWIALHEPN---  170

Query  235  SWQVYKNCIGLGRNVTA  251
             WQ+YK C+ +  N  A
Sbjct  171  -WQIYKQCVPVVNNSGA  186

>PHALS_03176
Length=207

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 62/133 (47%), Gaps = 17/133 (13%)

Query  122  QSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE-SSGYTLD  180
            Q  K  + +  L+ ++D  +           CGF+  P    Q IP +G    S      
Sbjct  67   QKLKAANKFKDLKTLMDTSAFGA-------KCGFSD-PKGKPQPIPKDGKATFSRAIVHT  118

Query  181  GPCEVWFDDTQVTSGRNCRTEFPH------GQHQVDYSSC--GDSCTLRWYWLGIQYMDG  232
            GPCE+W D+ +V    +C +++ +          VDYSSC  G    +R+YWL  Q ++G
Sbjct  119  GPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNG  178

Query  233  IYSWQVYKNCIGL  245
               WQ YKNCI L
Sbjct  179  KTVWQSYKNCIPL  191

>SPRG_07826
Length=371

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 73/159 (46%), Gaps = 21/159 (13%)

Query  96   IVDDPT-IQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLD--DQSLYHVSKDAIFD  152
             +D PT + G A  Y Q+ G + +  A ++K    Y +L+A LD  D S           
Sbjct  43   TIDGPTSLPGSA--YNQDPGYNAAQFAANFKTSK-YKTLKAFLDAWDTSAQ------CGQ  93

Query  153  CGFTSLPSETWQDIPT-----NGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH  207
            CG T + +   Q +P+     +G  E    + +GPCE+W D+T+V    +C    P G  
Sbjct  94   CGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWCDETRVYYNDDCAKNIPDGSM  153

Query  208  QVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLG  246
             +D S C  +  L   W+ +        WQ YKNC+ +G
Sbjct  154  PIDTSKCAGAKQLTMLWMALH----TPQWQAYKNCVAIG  188

>H257_11306
Length=369

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 59/125 (47%), Gaps = 16/125 (13%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE----SSGY--TLDGPC  183
            Y+SLR  ++  S           CG T++   T Q I   GT++      G+  T +GPC
Sbjct  78   YMSLRDFVNKNSA------TCGACGLTTMVGSTPQSINPAGTIQWKHDDEGFVETHNGPC  131

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            EVW DD+ V    NC    P G  +VD   C  + +L  YWL +        WQVY NC+
Sbjct  132  EVWCDDSIVFQDDNCPLHEPSGLLRVDMDKCRKAKSLVIYWLALHSPQ----WQVYLNCV  187

Query  244  GLGRN  248
             LG N
Sbjct  188  ALGGN  192

>PHYSO_524101
Length=308

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 64/128 (50%), Gaps = 14/128 (11%)

Query  126  QEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTN----GTLESSGYTL--  179
            +   Y SL+ +++D++   V+ DA   CG    P ET Q +P         +S G+T   
Sbjct  74   ESSSYSSLKELINDKATITVT-DATLTCGMCD-PDETAQPLPDTYVEWAHSDSEGFTASH  131

Query  180  DGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDY--SSCGDSCTLRWYWLGIQYMDGIYSWQ  237
            +GPCEVW DD +V    +C  ++     ++ Y   +C  S TL +YWL +       +WQ
Sbjct  132  EGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALHSS----TWQ  187

Query  238  VYKNCIGL  245
            VY NC  L
Sbjct  188  VYVNCAPL  195

>H310_05438
Length=339

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 55/122 (45%), Gaps = 19/122 (16%)

Query  130  YVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLE----SSGY--TLDGPC  183
            Y SL+   D         D   +CG T       Q +P NG ++      G+  + +GPC
Sbjct  79   YTSLKQFFD-------KNDNCGECGITKFGDA--QKLPANGVVQWRNGGEGFVSSHEGPC  129

Query  184  EVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            E+W D+T V    NC    P G  Q+D + C  S      W+ +  +D    WQVYKNC+
Sbjct  130  ELWCDNTLVFQNDNCARNLPSGDMQIDVAKCAGSKKFIALWIALHSVD----WQVYKNCV  185

Query  244  GL  245
             L
Sbjct  186  AL  187

>PHYRA_83500
Length=394

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 58/124 (47%), Gaps = 24/124 (19%)

Query  147  KDAIFD------CGFTSLPSETWQDIPTNGTLE-----SSGYTLDGPCEVWFDDTQVTSG  195
            +D + D      CG T   S + Q IP++G  +       G+T  GPCE++ DDT V   
Sbjct  74   RDVVLDIVKGQKCGNTDD-SASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHS  132

Query  196  RNCRTEFPHG--------QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGR  247
             NC+ ++P G           VDYSSC   CTL  YWL  Q       WQ Y NC  L  
Sbjct  133  DNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPLSG  188

Query  248  NVTA  251
            + +A
Sbjct  189  SGSA  192

>PHYCA_6388
Length=294

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 62/118 (53%), Gaps = 10/118 (8%)

Query  129  GYVSLRAML-DDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWF  187
            G  SL+A++  +Q LY+   D   +CG T+        +P +  LE +G+T  GPCEVW 
Sbjct  78   GGGSLKALISKNQKLYNDKVDP--ECGLTAFKDSARSKLPAS-QLEFTGFTHPGPCEVWC  134

Query  188  DDTQVTSGRNCRTEFPHGQHQVDY--SSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243
            DDT+V    NC+ ++P    ++ Y  S C  +  L  +W+ +        WQVY +C+
Sbjct  135  DDTKVLFDYNCQAKYPDIPAKIPYDESKCSGANRLTIHWIAVHGE----PWQVYTDCV  188

>PYAP_19712
Length=276

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 14/118 (12%)

Query  129  GYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNG--TLESSGYTLDGPCEVW  186
            G  +  A++ + +  H SK     CG T  P+   Q IP +G   L+ +   + GPCE+W
Sbjct  53   GPYTGNAVVKELADSHGSK-----CGKTD-PNGAVQPIPADGYVQLQITAAHI-GPCELW  105

Query  187  FDDTQVTSGRNCRTEFPHGQHQVDYSSCGDS-CTLRWYWLGIQYMDGIYSWQVYKNCI  243
             D   V S + C  E+P  + +VD+S C  S C LRW WL          W++Y NC+
Sbjct  106  LDGEMVASAKQCVKEYPDRKIKVDFSKCKSSKCQLRWVWLATHN----SPWEIYDNCV  159

Lambda      K        H        a         alpha
   0.320    0.135    0.429    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13725911664

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40