Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_070951475361358930910.0
PHYKE_83911475377858924700.0
PHYCA_5561601475364958924590.0
PITG_184521475385658924260.0
PHALS_064811475364458922230.0
PHYSO_3489011475352648921870.0
PHYRA_508551475348946721220.0
PYIR_134521475364559121000.0
PYAP_177619907562258920930.0
PYIW_199721475360959319560.0
PYAR_135699907549447518590.0
PYVX_181701475351054317620.0
H310_085901475364059317110.0
H257_084361475364259317020.0
SDRG_167201475362859316160.0
SPRG_141031475362859316130.0
SDRG_1440812408752848910092e-129
SPRG_0407412408750948810054e-129
PHALS_08068109044974835993e-69
PHYSO_254571109044894785872e-67
PYAR_17512109045335305789e-66
PHYKE_103271090612004966002e-65
SDRG_150451241574944685705e-65
SDRG_111311368074944685653e-64
SDRG_03823114284974675611e-63
PYAP_21882109045024815601e-63
PYIR_17506109045094925575e-63
SDRG_038221356704944725566e-63
PHYCA_504517114284934695531e-62
PPTG_18033109045004955513e-62
PHYRA_71927109044854855494e-62
SPRG_11769109044534695466e-62
PYIW_25301109045124875497e-62
SPRG_05609114284964805426e-61
SDRG_12187109044624735362e-60
PPTG_09787114284934695339e-60
PITG_14083114284934695331e-59
CCI11048114284964655321e-59
PYAP_234351008029514685512e-59
PHYSO_550665114284914695285e-59
H310_11259114285194895288e-59
H257_09722114285184835262e-58
H310_144471462305014715182e-57
PHYRA_72037114284934695154e-57
PITG_13427109044634685101e-56
PHALS_09136114284934695111e-56
CCA23647114284964595102e-56
H257_170371462304984525084e-56
PHYCA_7619109044624735039e-56
HYAP_08763114284734574995e-55
PHYKE_6836114284934714901e-53
PYVX_21517109044825174742e-51
HYAP_04843109044304104301e-45
PYIR_23431114284684504012e-41
PYAR_177141008024444673976e-41
PYAP_226451707615654783753e-36
PYIR_20273124015054843653e-36
PYVX_16175114284464703562e-35
CCI10477124014944813564e-35
CCA22989124014944823564e-35
HYAP_12621124015014793319e-32
PYVX_21248124015024313071e-28
PHYSO_556052124015004802911e-26
PHYRA_72215124014994802902e-26
SPRG_199431356703432392806e-26
PITG_15359124014964822866e-26
PHYCA_123621124014954792841e-25
PHYKE_9680124014984332841e-25
PYU1_G014259109042442232683e-25
H257_01186151564964812723e-24
PYAR_20075170764694702706e-24
PHALS_09942124014965042706e-24
CCA16670151565204802691e-23
CCI50816151568074842702e-23
H310_00561151564974792662e-23
SPRG_09825124014924852618e-23
PHYRA_47253151564814982609e-23
PHALS_10055151565164982601e-22
SDRG_06945124014924852582e-22
PYVX_20512151565284942547e-22
PYAR_16840151565365092548e-22
PPTG_09121151565205012521e-21
H310_02523124014944412512e-21
PHYRA_7388315665515212522e-21
PYU1_G00173714753133762284e-21
H310_0764115665485172485e-21
PHYCA_50444515665485502476e-21
PYAP_19280151565124932459e-21
CCI3999315665505152461e-20
PHALS_1202815665793692451e-20
PPTG_0093815665505372441e-20
SPRG_1205415665585202442e-20
SDRG_0506015665595202432e-20
PYU1_G011605151565244962404e-20
H257_16541124014944432395e-20
H257_0745015665673872405e-20
PYIW_19795151565194952396e-20
PITG_18935150674804812361e-19
SDRG_14446151564954772342e-19
PHYCA_555180151565215062342e-19
PYIW_2025715665033672315e-19
CCA1403015665605182325e-19
PYU1_G00569915665505192315e-19
PHYKE_980715665575472309e-19
PYIR_1413215665135132281e-18
PYIW_251901648732061772124e-18
PYIW_24688114282592612102e-17
PYVX_2349915665195252173e-17
HYAP_0414915665645332183e-17
PYAP_1914815665355252173e-17
PPTG_13000124013873362143e-17
PHYKE_2864151564864912146e-17
PHYSO_48941815664714721985e-15
PYAR_1666415665774151952e-14
PHYSO_562795151564153331871e-13
PYIR_21896151565184981852e-13
PITG_19065151564163331824e-13
PITG_0177815664704661782e-12
HYAP_08069650262552191642e-11
SPRG_04114151563763631531e-09
PPTG_247122910367621256e-08
HYAP_13613151564232251317e-07
PITG_19802156311851581124e-05
SPRG_186431333348574910.003
PYIW_2756812401128114870.028
PYAP_15943241513930780.64
CCI40989241655275810.90
PYU1_G000378105671070172791.7
SPRG_042311241579043712.2
PITG_02760241516530742.6
SDRG_0669012467665758763.2
HYAP_080686502510058703.4
PYU1_G014369634703164763.8
SPRG_0186512301263865763.8
PYU1_G004385241656230754.0
SDRG_05159241655172754.0
PYVX_18330241655830754.1
PPTG_162941508840645754.1
SDRG_0824612301281765754.7
H310_07705241654664755.0
SPRG_08354241655064745.4
SPRG_17626132408148116715.4
PHYCA_1311391508840645745.4
PHYKE_5677241621130725.7
PYAP_22849105671089147745.9
PHYSO_507629634703167746.6
PITG_05097434365367737.6
PPTG_05518241655430738.2
PYAR_242108578716634708.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_07095

Length=613
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP_07095                                                            1195       0.0   
PHYKE_8391                                                            956        0.0   
PHYCA_556160                                                          951        0.0   
PITG_18452                                                            939        0.0   
PHALS_06481                                                           860        0.0   
PHYSO_348901                                                          847        0.0   
PHYRA_50855                                                           822        0.0   
PYIR_13452                                                            813        0.0   
PYAP_17761                                                            810        0.0   
PYIW_19972                                                            758        0.0   
PYAR_13569                                                            720        0.0   
PYVX_18170                                                            683        0.0   
H310_08590                                                            663        0.0   
H257_08436                                                            660        0.0   
SDRG_16720                                                            627        0.0   
SPRG_14103                                                            625        0.0   
SDRG_14408                                                            393        2e-129
SPRG_04074                                                            391        4e-129
PHALS_08068                                                           235        3e-69 
PHYSO_254571                                                          230        2e-67 
PYAR_17512                                                            227        9e-66 
PHYKE_10327                                                           235        2e-65 
SDRG_15045                                                            224        5e-65 
SDRG_11131                                                            222        3e-64 
SDRG_03823                                                            220        1e-63 
PYAP_21882                                                            220        1e-63 
PYIR_17506                                                            219        5e-63 
SDRG_03822                                                            218        6e-63 
PHYCA_504517                                                          217        1e-62 
PPTG_18033                                                            216        3e-62 
PHYRA_71927                                                           216        4e-62 
SPRG_11769                                                            214        6e-62 
PYIW_25301                                                            216        7e-62 
SPRG_05609                                                            213        6e-61 
SDRG_12187                                                            211        2e-60 
PPTG_09787                                                            209        9e-60 
PITG_14083                                                            209        1e-59 
CCI11048                                                              209        1e-59 
PYAP_23435                                                            216        2e-59 
PHYSO_550665                                                          207        5e-59 
H310_11259                                                            207        8e-59 
H257_09722                                                            207        2e-58 
H310_14447                                                            204        2e-57 
PHYRA_72037                                                           202        4e-57 
PITG_13427                                                            201        1e-56 
PHALS_09136                                                           201        1e-56 
CCA23647                                                              201        2e-56 
H257_17037                                                            200        4e-56 
PHYCA_7619                                                            198        9e-56 
HYAP_08763                                                            196        5e-55 
PHYKE_6836                                                            193        1e-53 
PYVX_21517                                                            187        2e-51 
HYAP_04843                                                            170        1e-45 
PYIR_23431                                                            159        2e-41 
PYAR_17714                                                            157        6e-41 
PYAP_22645                                                            149        3e-36 
PYIR_20273                                                            145        3e-36 
PYVX_16175                                                            141        2e-35 
CCI10477                                                              141        4e-35 
CCA22989                                                              141        4e-35 
HYAP_12621                                                            132        9e-32 
PYVX_21248                                                            122        1e-28 
PHYSO_556052                                                          116        1e-26 
PHYRA_72215                                                           116        2e-26 
SPRG_19943                                                            112        6e-26 
PITG_15359                                                            114        6e-26 
PHYCA_123621                                                          114        1e-25 
PHYKE_9680                                                            114        1e-25 
PYU1_G014259                                                          107        3e-25 
H257_01186                                                            109        3e-24 
PYAR_20075                                                            108        6e-24 
PHALS_09942                                                           108        6e-24 
CCA16670                                                              108        1e-23 
CCI50816                                                              108        2e-23 
H310_00561                                                            107        2e-23 
SPRG_09825                                                            105        8e-23 
PHYRA_47253                                                           104        9e-23 
PHALS_10055                                                           104        1e-22 
SDRG_06945                                                            103        2e-22 
PYVX_20512                                                            102        7e-22 
PYAR_16840                                                            102        8e-22 
PPTG_09121                                                            101        1e-21 
H310_02523                                                            101        2e-21 
PHYRA_73883                                                           101        2e-21 
PYU1_G001737                                                          92.4       4e-21 
H310_07641                                                            100        5e-21 
PHYCA_504445                                                          99.8       6e-21 
PYAP_19280                                                            99.0       9e-21 
CCI39993                                                              99.4       1e-20 
PHALS_12028                                                           99.0       1e-20 
PPTG_00938                                                            98.6       1e-20 
SPRG_12054                                                            98.6       2e-20 
SDRG_05060                                                            98.2       2e-20 
PYU1_G011605                                                          97.1       4e-20 
H257_16541                                                            96.7       5e-20 
H257_07450                                                            97.1       5e-20 
PYIW_19795                                                            96.7       6e-20 
PITG_18935                                                            95.5       1e-19 
SDRG_14446                                                            94.7       2e-19 
PHYCA_555180                                                          94.7       2e-19 
PYIW_20257                                                            93.6       5e-19 
CCA14030                                                              94.0       5e-19 
PYU1_G005699                                                          93.6       5e-19 
PHYKE_9807                                                            93.2       9e-19 
PYIR_14132                                                            92.4       1e-18 
PYIW_25190                                                            86.3       4e-18 
PYIW_24688                                                            85.5       2e-17 
PYVX_23499                                                            88.2       3e-17 
HYAP_04149                                                            88.6       3e-17 
PYAP_19148                                                            88.2       3e-17 
PPTG_13000                                                            87.0       3e-17 
PHYKE_2864                                                            87.0       6e-17 
PHYSO_489418                                                          80.9       5e-15 
PYAR_16664                                                            79.7       2e-14 
PHYSO_562795                                                          76.6       1e-13 
PYIR_21896                                                            75.9       2e-13 
PITG_19065                                                            74.7       4e-13 
PITG_01778                                                            73.2       2e-12 
HYAP_08069                                                            67.8       2e-11 
SPRG_04114                                                            63.5       1e-09 
PPTG_24712                                                            52.8       6e-08 
HYAP_13613                                                            55.1       7e-07 
PITG_19802                                                            47.8       4e-05 
SPRG_18643                                                            39.7       0.003 
PYIW_27568                                                            38.1       0.028 
PYAP_15943                                                            34.7       0.64  
CCI40989                                                              35.8       0.90  
PYU1_G000378                                                          35.0       1.7   
SPRG_04231                                                            32.0       2.2   
PITG_02760                                                            33.1       2.6   
SDRG_06690                                                            33.9       3.2   
HYAP_08068                                                            31.6       3.4   
PYU1_G014369                                                          33.9       3.8   
SPRG_01865                                                            33.9       3.8   
PYU1_G004385                                                          33.5       4.0   
SDRG_05159                                                            33.5       4.0   
PYVX_18330                                                            33.5       4.1   
PPTG_16294                                                            33.5       4.1   
SDRG_08246                                                            33.5       4.7   
H310_07705                                                            33.5       5.0   
SPRG_08354                                                            33.1       5.4   
SPRG_17626                                                            32.0       5.4   
PHYCA_131139                                                          33.1       5.4   
PHYKE_5677                                                            32.3       5.7   
PYAP_22849                                                            33.1       5.9   
PHYSO_507629                                                          33.1       6.6   
PITG_05097                                                            32.7       7.6   
PPTG_05518                                                            32.7       8.2   
PYAR_24210                                                            31.6       8.5   

>HYAP_07095
Length=613

 Score = 1195 bits (3091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/589 (100%), Positives = 589/589 (100%), Gaps = 0/589 (0%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
            MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60

Query  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
            VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED
Sbjct  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120

Query  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
            DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK
Sbjct  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180

Query  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
            KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRS
Sbjct  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRS  240

Query  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
            KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI
Sbjct  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300

Query  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
            FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM
Sbjct  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360

Query  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
            QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA
Sbjct  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420

Query  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
            GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY
Sbjct  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
            DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK
Sbjct  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP
Sbjct  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589

>PHYKE_8391
Length=778

 Score = 956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/589 (79%), Positives = 519/589 (88%), Gaps = 7/589 (1%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
            M ++YP +V+FETHAFEDRDAFKQWLSTS + FV  FG DSKA THVTSPFVW SNP  F
Sbjct  173  MQMLYPDKVSFETHAFEDRDAFKQWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKF  232

Query  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
            VGGCDDLLA FRSG+AVG+ Q      +  E  +  A ++   + S +  + TP + +E+
Sbjct  233  VGGCDDLLAFFRSGVAVGSPQGA----DPAEKAEAAASIE--VAESSMTVTETPAVPMEE  286

Query  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
            + SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  287  ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  346

Query  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
            KLMHQSSLIGE +HHD A+FGWNV S  G+  TFDWKQLVSNV SYIKSI+FKYKVELRS
Sbjct  347  KLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRS  406

Query  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
            K VKYEN LGSF+DPHTL+LWHP+KGTK+ITTRHVV+AVGGRP+QL C G E A+SSDDI
Sbjct  407  KYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDI  466

Query  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
            FWMK+  PGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+
Sbjct  467  FWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEV  526

Query  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
            Q+GIEFIRKTVP+SITKL++GQLLVKW TED +  EETFDTVLNATGRDPDVAKLGLD+A
Sbjct  527  QAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKA  586

Query  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
            GVKLNEKTGRIW  NEQT+TPN++AIGDVIDAPELTPVAIQAGR LSRRLYN  TVQMDY
Sbjct  587  GVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDY  646

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
            DK+CTAVFTPIEYGCCGLSEEDS E +G+D+VEVYHKNFVPLEWSL+E +R ++ESCYVK
Sbjct  647  DKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLEWSLSE-SRTSSESCYVK  705

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            V+CD TR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  706  VICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  754

>PHYCA_556160
Length=649

 Score = 951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/589 (78%), Positives = 515/589 (87%), Gaps = 6/589 (1%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
            M ++YP RV FE H FEDR+AFK WLS S ++F T FG+DSKAT HVTSPFVW SNPT F
Sbjct  43   MQMLYPDRVTFELHPFEDREAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAF  102

Query  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
            VGGCDDLL  FRSG+ VGN Q       +G   + TA  D   S + + E+ T      +
Sbjct  103  VGGCDDLLTYFRSGVGVGNPQGATP---NGSPTEKTAEADVPMSETSVEETSTADA---E  156

Query  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
            + +YDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  157  ETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  216

Query  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
            KLMHQSSLIGE++HHD A+FGWN+ S +G  PTF+WKQLVSNV  YIKSI+FKYKVELRS
Sbjct  217  KLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRS  276

Query  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
            K VKYEN LGSFV+PHTL+LWHP+KGTK+ITTR VVIAVGGRP++L C GGE A+SSDDI
Sbjct  277  KYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  336

Query  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
            FWMK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA KIGEYME+
Sbjct  337  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEV  396

Query  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
            QSGIEFIRKTVPQSITKL++GQLLVKW +EDG+  EE FDTVLNATGRDPDVAKL LD+A
Sbjct  397  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  456

Query  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
            GVKLNEK+GRIWV NEQT+TPN+YAIGDVIDAPELTPVAIQAGRLLSRRLYN  TVQMDY
Sbjct  457  GVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDY  516

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
            +K+CTAVFTPIEYGCCG+SEEDSKE +G+D++EVYH NFVPLEWSL+  TR AAESCY+K
Sbjct  517  EKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLK  576

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            V+CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  577  VICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  625

>PITG_18452
Length=856

 Score = 939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/589 (78%), Positives = 506/589 (86%), Gaps = 4/589 (1%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
            M ++YP RVAFETH FEDR+AFKQWLS S +D    FG DS+AT HVTSPFVW S  T F
Sbjct  43   MQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSS--TIF  100

Query  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
            VGGCD+LLA FRSGIAVG  Q V  + +        AP  D +      E  T     ++
Sbjct  101  VGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAPETDGSMPDVAAE--TSSTAAKE  158

Query  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
            +ASYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  159  EASYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  218

Query  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
            KLMHQSSLIGE+LHHD ASFGWNV S  G  P FDWKQLV+NV  YI+ I+FKYKVELRS
Sbjct  219  KLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRS  278

Query  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
            K VKYEN LGSF+DPHTL+LWHP+KG+K+ITTR VVIAVGGRPR+L   GGE A+SSDDI
Sbjct  279  KYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDI  338

Query  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
            FWMK KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+
Sbjct  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEV  398

Query  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
            QSGIEFIRKTVPQSITKL++GQLLVKW +EDG+  EE FD+VLNATGRDPD+AKL LD+A
Sbjct  399  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKA  458

Query  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
            GVKLNEKTGRIWV +EQT+TPN+YAIGDVIDAPELTPVAIQAGRLLSRRLYN  TVQMDY
Sbjct  459  GVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDY  518

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
            DK+CTAVFTPIEYGCCGLSEEDS + +G D +EVYH NFVPLEWSL+ +TR AAESCYVK
Sbjct  519  DKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVK  578

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            V+CD+ R+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  579  VICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  627

>PHALS_06481
Length=644

 Score = 860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/589 (72%), Positives = 485/589 (82%), Gaps = 21/589 (4%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
            M ++YP R+AF+   FEDR+ F+ WL  S  DF   FG  SKA  HVTSPFVW SNPTTF
Sbjct  53   MQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGAKSKAMKHVTSPFVWSSNPTTF  112

Query  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
            VGGCDDLL  FRSGIAVG  Q +        T D  A +  TA              V++
Sbjct  113  VGGCDDLLLFFRSGIAVGRPQGM-------HTSDEVAEISSTA--------------VQE  151

Query  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
               +DYDLVVIGGG GGLACSKEAASFG+KVCVLDYVKPSP GT+WGLGGTCVNVGCIPK
Sbjct  152  KPIFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPK  211

Query  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
            KL+HQSSLIGEI+ HD A FGW   +    VP FDWKQLV+NV  YIK+I+FKYKV+LRS
Sbjct  212  KLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRS  271

Query  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
            K VKYEN LGSFVDPHT+KL HP+KGTK+ITTR+VVIAVG RPR+L C GGE AVSSDDI
Sbjct  272  KNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDI  331

Query  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
            FWMK+KEPGKTLV+GASYVALECAGFLKGMGY VKVMVRSILLR FDQ+MA KIGEYME+
Sbjct  332  FWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEV  391

Query  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
            QSGI+FIRKTVPQSI++L++ QLLVKW+ E G   EE F+TVLNATGRDP+VA LGLD+A
Sbjct  392  QSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKA  451

Query  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
            GVKLNEKTGRI V NEQT+T N+YAIGDV+DAPELTPVAIQ+GRLLS+RLYN  +VQMDY
Sbjct  452  GVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDY  511

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
            DK+CT VFTPIEYGCCGLSEE SK  YG+D++E+YH NFVPLEWSL+ +TR A+ SCY+K
Sbjct  512  DKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIK  571

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            VVCDK+R+ FVLGFHYLGPNAGEV QAMGLAM+L FTYDQ+V+TVGIHP
Sbjct  572  VVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHP  620

>PHYSO_348901
Length=526

 Score = 847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/489 (83%), Positives = 447/489 (91%), Gaps = 0/489 (0%)

Query  101  DTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPS  160
            +T    ++++  TP  V E + SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPS
Sbjct  14   NTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPS  73

Query  161  PHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLV  220
            P GTSWGLGGTCVNVGCIPKKLMHQSSLIGE++HHD A+FGWN+ S +G   TF WKQLV
Sbjct  74   PQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLV  133

Query  221  SNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVG  280
            +NV  YI+ I+FKYKVELRSK VKYEN LGSFVD HTL+LWHP+KGTK+ITTR VVIAVG
Sbjct  134  ANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVG  193

Query  281  GRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRS  340
            GRP++L C GGE A+SSDDIFWMK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRS
Sbjct  194  GRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  253

Query  341  ILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFD  400
            ILLRGFDQDMA+KIGEYME+QSGIEFIRKTVPQSITKL++GQLLVKW TEDG+  EE FD
Sbjct  254  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFD  313

Query  401  TVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAI  460
            TVLNATGRDPDVAKLGLD+A VKLNEKTGRIWV NEQT+TPN+YAIGDVIDAPELTPVAI
Sbjct  314  TVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAI  373

Query  461  QAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  520
            QAGRLLSRRLYN  T QMDYDKICTAVFTPIEYGCCGLSEEDSKE YG+D++EVYHKNFV
Sbjct  374  QAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFV  433

Query  521  PLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  580
            PLEWSL+E+TR AAESCY+KV+CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ
Sbjct  434  PLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  493

Query  581  LVDTVGIHP  589
            +VDTVGIHP
Sbjct  494  MVDTVGIHP  502

>PHYRA_50855
Length=489

 Score = 822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/467 (86%), Positives = 436/467 (93%), Gaps = 2/467 (0%)

Query  123  SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKL  182
            SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKL
Sbjct  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60

Query  183  MHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQ  242
            MHQSSLIGE++HHD A+FGWNV S  G  PTF+WKQLVSNV +YIKSI+FKYKVELRSK 
Sbjct  61   MHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119

Query  243  VKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFW  302
            VKYEN LGSFVDPHTL+LWH +KGTK+ITTR VVIAVGGRP++L+C GGE A+SSDDIFW
Sbjct  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179

Query  303  MKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEMQS  362
            MK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+QS
Sbjct  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239

Query  363  GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGV  422
            GIEFIRKTVPQSIT L++GQLLVKW  EDG+  EE FDTVLNATGRDPDVAKLGLD+AGV
Sbjct  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299

Query  423  KLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDK  482
            KLNEK+GRIWV NEQT+T N+YA+GDVIDAPELTPVAIQAGRLLSRRLYN  T QMDY+K
Sbjct  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359

Query  483  ICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV  542
            +CTAVFTPIEYGCCGLSEEDSKE +G+D+VEVYH NFVPLEWSL+E TR +AESCYVKV+
Sbjct  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSE-TRTSAESCYVKVI  418

Query  543  CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  465

>PYIR_13452
Length=645

 Score = 813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/591 (70%), Positives = 476/591 (81%), Gaps = 34/591 (6%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWL--STSYEDFVTQFGLDSKATTHVTSPFVWISNPT  58
            M V+YP  V FE H F DR+AF++WL  S++ E+    FG DSKA TH +SPFVW +N  
Sbjct  63   MRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVW-ANTR  121

Query  59   TFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
             F+GGCDD LA+FRSG+                    +AP    A+ + +  +  P    
Sbjct  122  GFIGGCDDTLALFRSGV--------------------SAPATLAATPTMVAAAPAPADDA  161

Query  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
            +    YDYDL+VIGGGSGGLACSKEA+ +GKKVCVLDYVKPSP GTSWGLGGTCVNVGCI
Sbjct  162  K----YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCI  217

Query  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
            PKKLMHQSSLIGE +H D  +FGW VG       TFDW Q++ +V+SYIKSI+FKYKVEL
Sbjct  218  PKKLMHQSSLIGETIHKDAKAFGWTVGE-----QTFDWSQMLKSVNSYIKSINFKYKVEL  272

Query  239  RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSD  298
            R K+VKYEN+LGSFVD HTL+LWHPKKGTK +TTR VVIAVGGRP+ L+C GG+LA+SSD
Sbjct  273  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSD  332

Query  299  DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYM  358
            DIFW K+  PGKTLVVGASYVALECAGF+KGMGY VK+MVRSILLRGFDQDMA+KIGE+M
Sbjct  333  DIFWRKEA-PGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFM  391

Query  359  EMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLD  418
            E +S IEFIR  VPQSITKL+SGQLLVKW++ DG+  EE FDTVLNATGRDPDVAKLGLD
Sbjct  392  ETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLD  451

Query  419  EAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM  478
            + GVKLN KTGRI V NEQT+TPN+YAIGDVIDAPELTPVAIQAGRLL+RRLYN  T  M
Sbjct  452  KVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALM  511

Query  479  DYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY  538
            DYDK+CTAVFTPIEYGCCGLSEE S E+YG++++E+YH+NF PLEWSL+   R AA SCY
Sbjct  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCY  570

Query  539  VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            VKV+CD  RN  V+GFHYLGPNAGEVTQA+GLAMKLGFTYDQ+V+ VGIHP
Sbjct  571  VKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHP  621

>PYAP_17761
Length=622

 Score = 810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/589 (68%), Positives = 476/589 (81%), Gaps = 32/589 (5%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
            M ++Y   VA E   FE RDAFK WL+ S   F   FG DS A TH +SPFVW SN   F
Sbjct  42   MQLLYSDAVAVEAVEFESRDAFKAWLAESNAAFAQAFGTDSPALTHTSSPFVW-SNARGF  100

Query  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
            +GGCD  LA FRSG+A                     P+   +++  +      P+ V++
Sbjct  101  IGGCDATLAHFRSGVA-------------------ARPLAGPSASPTMT-----PVAVDE  136

Query  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
              +YDYDLVVIGGGSGGLACSKEAA +GKKVCVLDYVKPSP GT+WGLGGTCVNVGCIPK
Sbjct  137  SKTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTCVNVGCIPK  196

Query  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
            KLMHQS+LIGE++H D  +FGWN+G        F W QLV +V++YIK I+FKYKVELR 
Sbjct  197  KLMHQSALIGELMHKDAGAFGWNMGEQK-----FTWTQLVESVNNYIKGINFKYKVELRD  251

Query  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
            K+VKYEN LGSFVDPHT++LWH KKGTK ITTRHVV+AVGGRPRQL+C GGE A+SSDDI
Sbjct  252  KKVKYENFLGSFVDPHTIELWHHKKGTKTITTRHVVVAVGGRPRQLSCPGGEHAISSDDI  311

Query  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
            FW ++ EPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFD+DMA++IG++M+ 
Sbjct  312  FW-RKTEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMANRIGDFMQD  370

Query  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
            +S IEFIR  VP+SI KL++GQLLVKW + DG+  EE FD+VLNATGRDPDV+KL LD+A
Sbjct  371  ESKIEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDVSKLNLDKA  430

Query  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
            GV+LN KTGRI V NEQT+TPNV+AIGDVIDAPELTPVAIQAGRLL+RRLYN  T  MDY
Sbjct  431  GVQLNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDY  490

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
            DK+CTAVFTPIEYGCCGLSEE +K++YG+D++E+YH++F+PLEWSL+ Q R+AA +CYVK
Sbjct  491  DKVCTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLS-QDRVAANTCYVK  549

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            V+CDKTR+ +V+GFHYLGPNAGEVTQAMGLAMK+GFTYDQ+V+ VGIHP
Sbjct  550  VICDKTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHP  598

>PYIW_19972
Length=609

 Score = 758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/593 (67%), Positives = 455/593 (77%), Gaps = 65/593 (11%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
            M V+YP  V  E H F DR+AF+ WLS S  DF   FG DSKA TH        S+P  F
Sbjct  54   MRVLYPDAVDCEIHEFPDREAFRAWLSASAADFAANFGADSKAATHT-------SSP--F  104

Query  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIV---  117
             G                                              +ES TP +V   
Sbjct  105  FGK---------------------------------------------DESPTPTMVAAP  119

Query  118  -VEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVG  176
             V+D+ +YDYDL+VIGGGSGGLACSKEAA +GKKVCVLDYVKPSP GT+WGLGGTCVNVG
Sbjct  120  VVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVG  179

Query  177  CIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykV  236
            CIPKKLMHQSSLIGE +H D A+FGW+VG        FDW Q++ +V+SYIKSI+FKYKV
Sbjct  180  CIPKKLMHQSSLIGETIHKDAAAFGWSVGEQK-----FDWAQMLKSVNSYIKSINFKYKV  234

Query  237  ELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVS  296
            ELR K+VKYEN+LGSFVD HTL+LWHPKKGTK +TTR VVIAVGGRP+ L+C GGELA+S
Sbjct  235  ELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAIS  294

Query  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
            SDDIFW K+  PGKTLV+GASYVALECAGF+KGMGY VK+MVRSILLRGFDQDMASKIGE
Sbjct  295  SDDIFWRKEA-PGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGE  353

Query  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
            +ME++S IEFIR  VPQSITKL+SGQLLVKW++ DGD  EE FDTVLNATGRDPDVAKL 
Sbjct  354  FMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLN  413

Query  417  LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
            LD  GV+LN KTGRI V NEQT+ PN++AIGDVIDAPELTPVAIQAGR+L+RRLYN  T 
Sbjct  414  LDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETA  473

Query  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
             MDYDK+CTAVFTPIEYGCCGLSEE S E++G+D +E+YH+NF PLEWSL+   R AA S
Sbjct  474  LMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD-RQAAGS  532

Query  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            CYVKV+CD TRN  V+GFHYLGPNAGEVTQA+GLAMKLGFTYD +V+ VGIHP
Sbjct  533  CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHP  585

>PYAR_13569
Length=494

 Score = 720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/475 (74%), Positives = 415/475 (87%), Gaps = 7/475 (1%)

Query  115  PIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVN  174
            P+ V+D+A+YDYDLVVIGGGSGGLACSKEAA  GKKV VLDYVKPSP GT+WGLGGTCVN
Sbjct  3    PMDVDDEATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVN  62

Query  175  VGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfky  234
            VGCIPKKLMHQS+L+GE++H D  +FGW  G+      +F W QLV++V++YIK I+FKY
Sbjct  63   VGCIPKKLMHQSALLGELMHKDAPAFGWTTGA-----QSFTWTQLVASVNNYIKGINFKY  117

Query  235  kVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELA  294
            KVELR K+VKYEN LGSFVD HT++LWH KK  K +TTRHVVIAVGGRPR L C GGE A
Sbjct  118  KVELRDKKVKYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEHA  177

Query  295  VSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKI  354
            +SSDDIFW ++ EPGKTLVVGASYVALECAGFLKGMGY VK+MVRSILLRGFDQDMA++I
Sbjct  178  ISSDDIFW-RKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRI  236

Query  355  GEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAK  414
            G++M+ +S IEFIR  VP+SI K ++G+LLVKW + DGD  EE FDTVLNATGRDPDV K
Sbjct  237  GDFMQDESRIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTK  296

Query  415  LGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEG  474
            L LD+AGV+LN K+GRI   NEQT+TPN++AIGDVIDAPELTPVAIQAGRLL+RRLYN  
Sbjct  297  LNLDKAGVELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNE  356

Query  475  TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAA  534
            T  MDYDKICTAVFTPIEYGCCGLSEED+K +YG++++E+YH++F+PLEWSL+E+ R+AA
Sbjct  357  TTLMDYDKICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEE-RVAA  415

Query  535  ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             +CYVKV+CDKTR+  V+GFHYLGPNAGEVTQAMGLAMK+GFTYDQ+V+ VGIHP
Sbjct  416  ATCYVKVICDKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHP  470

>PYVX_18170
Length=510

 Score = 683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/543 (65%), Positives = 415/543 (76%), Gaps = 57/543 (10%)

Query  47   VTSPFVWISNPTTFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASAS  106
            ++SPFVW SNPT FVGGCD LL  FRS +                      P  + AS  
Sbjct  1    MSSPFVWTSNPTAFVGGCDALLDRFRSQV----------------------PRPNAASKP  38

Query  107  ELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSW  166
            + N                                 EA+ FG+KV VLDYVKPSP GT W
Sbjct  39   QANGE------------------------------VEASKFGQKVLVLDYVKPSPQGTKW  68

Query  167  GLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssy  226
            GLGGTCVNVGCIPKKLMHQS+LIGE++H D A FGW   +     P FDW QL S+VS+Y
Sbjct  69   GLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENA----PKFDWSQLASSVSTY  124

Query  227  iksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQL  286
            IK+++FKYKV+LR K+VKYEN LG+FVDPHT++L +P+K +K +TTR VV+AVGGRPR L
Sbjct  125  IKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNPRKPSKTVTTRRVVVAVGGRPRLL  184

Query  287  ACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGF  346
             C GGEL+++SDDIFW K   PGKTLVVGASYVALECAGFLKG GY VKVMVRSILLRGF
Sbjct  185  PCPGGELSITSDDIFWRKTA-PGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGF  243

Query  347  DQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNAT  406
            DQDMA++IGEYME+++GIEFIR+TVP SITKL+ G+LLVKW   DG   EE FDTVLNAT
Sbjct  244  DQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNAT  303

Query  407  GRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLL  466
            GR+PDV KL LD+AGVKLN KTGRI V NEQT+TPN++AIGDVIDAPELTPVAIQAGRLL
Sbjct  304  GRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLL  363

Query  467  SRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL  526
            +RRLYN  T  MDY+K+CTAVFTPIEYGCCGLSEE+S E +G+D++EVYH+NF PLEW+L
Sbjct  364  ARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWAL  423

Query  527  AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVG  586
            ++ TR +  +CY+KV+CDKTR+ FV+GFHYLGPNAGEVTQA+GLAMKLGFTY+Q+V  VG
Sbjct  424  SDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVG  483

Query  587  IHP  589
            IHP
Sbjct  484  IHP  486

>H310_08590
Length=640

 Score = 663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/593 (58%), Positives = 425/593 (72%), Gaps = 38/593 (6%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTT-  59
            M  ++P +V    H   ++++F  WL+ S  +F  QF  D++   H +SPF ++    T 
Sbjct  58   MQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTP  117

Query  60   -FVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
             FVGGCDD LA FR+       Q   ST   G      A + DT+S+             
Sbjct  118  KFVGGCDDTLAFFRA-----RTQSAPST---GAPSAANAHVSDTSSS-------------  156

Query  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
             D+  YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  157  -DETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  215

Query  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
            PKKLMHQSS+IGE+LH D   FGW V +      +FDW +LVS+V  YI  ++FKY+++L
Sbjct  216  PKKLMHQSSIIGELLHKDAEQFGWTVSNA-----SFDWTKLVSSVQDYIHGLNFKYRIDL  270

Query  239  RSKQVKYENVLGSFVDPHTLKLWH--PKKGTKEITTRHVVIAVGGRPRQLACLGGELAVS  296
            R K+VKYEN+LG+F D HTL L +   KKG  ++T R  VIAVGGRP+ L+C G E A+S
Sbjct  271  RDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAIS  330

Query  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
            SDDIF  K + PGKTLVVGASYVALECAGFLKG G+ V +MVRSILLRGFDQD+A +IGE
Sbjct  331  SDDIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  389

Query  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
            YME +SGI FI+++VP SI KL +GQL V     +G      +DTVLNATGR PDV  L 
Sbjct  390  YMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLN  444

Query  417  LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
            L  AGV LN K+GRI V NEQT+TP++YAIGDVIDAPELTPVAIQAG+LL+RRL+  GT 
Sbjct  445  LPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTA  504

Query  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
             MDY KICTAVFTP+EYGCCGLSEED+    G D+++VYH+NF PLEWSL+ +  +A E 
Sbjct  505  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKE-  563

Query  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            CY K++ D T+   V+GFHYLGPNAGEVTQA+G+AMKL  TYD  V+TVGIHP
Sbjct  564  CYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHP  616

>H257_08436
Length=642

 Score = 660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/593 (59%), Positives = 424/593 (72%), Gaps = 40/593 (7%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTT-  59
            M  ++P +V    H   ++++F  WL+ S  +F  QF  D++   H +SPF ++    T 
Sbjct  62   MQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDNDARPLKHKSSPFCYLEQDDTP  121

Query  60   -FVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
             FVGGCDD LA FR+       Q   S      ++      +DT+ A             
Sbjct  122  KFVGGCDDTLAFFRA-----RTQSAPSAPASSASIHA----NDTSDA-------------  159

Query  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
              D  YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  160  --DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217

Query  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
            PKKLMHQSS+IGEILH D   FGW+V +      TFDW +LVS+V  YI  ++FKY+V+L
Sbjct  218  PKKLMHQSSIIGEILHKDADQFGWSVSNA-----TFDWSKLVSSVQDYIHGLNFKYRVDL  272

Query  239  RSKQVKYENVLGSFVDPHTLKLWH--PKKGTKEITTRHVVIAVGGRPRQLACLGGELAVS  296
            R K+VKYEN+LG+F D HTL L +   KKG  ++T R  VIAVGGRP+ L+C G E A+S
Sbjct  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  332

Query  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
            SDDIF  K   PGKTLVVGASYVALECAGFLKG G+ V +MVRSILLRGFDQD+A +IGE
Sbjct  333  SDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  391

Query  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
            YME +SGI FI+++VP SI KL++GQ  V   T      ++ +DT+LNATGR PDV KL 
Sbjct  392  YMESESGIAFIKESVPTSIVKLENGQFQVTHTTG-----QDVYDTILNATGRSPDVQKLN  446

Query  417  LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
            LD AGV LN K+GRI V NEQT+TPN+YA+GDVIDAPELTPVAIQAG+LLSRRL+  GT 
Sbjct  447  LDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTT  506

Query  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
             MDY KICTAVFTP+EYGCCGLSEED+    G ++VEVYH+NF PLEWSL+    +A E 
Sbjct  507  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKE-  565

Query  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            CY K++ D T+   VLGFHYLGPNAGEVTQA+G+A+KL  TYD  ++TVGIHP
Sbjct  566  CYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHP  618

>SDRG_16720
Length=628

 Score = 627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/593 (57%), Positives = 418/593 (70%), Gaps = 41/593 (7%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNP--T  58
            M  ++PG+V    H    + +F  WL TS   F TQF  D++AT H TSPF ++ +   T
Sbjct  49   MQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVGDARATNHYTSPFCYLEDGAGT  108

Query  59   TFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
             FVGGCDD LA FRS       Q  A+       +                        V
Sbjct  109  KFVGGCDDTLAFFRS-----RTQSAAAPSAPARNVHAND--------------------V  143

Query  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
            +D A+YD+DLVVIGGGSGGLA SKEAA +G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  144  DDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCI  203

Query  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
            PKKLMHQS+++GE+LH D  +FGW V +      TFDW +L+++V  YI  ++FKY+V+L
Sbjct  204  PKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLITSVQDYIHGLNFKYRVDL  258

Query  239  RSKQVKYENVLGSFVDPHTLKLWHPKKGT--KEITTRHVVIAVGGRPRQLACLGGELAVS  296
            R K+VKYEN LG+F D HTL L +P KG   K++T R  +IAVGGRP+ L C G +LA+S
Sbjct  259  RDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAIS  318

Query  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
            SDDIF  +   PGKTLVVGASYVALECAGFLKG G+ V VMVRSILLRGFD DMA++IG 
Sbjct  319  SDDIF-SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGT  377

Query  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
            YME ++ I FI+  VP SI +L +GQL V     +G      +DTVLNATGR PDV+ L 
Sbjct  378  YMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLN  432

Query  417  LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
            L  AGV LN KTGRI V +EQT+TP++YA+GDVID PELTPVAIQAGRLLS+RL++    
Sbjct  433  LSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSAT  492

Query  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
             M YDK+CTAVFTPIEYGCCGLSE+ + E  G D++ VYH++F PLEWSL+   R  A+ 
Sbjct  493  LMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-RALAKE  551

Query  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            CY K++ D+T+N+ V+GFHYLGPNAGEVTQA+G+A+KL  +Y+  V TVGIHP
Sbjct  552  CYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHP  604

>SPRG_14103
Length=628

 Score = 625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/593 (56%), Positives = 417/593 (70%), Gaps = 41/593 (7%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNP--T  58
            M  ++PG+V    H    + +F  WL  S   F TQF  D++AT H TSPF ++ +   T
Sbjct  49   MQTLFPGQVKATIHEHATKQSFNDWLEASQATFATQFVGDARATNHYTSPFCYLEDGAGT  108

Query  59   TFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
             FVGGCDD LA FRS       Q  A+       +                        V
Sbjct  109  KFVGGCDDTLAFFRS-----RTQSAAAPSAPARNVHAND--------------------V  143

Query  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
            +D A+YD+DLVVIGGGSGGLA SKEAA +G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  144  DDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCI  203

Query  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
            PKKLMHQS+++GE+LH D  +FGW V +      TFDW +LV++V  YI  ++FKY+V+L
Sbjct  204  PKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLVTSVQDYIHGLNFKYRVDL  258

Query  239  RSKQVKYENVLGSFVDPHTLKLWHPKKGT--KEITTRHVVIAVGGRPRQLACLGGELAVS  296
            R K+VKYEN LG+F D HTL L +P KG   K++T R  +IAVGGRP+ L C G +LA+S
Sbjct  259  RDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAIS  318

Query  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
            SDDIF  +   PGKTLVVGASYVALECAGFLK  G+ V VMVRSILLRGFD DMA++IG 
Sbjct  319  SDDIF-SRPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMVRSILLRGFDTDMAARIGT  377

Query  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
            YME ++ I+FI+  VP SI +L +GQL V     +G      +DTVLNATGR+PDV+ L 
Sbjct  378  YMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEG-----IYDTVLNATGRNPDVSGLN  432

Query  417  LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
            L  AGV LN KTGRI V +EQT+ P++YA+GDVID PELTPVAIQAGRLL++RL++    
Sbjct  433  LPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTPVAIQAGRLLAKRLFDNSAT  492

Query  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
             M YDK+CTAVFTPIEYGCCGLSE+ + E  G D++ VYH++F PLEWSL+   R  A+ 
Sbjct  493  LMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQSFTPLEWSLSHD-RALAKE  551

Query  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            CY K++ D+T+N+ V+GFHYLGPNAGEVTQA+G+AMKL  +YD  V TVGIHP
Sbjct  552  CYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNASYDDFVSTVGIHP  604

>SDRG_14408
Length=528

 Score = 393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 233/489 (48%), Positives = 310/489 (63%), Gaps = 33/489 (7%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+ HGT WGLGGTCVNVGC+PKK
Sbjct  21   SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  80

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVP---TFDWKQLVSNVssyiksisfkykVEL  238
            +MH S ++G  L HD A  GW       Q+P     +W+ LV  V +++K ++F Y+V L
Sbjct  81   IMHYSGILGAGL-HDAAHLGW-------QLPEKVEHNWETLVETVQAHVKKLNFSYRVGL  132

Query  239  RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR---PRQLACLGGELAV  295
            RS +V+Y N L  F DPHTL        T+ +T  H++IA GGR   P+++  + GE A+
Sbjct  133  RSNKVQYINALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEIPGV-GEYAI  191

Query  296  SSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIG  355
            +SDD+F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A+KI 
Sbjct  192  TSDDLFSLTTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQ  250

Query  356  EYMEMQSGIEFIRKTVPQSITKLD-SGQLLVKWI-TEDGDCFEETFDTVLNATGRDPDVA  413
            + M  Q G++F   T+P SI K D +GQL V +  +E  + F E FDTVL A GR  D  
Sbjct  251  DIMVAQ-GMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTF  309

Query  414  KLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDA-PELTPVAIQAGRLLSRRLYN  472
             +GL++ GVK     G+    NE T  P+++A+GDV+   PELTPVAI+AG  L RRL+ 
Sbjct  310  NIGLEKVGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFK  368

Query  473  EG-TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTR  531
               T  M+YD I T VFTP+EYG  GLSEE++   YG D V VY   F  LEW    + +
Sbjct  369  PNYTKTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVHRQK  428

Query  532  IAA-----------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  580
              +            +C  K+VC K+ N  VLGFH++GPNAGEVTQ   +A+ +G T + 
Sbjct  429  AESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKED  488

Query  581  LVDTVGIHP  589
              + +GIHP
Sbjct  489  FDNVIGIHP  497

>SPRG_04074
Length=509

 Score = 391 bits (1005),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 233/488 (48%), Positives = 308/488 (63%), Gaps = 31/488 (6%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+ HGT WGLGGTCVNVGC+PKK
Sbjct  2    SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  61

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVP---TFDWKQLVSNVssyiksisfkykVEL  238
            +MH S ++G  L HD A  GW       QVP     +W+ LV  V +++K ++F Y+V L
Sbjct  62   IMHYSGILGAGL-HDAAHLGW-------QVPEKVEHNWETLVEAVQAHVKKLNFSYRVGL  113

Query  239  RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGG--ELAVS  296
            RS +V+Y N L  F DPHTL        T+ +T  H++IA GGRP     + G  E A++
Sbjct  114  RSNKVQYINALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAIT  173

Query  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
            SDD+F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A+KI +
Sbjct  174  SDDLFSLSTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQD  232

Query  357  YMEMQSGIEFIRKTVPQSITKLD-SGQLLVKWI-TEDGDCFEETFDTVLNATGRDPDVAK  414
             M  Q G++F   T+P SI K + +GQL V +  +E  + F E FDTVL A GR  D   
Sbjct  233  IMVAQ-GMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFN  291

Query  415  LGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDA-PELTPVAIQAGRLLSRRLYNE  473
            +GL++AGVK     G+    NE T  P+++A+GDV+   PELTPVAI+AG  L RRL+  
Sbjct  292  IGLEKAGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKP  350

Query  474  G-TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRI  532
              T  M+YD I T VFTP+EYG  GLSEE++   YG D + VY   F  LEW    + + 
Sbjct  351  NYTKTMNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKA  410

Query  533  AA-----------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQL  581
             +            +C  K+VC K+ N  VLGFH++GPNAGEVTQ   +A+ +G T +  
Sbjct  411  ESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDF  470

Query  582  VDTVGIHP  589
             + +GIHP
Sbjct  471  DNVIGIHP  478

>PHALS_08068
Length=497

 Score = 235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 161/483 (33%), Positives = 251/483 (52%), Gaps = 44/483 (9%)

Query  125  DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
            +YD +VIG GSGG+A ++ AAS+ G +V +++  +         LGGTCVNVGC+PKKLM
Sbjct  23   EYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLM  73

Query  184  HQSSLIGEILHHDCASFGWNVGSVNGQVP---TFDWKQLVSNVssyiksisfkykVELRS  240
            + ++ +   LHHD   +G+   +  G +     F+W +L +   +Y+          LR 
Sbjct  74   YIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYV----------LRL  123

Query  241  KQVKYENVLGSFVDPHTLKLWHPKKGT-----KEITTRHVVIAVGGRPRQLACLGGELAV  295
             ++   N+  S VD         ++G      KE+  + ++IAVGGRP      G EL +
Sbjct  124  NEIYETNLANSKVDLIRGSAKFNERGNVEVDDKEVRAKKILIAVGGRPLIPDIPGKELCI  183

Query  296  SSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKI  354
             SD  F + +  P K  +VGA Y+A+E AG L  +G    V  R   +LR FD  + + +
Sbjct  184  DSDGFFEL-ETLPTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNILRTTL  242

Query  355  GEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAK  414
             E M    G+     +    + +   G    K +          FD V+ ATGR P  + 
Sbjct  243  EEAMA-NDGVHLRPNSTVARVKEAADG---TKTLVLTNGSEHRGFDVVICATGRVPLTST  298

Query  415  LGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY-N  472
            L L++AG+  ++  G I VN  ++TT  NVYA+GDV + P LTPVAI AGR LS RL+  
Sbjct  299  LNLEKAGITTDD-NGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGG  357

Query  473  EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRI  532
                ++ Y+ I T +F+    G  GL+EE ++++YGD++++VY   FV + + L  +T  
Sbjct  358  MKDAKLSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIE  417

Query  533  AA------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVG  586
            A           +K+VC   +   V+G H +G  A E+ Q  G+A+K+G T     + + 
Sbjct  418  ATGVPKEKPKTAMKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIA  476

Query  587  IHP  589
            IHP
Sbjct  477  IHP  479

>PHYSO_254571
Length=489

 Score = 230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 166/478 (35%), Positives = 250/478 (52%), Gaps = 34/478 (7%)

Query  125  DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  15   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKKLM  65

Query  184  HQSSLIGEILHHDCASFGW---NVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
              ++ +   LHHD   +G+     G   GQ   FDW +L +   +Y+  ++  Y+  L +
Sbjct  66   FIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  125

Query  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
             +V        F D   +++       KEI  ++V+IAVGG+P      G EL + SD  
Sbjct  126  SKVALIRGSAKFNDKGNVEV-----DGKEILAKNVMIAVGGKPLIPDIPGKELCIDSDGF  180

Query  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKIGEYME  359
            F + +  P K  VVGA Y+A+E AG L  +G    +  R   +LR FD  + + + + M 
Sbjct  181  FEL-ETLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLEDAM-  238

Query  360  MQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDE  419
             + G+     +    + K D G   +  +  DG  +   +D V+ A GR P  + L LD+
Sbjct  239  AKDGVHLRPHSNIARVEKADDGTKTL--VLADGSEY-SGYDVVIYAAGRVPLTSNLQLDK  295

Query  420  AGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY-NEGTVQ  477
            AGV   +K G I VN  ++T+   V A+GDV   P LTPVAI AGR LS RL+      +
Sbjct  296  AGVD-TDKNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDAK  354

Query  478  MDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAA---  534
            + Y+ I T VF+    G  GL+EE ++ +YGDD ++VY   FV + + L  +   A    
Sbjct  355  VSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINEMDEATGEP  414

Query  535  ---ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                   +K+VC   +   V+G H +G  A E+ Q  G+A+K+G T     + V IHP
Sbjct  415  KDKPKTAMKLVC-AGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCVAIHP  471

>PYAR_17512
Length=533

 Score = 227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 168/530 (32%), Positives = 270/530 (51%), Gaps = 60/530 (11%)

Query  103  ASASELNESRTPPIVVEDDAS--------YDYDLVVIGGGSGGLACSKEAASF-GKKVCV  153
            A+ S+L  + T P+      S         +YD +VIG GSGG+A S+ AAS+   +V V
Sbjct  3    ANVSKLRAASTLPLRARGGISRLLSTANDVEYDYLVIGAGSGGMASSRRAASYPNTRVAV  62

Query  154  LDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQV--  211
            ++  +         LGGTCVNVGC+PKK+M+ ++ +G +LH D   +G+      G +  
Sbjct  63   VEQAR---------LGGTCVNVGCVPKKIMYLAANMGHLLHRDLFHYGFETKRGGGHLID  113

Query  212  -PTFDWKQLVSN----------------------VssyiksisfkykVELRSKQVKYENV  248
               F W +L                         + +   + + +  VE+  K++  +NV
Sbjct  114  ETQFHWNKLKERRDAYVLRLNGIYERNLGNSKVELLTGTATFNAQGNVEVDGKEIPAKNV  173

Query  249  LGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEP  308
            L +       +  + +   KEI+ ++V+IAVGG+P      G E  + SD  F +++  P
Sbjct  174  LIAVXXXXNAQ-GNVEVDGKEISAKNVLIAVGGKPLIPNIPGKEHCIDSDGFFELEEM-P  231

Query  309  GKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKIGEYMEMQSGIEFI  367
             K  VVGA Y+A+E AG L G+G    +  R   +LRGFD+ + S + + M+ + G++  
Sbjct  232  KKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRGFDELIRSTLHDAMD-KDGLKLR  290

Query  368  RKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEK  427
              ++   +TK   G   +  + +DG      FDTV+ A GR P    L L+ AGV+ + +
Sbjct  291  PHSLVAKVTKQADGTKTL--VLQDG-TEHAGFDTVIYAAGRVPLTQSLNLEGAGVETDAQ  347

Query  428  TGRIWVNNEQTTTP--NVYAIGDVIDAPELTPVAIQAGRLLSRRLYN-EGTVQMDYDKIC  484
             G I ++  Q TT   N++A+GDV   P LTPVAI AGR LS RL+      +M Y+ I 
Sbjct  348  -GFIKIDEYQRTTAKKNIFAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKEAKMSYENIP  406

Query  485  TAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ-----TRIAAESCYV  539
            T VF+    G  GL+E++++ ++GDD+V+VY   FV + + +  +      +       +
Sbjct  407  TVVFSHPPIGTVGLTEKEARAKHGDDAVKVYSSRFVNMHYGIVNEFGNDGQQKPKPMTAM  466

Query  540  KVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            K+VC   +   V+G H +G  A E+ Q  G+A+K+G T       V IHP
Sbjct  467  KLVC-VGKEEKVVGVHLIGMAADEILQGFGVAVKMGATKADFDSCVAIHP  515

>PHYKE_10327
Length=1200

 Score = 235 bits (600),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 169/496 (34%), Positives = 262/496 (53%), Gaps = 38/496 (8%)

Query  111  SRTPPIVVEDDASY----DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTS  165
            SR P +     AS     +YD +VIG GSGG+A ++ AAS+ G +V V++  +       
Sbjct  8    SRVPHLARALSASRALQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR-------  60

Query  166  WGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQV---PTFDWKQLVSN  222
              LGGTCVNVGC+PKKLM  ++ +G  LHHD   +G+   +  G V     FDW +L + 
Sbjct  61   --LGGTCVNVGCVPKKLMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTR  118

Query  223  VssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR  282
              +Y+  ++  Y+  L + +V+      +F D   + +       KE+  ++V+IAVGG+
Sbjct  119  RDAYVLRLNGIYERNLANSKVELIRGSAAFNDNGNVVV-----DGKEVRAKNVLIAVGGK  173

Query  283  PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-  341
            P      G EL + SD  F ++   P K  VVGA Y+A+E AG L  +G    +  R   
Sbjct  174  PMIPDIPGKELCIDSDGFFELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEG  232

Query  342  LLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDT  401
            +LR FD  + + + + M+ + G+   R +   +I +++      K +          +D 
Sbjct  233  VLRTFDGIVRTTLEDAMK-KDGVHLQRHS---NIARVNQAADGTKTLVLADGSEHSGYDV  288

Query  402  VLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTPVAI  460
            V+ A GR P  + L LD+AG+   +K G I VN  ++T+   V A+GDV   P LTPVAI
Sbjct  289  VIYAAGRVPLTSTLKLDKAGIA-TDKNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAI  347

Query  461  QAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNF  519
             AGR LS RL+   G  ++ Y+ I T VF+    G  GL+EE ++++YGDDS++VY   F
Sbjct  348  AAGRRLSDRLFGGMGGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRF  407

Query  520  VPLEWSLA-EQTRIAAE-----SCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMK  573
            V + + L  E      E        +K+VC   ++  V+G H +G  A E+ Q  G+A+K
Sbjct  408  VNMYYGLINEMDETTGEPKDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQGFGVAVK  466

Query  574  LGFTYDQLVDTVGIHP  589
            +G T     + + IHP
Sbjct  467  MGATKADFDNCMAIHP  482

>SDRG_15045
Length=494

 Score = 224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 160/468 (34%), Positives = 244/468 (52%), Gaps = 20/468 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGREN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++L  E+LH   A     V  +  Q   FDW  + +   +Y+  ++  Y   +   +V  
Sbjct  61   AALHAEMLHSARAYAFKGVSDI--QYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  118

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                  FVD HT+++       +  T +H++IAVGG P      G E A+SSD  F + +
Sbjct  119  VMGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-E  172

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKL  424
            +F+R++   +I K   G L ++            F+TVL A GR P    LGL+   + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  425  NEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYDK  482
            + +        E TT PNVYAIGDV     ELTPVAI AGR L+ RL+ NE    ++Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  483  ICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL-AEQTRIAAESCYVKV  541
            I T VF+    G  GL+E  + E+YG  +V  +  +F  + +++ AE+ ++      +K+
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKV---QTAMKL  408

Query  542  VCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            VC       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  409  VCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  455

>SDRG_11131
Length=494

 Score = 222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 159/468 (34%), Positives = 243/468 (52%), Gaps = 20/468 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGREN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++L  E+LH   A     V  +  Q   FDW  + +   +Y+  ++  Y   +   +V  
Sbjct  61   AALHAEMLHSARAYAFKGVSDI--QYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  118

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                  FVD HT+++       +  T +H++IAVGG P      G E A+SSD  F + +
Sbjct  119  VMGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-E  172

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKL  424
            +F+R++   +I K   G L ++            F+TVL A GR P    LGL+   + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  425  NEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYDK  482
            + +        E TT PNVYAIGDV     ELTPVAI AGR L+ RL+ NE    ++Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  483  ICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL-AEQTRIAAESCYVKV  541
            I T VF+    G  GL+E  +  +YG  +V  +  +F  + +++ AE+ ++      +K+
Sbjct  352  IPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKV---QTAMKL  408

Query  542  VCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            VC       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  409  VCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  455

>SDRG_03823
Length=497

 Score = 220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 162/467 (35%), Positives = 246/467 (53%), Gaps = 18/467 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +VIGGGSGG + ++ AA++G KV V++    +      G+GGTCVNVGC+PKK+M  
Sbjct  7    YDYIVIGGGSGGNSSARRAAAYGAKVLVIERGHAN---DGAGMGGTCVNVGCVPKKVMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            +++  E+LH   A    N+  V  +  +FDW  L     +Y+  ++  Y+  L + ++  
Sbjct  64   AAMHAEMLHSAHAYTFKNIQDV--EYGSFDWAALKKKRDAYVARLNGIYERNLGNNKIPL  121

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                  FVD HT+++          T +H++IAVGG P      G E A+SSD  F + +
Sbjct  122  IYGAAKFVDNHTIEV-----NGDRYTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-E  175

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   +   ME  +G+
Sbjct  176  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  234

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKL  424
             F+R++   SI K + G L ++            F+TVL A GR P    LGL+   + L
Sbjct  235  RFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIAL  294

Query  425  NEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYDK  482
            +          E TT PNV+A+GDV     ELTPVAI AGR L+ RL+ NE    ++Y +
Sbjct  295  SPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQ  354

Query  483  ICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV  542
            I T VF+    G  GL+E  + E+YG  +V+VY   F  + ++++EQ     +   +K++
Sbjct  355  IPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDE--KQKTAMKLM  412

Query  543  CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            C       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  413  CIGEEET-VIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  458

>PYAP_21882
Length=502

 Score = 220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 160/481 (33%), Positives = 246/481 (51%), Gaps = 43/481 (9%)

Query  126  YDLVVIGGGSGGLACSKEAASFGK-KVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            YD +VIG GSGG+A S+ AA++   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  31   YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  81

Query  185  QSSLIGEILHHDCASFGWNV--GSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQ  242
             ++ +G  LH D   +G+    G        F WK+L     +Y+          LR   
Sbjct  82   LAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYV----------LRLNG  131

Query  243  VKYENVLGSFVDPHTLKLWHPKKGT-----KEITTRHVVIAVGGRPRQLACLGGELAVSS  297
            +   N+  S VD          KG      KEI  ++V+IAVGG+P      G E  + S
Sbjct  132  IYGRNLDNSKVDLFRGTATFNAKGNVEVDGKEIAAKNVLIAVGGKPLIPDIPGKEHCIDS  191

Query  298  DDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKIGE  356
            D  F + +++P K  VVGA Y+A+E AG L G+G    +  R   +LRGFD+ + + + +
Sbjct  192  DGFFEL-EEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDELIRTTLHD  250

Query  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
             M  +        +V + I   D  + LV     DG      FD+V+ A GR P    L 
Sbjct  251  AMAKEGVNLRPHSSVTKVIKAADGTKTLV---LADG-SEHSGFDSVIYAAGRVPLTESLN  306

Query  417  LDEAGVKLNEKTGRIWVNNEQTTTP--NVYAIGDVIDAPELTPVAIQAGRLLSRRLY-NE  473
            L+ AG++ ++  G I ++  Q TT   N++A+GDV   P LTPVAI AGR L+ RL+   
Sbjct  307  LEAAGIETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRLFGGM  365

Query  474  GTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ----  529
               +  Y+ I T VF+    G  GL+E+ ++ ++GDD ++VY   FV + + +  +    
Sbjct  366  KDAKASYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINEFGED  425

Query  530  -TRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIH  588
              +       +K+VC + ++  V+G H +G  A E+ Q  G+A+K+G T       V IH
Sbjct  426  GQQKPKPMTAMKLVC-QGKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCVAIH  484

Query  589  P  589
            P
Sbjct  485  P  485

>PYIR_17506
Length=509

 Score = 219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 175/492 (36%), Positives = 250/492 (51%), Gaps = 58/492 (12%)

Query  121  DASYDYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIP  179
            DA YDY  +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+P
Sbjct  36   DAPYDY--LVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVP  84

Query  180  KKLMHQSSLIGEILHHDCASFGWNV--GSVNGQVPTFDWKQLVSNVssyiksisfkykVE  237
            KK+M+ ++ +   LH D   +G+    GS  G    F W +L     +YI          
Sbjct  85   KKIMYLAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYI----------  134

Query  238  LRSKQVKYENVLGSFVDPHTLKLWHPKKGTKE-----ITTRHVVIAVGGRPRQLACLGGE  292
            LR   +   N+  S VD          +G  E     I+ R+V+IAVGG+P      G E
Sbjct  135  LRLNGIYERNLGNSKVDLIQGTAAFNAQGEVEVDGKVISARNVLIAVGGKPLIPDIPGKE  194

Query  293  LAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQ---  348
              + SD  F +++  P K  VVGA Y+A+E AG L G+G    +  R   +LR FD+   
Sbjct  195  HCIDSDGFFELEEL-PNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVR  253

Query  349  ----DMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLN  404
                D  +K G  +  QS +  I KT       LD  + LV     DG      FDTV+ 
Sbjct  254  DTLHDAMAKDGIVVRPQSNVARIEKT-------LDGKKTLV---LADG-SEHAGFDTVIY  302

Query  405  ATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTP-NVYAIGDVIDAPELTPVAIQAG  463
            A GR P  + L +  AG++  +K G I V+  QTT+  NV+A+GDV     LTPVAI AG
Sbjct  303  AAGRIPLTSNLNISAAGIE-TDKHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAG  361

Query  464  RLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPL  522
            R LS RL+      ++ Y+ I T VF+    G  GL+E++++E+YGD  ++ Y   FV +
Sbjct  362  RRLSDRLFGGMEDAKISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNM  421

Query  523  EWSL-----AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFT  577
             + L     AE          +K+VC   ++  V+G H +G  A E+ Q  G+A+K+G T
Sbjct  422  YYGLVNELDAEGNTKPKPMTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKMGAT  480

Query  578  YDQLVDTVGIHP  589
                 + V IHP
Sbjct  481  KADFDNCVAIHP  492

>SDRG_03822
Length=494

 Score = 218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 160/472 (34%), Positives = 247/472 (52%), Gaps = 22/472 (5%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            A+YDY  +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK
Sbjct  2    ATYDY--IVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKK  56

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
            +M  ++L  E+L H   ++ +  G  + Q   FDW  + +   +Y+K ++  Y   +   
Sbjct  57   IMFNAALHAEML-HSARAYAFK-GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLED  114

Query  242  QVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIF  301
            +V        FVD HT+++   +   K     H++IAVGG P      G E A+SSD  F
Sbjct  115  KVDLVMGAAKFVDNHTVEVNGDRYAAK-----HILIAVGGVPAMPPLPGIEHAISSDGFF  169

Query  302  WMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEM  360
             + + +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   +   ME 
Sbjct  170  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-  227

Query  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
             +G+ F+R++   SI K + G L ++            F+TVL A GR P    LGL+  
Sbjct  228  HAGVRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETT  287

Query  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQM  478
             + L+          E TT PNV+A+GDV     ELTPVAI AGR L+ RL+ NE    +
Sbjct  288  DIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACV  347

Query  479  DYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL-AEQTRIAAESC  537
            +Y +I T VF+    G  GL+E  +  +YG  +V  +  +F  + +++ AE+ ++     
Sbjct  348  NYHQIPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKV---QT  404

Query  538  YVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             +K+VC       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  405  AMKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  455

>PHYCA_504517
Length=493

 Score = 217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 169/469 (36%), Positives = 252/469 (54%), Gaps = 21/469 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +VIGGGSGG+A ++ AA++G KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++   E L+ +   +  N      Q   FDW  +     +YIK ++  Y+  L +  V +
Sbjct  64   TAAHVEHLNRN-KDYSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNANVDH  122

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               +   V    +++     G K  T +HV++A GG P      G E  + SD  F ++Q
Sbjct  123  VQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFFKLEQ  177

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  365  EFIRKTVPQSITKLDSGQL-LVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVK  423
            +F+R      + K D+G+L  V  I  +   F + FDT+L A GR+P    LGL+E GVK
Sbjct  236  KFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPD-FDTILYAVGREPRTKDLGLEEVGVK  294

Query  424  LNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLYN-EGTVQMDY  480
            L+E  G I V+  E T+ P VYAIGD  +   ELTPVAI AGR LS RL+  E    ++Y
Sbjct  295  LSE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNY  353

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
             +I T +F+    G  G +E ++ E+YG+++V+VY   FV L  S+A+  R    +  + 
Sbjct  354  HQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTAMKLV  413

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             V +K     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  414  TVGEKET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PPTG_18033
Length=500

 Score = 216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 163/495 (33%), Positives = 256/495 (52%), Gaps = 42/495 (8%)

Query  108  LNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSW  166
            L+ SR P          +YD +VIG GSGG+A ++ AAS+ G +V V++  +        
Sbjct  17   LSASRAP--------QTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR--------  60

Query  167  GLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWN---VGSVNGQVPTFDWKQLVSNV  223
             LGGTCVNVGC+PKKLM  ++ +   L HD   +G+     G   G+   FDW +L +  
Sbjct  61   -LGGTCVNVGCVPKKLMFIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARR  119

Query  224  ssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRP  283
             +Y+  ++  Y+  L + +V+       F +   +++       KE+  ++V+IAVGG+P
Sbjct  120  DAYVLRLNGIYERNLANSKVELIRGSAKFNENGNVEV-----DGKELLAKNVLIAVGGKP  174

Query  284  RQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-L  342
                  G EL + SD  F + +  P K  VVGA Y+A+E AG L  +G    +  R   +
Sbjct  175  LIPDIPGKELCIDSDGFFEL-EILPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGV  233

Query  343  LRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTV  402
            LR FD  + + + + M ++ G+     +    + +   G   V  +  DG  +   +D V
Sbjct  234  LRSFDDIVRTTLEDAM-VKDGVHLRPHSNVARVEQAADGTKTV--VLTDGSEYN-GYDVV  289

Query  403  LNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTPVAIQ  461
            + A GR P  + L LD+AGV  +E  G I VN  ++T+   V A+GDV   P LTPVAI 
Sbjct  290  MYAAGRVPLTSNLQLDKAGVTTDEH-GFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIA  348

Query  462  AGRLLSRRLYNE-GTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  520
            AGR LS RL+      ++ Y+ I T VF+    G  GL+E+ ++ +YGDD+V+VY   FV
Sbjct  349  AGRRLSDRLFGGLNNSKVSYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFV  408

Query  521  PLEWSLAEQTRIAA------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKL  574
             + + L  +   +           +K+VC   +   V+G H +G  A E+ Q  G+A+K+
Sbjct  409  NMYYGLINEVDESTGEPKDKPKTAMKLVC-VGKEEKVVGLHMIGMAADEILQGFGVAVKM  467

Query  575  GFTYDQLVDTVGIHP  589
            G T     + + IHP
Sbjct  468  GATKADFDNCIAIHP  482

>PHYRA_71927
Length=485

 Score = 216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 159/485 (33%), Positives = 247/485 (51%), Gaps = 48/485 (10%)

Query  125  DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  11   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  61

Query  184  HQSSLIGEILHHDCASFGWN---VGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
              ++ +   L HD   +G+     G   GQ   FDW +L +   +Y+  ++  Y+  L +
Sbjct  62   FIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  121

Query  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
             +V+  +    F +   +++       KE+  ++V++AVGG+P      G EL + SD  
Sbjct  122  SKVELIHGSAKFNEKGNVEV-----DGKELLAKNVLVAVGGKPLIPDIPGKELCIDSDGF  176

Query  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFD-------QDMAS  352
            F ++   P K  VVGA Y+A+E AG L  +G    +  R   +LR FD       +D  +
Sbjct  177  FELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAMA  235

Query  353  KIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDV  412
            K G ++   S +  + +    + T           +  DG      +D V+ A GR P  
Sbjct  236  KDGVHLRPHSNVTRVEQVADGTKT----------LVLADG-SEHSGYDVVIYAAGRVPLT  284

Query  413  AKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY  471
            + L LD A +   +K G I VN  ++T+   V A+GDV   P LTPVAI AGR LS RL+
Sbjct  285  SNLQLDNADIA-TDKHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLF  343

Query  472  -NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQT  530
                  ++ Y+ I T VF+    G  GL+EE ++ +YGDD+ +VY   FV + + L  + 
Sbjct  344  GGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEV  403

Query  531  RIAA------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDT  584
              A           +K+VC   +   V+G H +G  A E+ Q  G+A+K+G T     + 
Sbjct  404  DEATGEPKDKPKTAMKLVC-VGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNC  462

Query  585  VGIHP  589
            + IHP
Sbjct  463  IAIHP  467

>SPRG_11769
Length=453

 Score = 214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 160/469 (34%), Positives = 244/469 (52%), Gaps = 39/469 (8%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVV+GGGSGG+A ++ AA++GKKV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVP--TFDWKQLVSNVssyiksisfkykVELRSKQV  243
            ++ +   + HD  ++G+        VP  T DW  L     +Y+  ++  Y   L+   V
Sbjct  56   AADLAHSMRHDAPAYGFPA------VPNTTVDWATLKQRRDAYVTRLNGIYARNLQGSGV  109

Query  244  KYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWM  303
             + + L SF             G+        ++AVGG+P      G E  +SSD  F +
Sbjct  110  DFAHGLCSF-------------GSDGRRGDERLVAVGGQPVMPDIPGIEHCISSDGFFEL  156

Query  304  KQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKIGEYMEMQS  362
             ++ P +  VVGA Y+A+E AG L+G+G    +  R   +LR FD DM   +      + 
Sbjct  157  DER-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQSVLHDAFKRD  214

Query  363  GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGV  422
            GI     +    + K+D     +   T  GD +   FD VL ATGR P    LGL+  G+
Sbjct  215  GITLQPHSTVARVDKVDPATGTLSLTTTAGD-YHTGFDCVLVATGRTPMTKHLGLEHRGI  273

Query  423  KLNEKTGRIWVNNEQ-TTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNE-GTVQMDY  480
            +L+   G I V+  Q T+ P V+A+GDV++   LTPVAI AGR L+ RL+      + DY
Sbjct  274  ELSPN-GFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADY  332

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
              I + VF+    G  GL+E+++++ Y +D ++VY   FV + +SL E       +  +K
Sbjct  333  TSIPSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAH-EKPTTAMK  391

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            ++C       V G H +G  A E+ Q  G+A+K+G     L   + IHP
Sbjct  392  LICVGPTEKIV-GLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHP  439

>PYIW_25301
Length=512

 Score = 216 bits (549),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 245/487 (50%), Gaps = 56/487 (11%)

Query  126  YDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            YD +VIG GSGG+A S+ AA +   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  185  QSSLIGEILHHDCASFGW--NVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQ  242
             ++ +  +LH D   +G+    G   G    F W +L     +YI          LR   
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYI----------LRLND  140

Query  243  VKYENVLGSFVDPHTLKLWHPKKGT-----KEITTRHVVIAVGGRPRQLACLGGELAVSS  297
            +   N+  S VD  T        G      KEI  ++++IAVGG+P      G EL + S
Sbjct  141  IYERNLGNSKVDLLTGTAVFNAHGNVEMDGKEIQAKNILIAVGGKPLIPDIPGKELCIDS  200

Query  298  DDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQ-------D  349
            D  F ++Q  P K  VVGA Y+A+E AG L G+G    +  R   +LR FD+       D
Sbjct  201  DGFFELEQL-PKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHD  259

Query  350  MASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRD  409
              +K G  +  QS +  + +T     T      L ++  +E        FDTV+ A GR 
Sbjct  260  AMAKDGIVVRPQSNVARVEQTADGKKT------LFLQNGSE-----HAGFDTVIYAAGRV  308

Query  410  PDVAKLGLDEAGVKLNEKTGRIWVNNEQTTT-PNVYAIGDVIDAPELTPVAIQAGRLLSR  468
            P  ++L L  AG+   +K G I V+  QTT+  NV+A+GDV     LTPVAI AGR LS 
Sbjct  309  PLTSELNLSAAGIA-TDKHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSD  367

Query  469  RLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL-  526
            RL+      ++ YD I T VF+    G  GL+E +++E++GD  ++ Y   FV + + L 
Sbjct  368  RLFGGMADAKISYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLV  427

Query  527  ----AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLV  582
                A+          +K+VC   ++  V+G H +G  A E+ Q  G+A+K+G T     
Sbjct  428  NDVDADGAAKPKPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFD  486

Query  583  DTVGIHP  589
            + V IHP
Sbjct  487  NCVAIHP  493

>SPRG_05609
Length=496

 Score = 213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 165/480 (34%), Positives = 251/480 (52%), Gaps = 36/480 (8%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            A+  YD +VIGGGSGG + ++ AA++G KV +++    +      G+GGTCVNVGC+PKK
Sbjct  2    ATTVYDYIVIGGGSGGNSSARRAAAYGAKVLLIERGHAN---DGAGMGGTCVNVGCVPKK  58

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
            +M  ++L  E+LH   A    N+  V  +  +FDW  L     +Y+  ++  Y+  L + 
Sbjct  59   IMFNAALHAEMLHSAHAYTFKNIQDV--EYGSFDWAALKKKRDAYVARLNGIYERNLGNN  116

Query  242  QVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIF  301
            Q+        FVD HT+++          T +H++IAVGG P      G E A+SSD  F
Sbjct  117  QIPLVYGAAKFVDNHTVEV-----NGDRYTAKHILIAVGGVPAMPPLPGIEHAISSDGFF  171

Query  302  WMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEM  360
             + + +P K  VVGA Y+A+E AG    +     +  R + +LR FD  +   +   ME 
Sbjct  172  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-  229

Query  361  QSGIEFIRKTVPQSITKL------DSGQLLVKWITEDGDCFEET---FDTVLNATGRDPD  411
             +G+ F+R++   SI K       DSG         DG    ++   F+TVL A GR P 
Sbjct  230  HAGVHFVRESGITSIEKAVDGYADDSG---------DGGGVPQSFPGFETVLFAIGRTPR  280

Query  412  VAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRL  470
               LGL+   + L+          E T+ PNVYA+GDV     ELTPVAI AGR L+ RL
Sbjct  281  THDLGLETTDIALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRL  340

Query  471  Y-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ  529
            + NE    ++Y +I T VF+    G  GL+E  +  +YG ++V+VY  +F  + ++++EQ
Sbjct  341  FGNEPNACINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQ  400

Query  530  TRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                 +   +K++C       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  401  DD--KQKTAMKLICIGEEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  457

>SDRG_12187
Length=462

 Score = 211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 164/473 (35%), Positives = 250/473 (53%), Gaps = 38/473 (8%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVV+GGGSGG+A ++ AA++GKKV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVP--TFDWKQLVSNVssyiksisfkykVELRSKQV  243
            ++ +   + HD  ++G+        VP  T DW  L     +Y+  ++  Y   L+   V
Sbjct  56   AADLAHSMRHDAPAYGFPA------VPNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGV  109

Query  244  KYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWM  303
             +   L SF     +++        +    +V++AVGG+P      G E  +SSD  F +
Sbjct  110  DFAQGLCSFGSDGRVQI---DATPLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFEL  166

Query  304  KQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKIGEYMEMQS  362
             ++ P +  VVGA Y+A+E AG L+G+G    +  R   +LR FD DM   +      + 
Sbjct  167  DER-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQAVLHDAFQRD  224

Query  363  GIEFIRKTVPQSITKLD----SGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLD  418
            GI     +   +I ++D    +G L V   T  G+     FD VL ATGR P    LGL+
Sbjct  225  GITLQPHS---TIARVDKDPTTGSLSVT--TTAGE-HHSGFDCVLVATGRTPMTKDLGLE  278

Query  419  EAGVKLNEKTGRIWVNNEQ-TTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNE-GTV  476
              G++L+   G I V+  Q T+ P V+A+GDV+D   LTPVAI AGR L+ RL+      
Sbjct  279  HRGIQLSPN-GFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDA  337

Query  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
            + DY  I + VF+    G  GL+E+++++ Y DD ++VY   FV + +SL E       +
Sbjct  338  KADYTNIPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAH-EKPT  396

Query  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              +K++C       V G H +G  A E+ Q  G+A+K+G     L   + IHP
Sbjct  397  TAMKLICVGPSEKIV-GLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHP  448

>PPTG_09787
Length=493

 Score = 209 bits (533),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 163/469 (35%), Positives = 255/469 (54%), Gaps = 21/469 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +VIGGGSGG+A ++ AA+FG KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++   E L+ +   +  N  S + +   FDW  + +   +YIK ++  Y+  L + +V +
Sbjct  64   TAAHVEHLNRN-KDYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               +   V    +++       +  T +HV++A GG P      G E  + SD  F ++Q
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFFKLEQ  177

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  365  EFIRKTVPQSITKLDSGQL-LVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVK  423
            +F+R +    + K ++G+L  V  +  +   F + FDT++ A GR+P    LGL+E GVK
Sbjct  236  KFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFAD-FDTIVFAIGREPRTKDLGLEEIGVK  294

Query  424  LNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NEGTVQMDY  480
            L+E  G I V+  E T+ P VYAIGD  +   ELTPVAI AGR LS RL+  E    ++Y
Sbjct  295  LSE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNY  353

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
             +I T +F+    G  G +E ++  +YG+++++VY   FV L  S+A+  R    +  + 
Sbjct  354  HQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTAMKLV  413

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             V +K     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  414  TVGEKET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PITG_14083
Length=493

 Score = 209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 166/469 (35%), Positives = 252/469 (54%), Gaps = 21/469 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +VIGGGSGG+A ++ AA++G KV V   V+        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++   E L+ +   +  N  S + +   FDW  + +   +YIK ++  Y+  L + +V +
Sbjct  64   AAAHVEHLNRN-KDYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               +   V    +++       +  T +HV++A GG P      G E  + SD  F ++Q
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFFKLEQ  177

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET-FDTVLNATGRDPDVAKLGLDEAGVK  423
             F+R +    + K D+G+L    +T DG+  + T FD+++ A GR P    LGL+E GVK
Sbjct  236  NFVRNSRAVRVEKQDNGKLTY-VVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVGVK  294

Query  424  LNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLYN-EGTVQMDY  480
            L E  G I V+  E T+   VYAIGD  +   ELTPVAI AGR LS RL+  E    ++Y
Sbjct  295  LAE-GGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNY  353

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
             +I T +F+    G  G +E ++  +YG+++V+VY   FV L  S+A+  R    +  + 
Sbjct  354  HQIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAMKLV  413

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             V DK     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  414  TVGDKET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>CCI11048
Length=496

 Score = 209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 155/465 (33%), Positives = 240/465 (52%), Gaps = 37/465 (8%)

Query  142  KEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSL------------I  189
            + AA++G KV +++  +        G GGTCVN GC+PKK+M+ ++             I
Sbjct  22   RRAATYGAKVLLIERHREY---DGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  190  GEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVL  249
                  +CAS  ++ G        FDW ++ +   +YI+ ++  Y   L + ++     +
Sbjct  79   RPFTSKECASHSFSFGD-------FDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGI  131

Query  250  GSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPG  309
               +    +++            +H++IAVGG P   +  G E A+ SD  F + + +P 
Sbjct  132  AKLIAKDRVQVNQ----DSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKL-ETQPK  186

Query  310  KTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGIEFIR  368
            K  VVGA Y+A+E AG    +     V  R   +LR FD  +   + E ME + G+ F+R
Sbjct  187  KVAVVGAGYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEME-KDGVNFVR  245

Query  369  KTVPQSITKLDSGQL-LVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEK  427
            K+  + ITK    +L +   I E+   F + FD ++ A GR P    LGL+E GV LNE 
Sbjct  246  KSHLEKITKAKDDKLAITARIGEENQTFSD-FDQIVMAVGRSPRTVGLGLEEVGVALNE-  303

Query  428  TGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYDKIC  484
            TG I V+  E T+ P VYA+GDV     ELTPVAI AGR L+ RL+ NE    + Y +I 
Sbjct  304  TGHIIVDAQENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIP  363

Query  485  TAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCD  544
            T VF+    G  G +E ++  +YG+++V+ Y   FV L +S+AE      ++  +K+VC 
Sbjct  364  TVVFSHPPLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTA-MKLVCV  422

Query  545  KTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             ++   V+G H  G  A E+ Q  G+AMK+G T     + V IHP
Sbjct  423  GSKET-VVGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHP  466

>PYAP_23435
Length=951

 Score = 216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 166/468 (35%), Positives = 246/468 (53%), Gaps = 19/468 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD VVIGGGSGG+A ++ AA++G KV +++  +        GLGGTCVN GC+PKK+M  
Sbjct  471  YDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKKVMFN  527

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++   E L  +   +  N      +   FDW  + +   +YI  ++  Y+  + +  +  
Sbjct  528  AAAHVEHLARN-GDYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNAGIDL  586

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               + + V  + +++       K  T +HV++AVGG P   A  G E A+ SD  F + +
Sbjct  587  VQGVATLVSSNQIEV-----DGKVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFFKL-E  640

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + E ME + G+
Sbjct  641  SQPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-KHGV  699

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKL  424
             F+R++  + I K   G+L +    +  D   E FD VL A GR+P    LGLD+AGVKL
Sbjct  700  NFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKAGVKL  759

Query  425  NEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYD  481
            N+  G I V+  E T+ P VYAIGD      ELTPVAI AGR L+ RL+ NE    + Y 
Sbjct  760  ND-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACLHYH  818

Query  482  KICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKV  541
            +I T VF+    G  G +E ++  ++G D V+VY   FV L  S+A+       +  +  
Sbjct  819  QIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMADPENKGKTAMKLVC  878

Query  542  VCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            V D   +  V+G H  G  A E+ Q  G+AMK+  T     + V IHP
Sbjct  879  VGD---DEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHP  923

>PHYSO_550665
Length=491

 Score = 207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 166/469 (35%), Positives = 248/469 (53%), Gaps = 21/469 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD VVIGGGSGG+A ++ AA++G KV V   V+        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFEGMGLGGTCVNFGCVPKKVMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++   E L  +   +  N  + + +   FDW  + +   +YIK ++  Y+  L + QV +
Sbjct  64   AAAHVEHLARN-KDYSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAQVDH  122

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               +   V    +++       K  T +HV++A GG P      G E  + SD  F ++Q
Sbjct  123  VQGIAKLVAKDKVEV-----AGKVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDGFFKLEQ  177

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  365  EFIRKTVPQSITKLDSGQL-LVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVK  423
            +F+R      + K   G+L  V  I  +   F + FD +L A GR+P    LGL+E GVK
Sbjct  236  KFVRNMRAARVEKQADGKLTFVVTINGEEHKFPD-FDAILYAVGREPRTKDLGLEEVGVK  294

Query  424  LNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NEGTVQMDY  480
            L+E  G I V+  E T+ P VYAIGD  I   ELTPVAI AGR LS RL+  E    ++Y
Sbjct  295  LSE-GGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDACLNY  353

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
             +I T +F+    G  G +E ++  +YG+++V+ Y   FV L  S+A+  R    +  + 
Sbjct  354  HQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMADPERKGKTAMKLV  413

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             V ++     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  414  TVGEQET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>H310_11259
Length=519

 Score = 207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 169/489 (35%), Positives = 261/489 (53%), Gaps = 27/489 (6%)

Query  111  SRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGG  170
            S  P ++    ++  YD +V+GGGSGG+A ++ AAS+G KV V++  +        GLGG
Sbjct  14   SSFPQLLRRPMSTTSYDYIVLGGGSGGIASARRAASYGAKVLVVERGRTL---GGAGLGG  70

Query  171  TCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNG-QVPTFDWKQLVSNVssyiks  229
            TCVNVGC+PKK+M+ ++ + EI+H   ++  +    V G +  +FDW  + S   +Y+  
Sbjct  71   TCVNVGCVPKKVMYNAAFLAEIMH---SAKTYTFKGVQGVEFGSFDWPAMKSKRDAYVTR  127

Query  230  isfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACL  289
            +   Y+  L    +   + + +FVD HT+ +     G K  T  H+++AVGG P+  +  
Sbjct  128  LHGIYERNLAKDGISLVSGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIP  182

Query  290  GGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQ  348
            G ELA+SSD  F + + +P K  VVGA Y+A+E AG    +     +  R   +LR FD 
Sbjct  183  GIELAISSDGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDP  241

Query  349  DMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWIT--EDGDCFEETF---DTVL  403
             +   + + M  ++G+ F+ ++   SI K  +G L ++     E+G    + F   D V+
Sbjct  242  LVRDHVNKEMR-RAGVAFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVV  300

Query  404  NATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQ  461
             A GR P     G D   +  + K G I V+  E TT P VYAIGD      ELTPVAI 
Sbjct  301  VAIGRTPRTTDCGFDRTDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIA  359

Query  462  AGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  520
            AGR L+ RL+  E    ++Y +I T VF+    G  G +E D+  +YG  +V+VY  +FV
Sbjct  360  AGRRLADRLFGGEPDACINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFV  419

Query  521  PLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  580
             L ++L     +   S  +KVVC   +   V+G H  G  A E+ Q  G+A+K+G     
Sbjct  420  NLFYTLLPPKDM--PSTAMKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSD  476

Query  581  LVDTVGIHP  589
            L + + IHP
Sbjct  477  LDNVIAIHP  485

>H257_09722
Length=518

 Score = 207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 168/483 (35%), Positives = 253/483 (52%), Gaps = 29/483 (6%)

Query  118  VEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGC  177
            V   ++  YD +V+GGGSGG++ ++ AAS+G  V V++  +        GLGGTCVNVGC
Sbjct  20   VRGMSTTSYDYIVLGGGSGGISSARRAASYGANVLVIERGREQ---GGAGLGGTCVNVGC  76

Query  178  IPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVE  237
            +PKK+M+ ++   EILH   A     V  V     +FDW  + +   SY+  +   Y+  
Sbjct  77   VPKKVMYNAAFHAEILHSAKAYAFKGVQDVG--FGSFDWATMKTKRDSYVARLHGIYERN  134

Query  238  LRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSS  297
            L    +   +   SFVD HT+ +          T  H+++AVGG P+  +  G E A+SS
Sbjct  135  LAKDNITLVSGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISS  189

Query  298  DDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKIGE  356
            D  F + + +P K  V+GA Y+A+E AG    +     V  R   +LR FD  +   + +
Sbjct  190  DGFFGL-ETQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVND  248

Query  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVK--WITEDGDCFEET----FDTVLNATGRDP  410
             M  +SG++F+  +  QSI K   G L ++    TEDG          FD ++ A GR P
Sbjct  249  EMR-RSGVQFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTP  307

Query  411  DVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSR  468
              +   ++   +  NEK G I V+  E T+ P VYAIGDV +   ELTPVAI AGR L+ 
Sbjct  308  RTSGF-MEHTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLAD  365

Query  469  RLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWS-L  526
            RL+  E    + Y +I T VF+    G  G +E D+  ++G  +V+VY  +FV L +S L
Sbjct  366  RLFGGEPDACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSML  425

Query  527  AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVG  586
            A + +       +K++C   +   V+G H  G  A E+ Q  G+A+K+G     L + V 
Sbjct  426  APENK---PKTAMKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVA  481

Query  587  IHP  589
            IHP
Sbjct  482  IHP  484

>H310_14447
Length=501

 Score = 204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 165/471 (35%), Positives = 253/471 (54%), Gaps = 25/471 (5%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +V+GGGSGG++ +  A  +G KV V++  + +      G+GGTCVNVGC+PKK+M+ 
Sbjct  9    YDYIVVGGGSGGVSSASRAVEYGAKVLVIERGRVN---GGAGMGGTCVNVGCVPKKIMYN  65

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            + +  EIL H    + +    VN +  +FDW  + +   +Y+  +S  Y+  L  + +  
Sbjct  66   AGVHAEIL-HSAKDYSFK-DVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEENI--  121

Query  246  ENVLGS--FVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWM  303
            ++V+G+  FVD HT+++       +  T  H++IAVGG P+     G E AVSSD  F +
Sbjct  122  DHVIGAAVFVDDHTVEV-----NGQRYTAPHILIAVGGMPQMPNIPGIEHAVSSDGFFDL  176

Query  304  KQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQS  362
               +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   + + M  ++
Sbjct  177  PT-QPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEMA-KA  234

Query  363  GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEE--TFDTVLNATGRDPDVAKLGLDEA  420
            G+ F+     +SI K   G L V  + + G+   E   FD +++A GR P    +GLD+ 
Sbjct  235  GVAFVTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDKT  292

Query  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQM  478
             V+L++    +    E TT   VYAIGDV     ELTPVAI AGR L+ RL+  E    +
Sbjct  293  HVELSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNACI  352

Query  479  DYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY  538
             Y +I T VF+    G  GL+E D+  +YG D+V VY   F  + ++LA  +    ++  
Sbjct  353  HYHQIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTA-  411

Query  539  VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +K+VC       V+G H  G  A E+ Q  G+A+KLG       + V IHP
Sbjct  412  MKLVCIGVEET-VIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIHP  461

>PHYRA_72037
Length=493

 Score = 202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 162/469 (35%), Positives = 247/469 (53%), Gaps = 21/469 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD VVIGGGSGG+A ++ AA++G KV V   V+        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++   E LH +   +     + +     FDW  +     +YI  ++  Y+  L + +V +
Sbjct  64   AAAHVEHLHRN-EDYSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNAKVDH  122

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               + + V    +++       K  T +HV++A GG P      G E    SD  F ++Q
Sbjct  123  VQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFFRLEQ  177

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + + ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-KAGV  235

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFE-ETFDTVLNATGRDPDVAKLGLDEAGVK  423
            +F+R T    + K D G+L    +T DG+  +   FD +L A GR+P    LGL++ GVK
Sbjct  236  KFVRNTRAVRVDKQDDGKLTF-VVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKVGVK  294

Query  424  LNEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDY  480
            L +  G I V+  E T+ P VYAIGD      ELTPVAI AGR LS RL+  E    ++Y
Sbjct  295  LAD-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNY  353

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
             +I T +F+    G  G +E ++  ++G+++V+VY   FV L  S+A+  R    +  + 
Sbjct  354  HQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTAMKLV  413

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             V ++     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  414  TVGEQET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PITG_13427
Length=463

 Score = 201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 151/468 (32%), Positives = 242/468 (52%), Gaps = 39/468 (8%)

Query  138  LACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHD  196
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   L HD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHD  51

Query  197  CASFGWN---VGSVNGQVPTFDWKQLVSNV-ssyiksisfkykVELRSKQVKYENVLGSF  252
               +G+     G   G+   FDW +L +   +  ++      +  L + +V+    L +F
Sbjct  52   LLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATF  111

Query  253  VDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTL  312
             +   +++     G KE+  ++V+IAVGG+P      G EL + SD  F + +  P K  
Sbjct  112  NEKGNVEV-----GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFEL-ETLPKKVA  165

Query  313  VVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKIGEYMEMQSGIEFIRKTV  371
            VVGA Y+A+E AG L  +G    +  R   +LR FD  + + + + M  + G+       
Sbjct  166  VVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFDDIVRTTLEDAM-AKEGVHL----R  220

Query  372  PQS-ITKLDSGQLLVK-WITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTG  429
            P S + +++ G    K  +  DG  +   +D V+ A GR P  + L LD+AG+  +E  G
Sbjct  221  PHSNVARVELGADGTKTLVLTDGSKY-SGYDVVIYAAGRVPLTSNLQLDKAGITTDEH-G  278

Query  430  RIWVNN-EQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAV  487
             I VN  ++T+   V A+GDV   P LTPVAI AGR LS RL+      ++ Y+ I T V
Sbjct  279  FIPVNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVV  338

Query  488  FTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAA------ESCYVKV  541
            F+    G  GL+EE ++ +YGDD+++VY   FV + + L  +   +           +K+
Sbjct  339  FSHPPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKL  398

Query  542  VCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            VC   +   V+G H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  399  VC-AGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  445

>PHALS_09136
Length=493

 Score = 201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 162/469 (35%), Positives = 248/469 (53%), Gaps = 21/469 (4%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +VIGGGSGG+A ++ AA+ G KV V   V+        GLGGTCVN GC+PKK+M  
Sbjct  7    YDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            +++  E L+ +   +  N  + + +   FDW  + +   +YI+ ++  Y+  L + QV  
Sbjct  64   TAVHVEHLNRN-KDYSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIYERNLSNAQVDV  122

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               +   V    +++          T +HV++A GG P      G E  + SD  F ++Q
Sbjct  123  IQGIAKIVAKDKIQV-----AGHIYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFFKLEQ  177

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET-FDTVLNATGRDPDVAKLGLDEAGVK  423
            EF+R      I K +  +L    +T +G+  E T FDT+L A GR P    LGL+E GVK
Sbjct  236  EFVRNMSATRIEKSNDDKLTF-VVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEIGVK  294

Query  424  LNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NEGTVQMDY  480
            L +  G I V+  E TT P VYAIGDV +   ELTPVAI AGR L+ RL+  E    ++Y
Sbjct  295  LAD-GGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDACLNY  353

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
             +I T +F+    G  G +E ++   +G +++++Y   FV L  ++A+  R    +  + 
Sbjct  354  HQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMADPERKGKTAMKLV  413

Query  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             V ++     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  414  TVGEEET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>CCA23647
Length=496

 Score = 201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 151/459 (33%), Positives = 237/459 (52%), Gaps = 25/459 (5%)

Query  142  KEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHH------  195
            + AA++G KV +++  +        G GGTCVN GC+PKK+M+ ++   E +        
Sbjct  22   RRAATYGAKVLLIERHREY---EGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  196  -DCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFVD  254
               AS G    S +     FDW ++     +YI+ ++  Y   L + ++     +   + 
Sbjct  79   RPFASKGDTSHSFS--FGDFDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIA  136

Query  255  PHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVV  314
               +++            +H++IAVGG P   +  G E A+ SD  F + + +P K  VV
Sbjct  137  KDRVQVNQ----DSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKL-ETQPKKVAVV  191

Query  315  GASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQ  373
            GA Y+A+E AG    +     +  R   +LR FD  +   + E ME ++G+ F+RK+  +
Sbjct  192  GAGYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLE  250

Query  374  SITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV  433
             I K +  +L +     D       FD ++ A GR P    LGL++ GV+LNE TG I V
Sbjct  251  KIVKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNE-TGHIIV  309

Query  434  N-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTP  490
            +  E T+ P VYA+GDV     ELTPVAI AGR L+ RL+ NE    + Y +I T VF+ 
Sbjct  310  DAQENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSH  369

Query  491  IEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNF  550
               G  G +E ++  +YG+++V+ Y   FV L +S+AE      ++C +K+VC  ++   
Sbjct  370  PPLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTC-MKLVCVGSKET-  427

Query  551  VLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            V+G H  G  A E+ Q  G+AMK+G T     + V IHP
Sbjct  428  VVGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHP  466

>H257_17037
Length=498

 Score = 200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 149/452 (33%), Positives = 232/452 (51%), Gaps = 17/452 (4%)

Query  141  SKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASF  200
            +  A  +G KV V++  + +      G+GGTCVNVGC+PKK+M+ +    EILH     +
Sbjct  23   ASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKKIMYNAGFHAEILH-SAKDY  78

Query  201  GWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKL  260
             +    VN +  +FDW  + +   +Y+  ++  Y+  L  + + +     +FVD HT+++
Sbjct  79   SFK-EVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVEV  137

Query  261  WHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVA  320
                 G +  T  H++IAVGG P+     G E A+SSD  F +   +P K  VVGA Y+A
Sbjct  138  ----NGLR-FTAPHILIAVGGVPQLPTIPGIEHAISSDGFFDLPT-QPKKVAVVGAGYIA  191

Query  321  LECAGFLKGMGYAVKVMVRS-ILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLD  379
            +E AG    +     V  R   +LR FD  +   + + M  +SG+ F+ ++  QSI K  
Sbjct  192  VELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEMA-KSGVTFVTQSHLQSIRKEA  250

Query  380  SGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTT  439
             G L +     D       F+ +++A GR P    +GLD+  V+L+     +    E TT
Sbjct  251  DGTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQENTT  310

Query  440  TPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCG  497
             P VYAIGD  I   ELTPVAI AGR L+ RL+ +E    + Y +I T +F+    G  G
Sbjct  311  VPGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGTIG  370

Query  498  LSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYL  557
            L+E ++  +YG  +V  Y  +F  L +SL +      ++  +K+VC       V+G H  
Sbjct  371  LTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTA-MKLVCIGVEET-VVGAHVA  428

Query  558  GPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            G  A E+ Q  G+A+K+G       + V IHP
Sbjct  429  GLGADEMIQGFGVAIKMGAYKSDFDNIVAIHP  460

>PHYCA_7619
Length=462

 Score = 198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 154/473 (33%), Positives = 235/473 (50%), Gaps = 50/473 (11%)

Query  138  LACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHD  196
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   LHHD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHD  51

Query  197  CASFGWN---VGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFV  253
               +G+     G   G+   FDW +L +   +Y+          LR   +   N+  S V
Sbjct  52   FLHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYV----------LRLNGIYERNLENSKV  101

Query  254  DPHTLKLWHPKKGT-----KEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEP  308
            D         + G      KEI   +V+IAVGG+P      G EL + SD  F + +  P
Sbjct  102  DLIRGSAKFNQNGNVEVDGKEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFEL-ETLP  160

Query  309  GKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKIGEYMEMQSGIEFI  367
             K  VVGA Y+A+E AG L  +G    +  R   +LR FD  + + + + ME + G+   
Sbjct  161  KKVAVVGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAME-KDGVHL-  218

Query  368  RKTVPQS-ITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNE  426
                P S + +++      + +          ++ V+ A GR P    L LD+AGV   +
Sbjct  219  ---CPHSNVVRVEQAADNTRTLVLADGSEHSGYEVVIYAAGRVPLTTSLQLDKAGVT-TD  274

Query  427  KTGRIWVNN-EQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY-NEGTVQMDYDKIC  484
              G I V+  +QT+  NV+A+GD    P LTPVAI AGR LS RL+      ++ Y+ I 
Sbjct  275  NHGFIQVDEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIP  334

Query  485  TAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES--------  536
            T VF+    G  GL+E  ++ +YGDD ++VY   FV + + L  +  I  E+        
Sbjct  335  TVVFSHPPIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINE--IDEETGEPKDKPK  392

Query  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              +K+VC   ++  V+G H +G  A E+ Q  G+A+K+G T     D + IHP
Sbjct  393  TAMKLVC-AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHP  444

>HYAP_08763
Length=473

 Score = 196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 148/457 (32%), Positives = 240/457 (53%), Gaps = 23/457 (5%)

Query  138  LACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDC  197
            +A ++ AA++G KV V++  +        GLGGTCVN GC+PKK+M  ++    + H + 
Sbjct  1    MASARRAATYGAKVLVIERGRQY---DGMGLGGTCVNFGCVPKKIMFNTA--AHVEHLNR  55

Query  198  ASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHT  257
            A   +++ +       FDW ++ +   +YI  ++  Y+  L + +V +   +  FV  + 
Sbjct  56   AK-DYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNK  114

Query  258  LKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGAS  317
            +++       +  T +HV+IA GG P +    G    + SDD F ++Q +P K  VVGA 
Sbjct  115  VQV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQ-QPQKVAVVGAG  168

Query  318  YVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSIT  376
            Y+A+E AG    +     +  R   +LR F+  +   + E ME ++G+ F+R      + 
Sbjct  169  YIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGVE  227

Query  377  KLDSGQL-LVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-  434
            K   G+L LV  +  +   F + FDT+L A GR P    LGL++ GVKL E  G I V+ 
Sbjct  228  KQLDGKLTLVVNVHNEEQKFTD-FDTILFAVGRKPRTEDLGLEDIGVKLAE-GGFIQVDA  285

Query  435  NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIE  492
             E T+ P VYAIGD  +   ELTPVAI AGR L+ RL+  E    ++Y +I + +F+   
Sbjct  286  QENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPP  345

Query  493  YGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVL  552
             G  G +E ++  +YG+++V+VY   FV L  S+A+       +  +  V ++     V+
Sbjct  346  IGTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLVTVGEQET---VV  402

Query  553  GFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  403  GVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  439

>PHYKE_6836
Length=493

 Score = 193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 159/471 (34%), Positives = 246/471 (52%), Gaps = 25/471 (5%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD VVIGGGSGG+A ++ AA++G KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPKKVMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            +++  E L  +   +  N    + Q   FDW  + +   +YI  ++  Y+  L+++QV +
Sbjct  64   TAMHVEHLARN-RDYSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNLQNQQVDH  122

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               +   V    +++       +  T +++++A GG P      G E  + SD  F ++Q
Sbjct  123  VQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFFKLEQ  177

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET---FDTVLNATGRDPDVAKLGLDEAG  421
            +F+R +    + K   G+L    +T DG   EE    FDT+L A GR P    LGL+E  
Sbjct  236  KFVRNSRAVRVEKQTDGKLTF-VVTVDGK--EEKFPDFDTILYAVGRTPRTKDLGLEEIN  292

Query  422  VKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQM  478
            VKL++  G I V+  E T+   VYAIGD      ELTPVAI AGR LS RL+  E    +
Sbjct  293  VKLSQD-GFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  479  DYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY  538
            +Y +I T +F+    G CG +E ++ E++G ++++ Y   FV L  S+A+  R    +  
Sbjct  352  NYHQIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKTAMK  411

Query  539  VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +  V ++     V         A E+ Q  G+AMK+  T     + V IHP
Sbjct  412  LVCVGEEEVVVGVHVAGEG---ADEMIQGFGVAMKMNATKADFDNIVAIHP  459

>PYVX_21517
Length=482

 Score = 187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 153/517 (30%), Positives = 236/517 (46%), Gaps = 106/517 (21%)

Query  112  RTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGG  170
            R  P+      + ++DL+VIG GSGG+A S+ AAS+   +V V++  +         LGG
Sbjct  14   RGLPLARALSTAREFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGG  64

Query  171  TCVNVGCIPKKLMHQSSLIGEILHHDCASFGW----NVGSVNGQVPTFDWKQL-------  219
            TCVNVGC+PKK+M+  + +   LH D   +G+    + G   G    FDW++L       
Sbjct  65   TCVNVGCVPKKIMYTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAY  124

Query  220  VSNVssyiksisfkykVELRSKQVKYENVLGSF-VDPHTLKLWHPKKGTKEITTRHVVIA  278
            V  ++   +      KVEL +   ++ NV G   VD              E+  + V++A
Sbjct  125  VLRLNGIYERNLANSKVELLTGTARF-NVDGKIEVD------------GVEVRAKKVLLA  171

Query  279  VGGRPR----QLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAV  334
            VGG+P      +A  G EL + SD  F ++Q  P K  VVGA Y+A+E AG L  +G   
Sbjct  172  VGGKPLIPDIPVAATGKELCIDSDGFFELEQL-PRKVAVVGAGYIAVELAGVLNALGADT  230

Query  335  KVMVRSI-LLRGFD--------------------QDMASKIGEYMEMQSGIEFIRKTVPQ  373
             +  R   +LR FD                    QD  ++ G  +   S IE +      
Sbjct  231  TIFTRRDGVLRSFDWWNSQFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADG  290

Query  374  SITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV  433
            + T           +  DG      F++V+ A GR P    LGLD AGV  +E+ G I V
Sbjct  291  TKT----------LVLADGST-HTGFESVIYAAGRVPLTGDLGLDNAGVATDER-GHIRV  338

Query  434  NN-EQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIE  492
            +  +QTT P++ A+GD      LTP++                    Y+ + T VF+   
Sbjct  339  DEYQQTTAPDILAVGDACGTIALTPIS--------------------YENVPTVVFSHPP  378

Query  493  YGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVL  552
             G  GL+E+ ++ ++GD+ +++Y   FV + + +  +           +VC       V 
Sbjct  379  IGTVGLTEKQARAKFGDEQIKIYKSTFVNMYYGVVNE-----------LVCAGPDEKIV-  426

Query  553  GFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            G H +G  A E+ Q  G+A+K+G T   L   V IHP
Sbjct  427  GLHVIGMGADEMLQGFGVAVKMGATKADLDSCVAIHP  463

>HYAP_04843
Length=430

 Score = 170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/410 (32%), Positives = 205/410 (50%), Gaps = 26/410 (6%)

Query  193  LHHDCASFGWNV----GSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENV  248
            L HD   +G+      GS+  Q+  FDW +L +   +Y++ ++  Y+  L S +V++   
Sbjct  5    LQHDVVHYGFEKEGTGGSLGAQM-HFDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQG  63

Query  249  LGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEP  308
               F     +++       KE+  ++V+IAVGG+P      G EL + SD  F +    P
Sbjct  64   SARFNKQGNVEV-----DGKEVLAKNVMIAVGGKPMIPDIPGKELCIDSDGFFEL-DTLP  117

Query  309  GKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMASKIGEYMEMQSGIEFI  367
             K  V+GA Y+A+E AG L  +G    +  R   +LR FD  + + + + M +  G+   
Sbjct  118  KKVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVRTTLEDAMAID-GLHLR  176

Query  368  RKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEK  427
              +    + +   G   +        C    FD V+ A GR P   KL LD AGV  N K
Sbjct  177  PNSNVARVEQAADGTNTLVLTDGSAHC---GFDIVIYAAGRVPLTDKLDLDNAGVATN-K  232

Query  428  TGRIWVNN-EQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICT  485
             G I VN  ++T+   V+A+GDV   P LTPVA+ AGR LS RL+ N    ++ Y+ I T
Sbjct  233  HGYIVVNEFQETSNSKVFAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIPT  292

Query  486  AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAA------ESCYV  539
             VF+    G  GL+E+ ++ +YGDD ++VY  +FV + + L  +   A           +
Sbjct  293  VVFSHPPIGTIGLTEKQAQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTAI  352

Query  540  KVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            K+VC   +   V+G H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  353  KLVCAGKKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  401

>PYIR_23431
Length=468

 Score = 159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 134/450 (30%), Positives = 208/450 (46%), Gaps = 40/450 (9%)

Query  142  KEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFG  201
            + AA++G KV V++  +        GLGGTCVN GC+PKK+M  +S   E L+ +     
Sbjct  23   RRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPKKVMFNASAHVEHLNRNADYSI  79

Query  202  WNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKLW  261
               GS   +   FDW  + +   +YI  ++  Y+  L +  V     +   V  + +++ 
Sbjct  80   TTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQIEV-  138

Query  262  HPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVAL  321
                     T +H+++AVGG+P      G E  + SD  F + + +P K  VVGA Y+A+
Sbjct  139  ----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRL-EAQPKKVAVVGAGYIAI  193

Query  322  ECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDS  380
            E AG    +     +  R   +LR FD  +   I E  E ++GI F+R +  + I K   
Sbjct  194  ELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDKQAD  252

Query  381  GQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTT  440
            G L +    +  +     FDT+L A GR+P    LGL+E GVKL +    +    E T+ 
Sbjct  253  GTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQENTSV  312

Query  441  PNVYAIGDV-IDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLS  499
            P +YAIGD  I   ELTP                         I T VF+    G  G +
Sbjct  313  PGIYAIGDATITGWELTP-------------------------IPTVVFSHPPLGTIGYT  347

Query  500  EEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGP  559
            E  + E++G ++V+VY   FV L +++A+       +  +K+V        V   H  G 
Sbjct  348  EPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTA--MKLVTVGEDEVVVG-VHVAGE  404

Query  560  NAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             A E+ Q  G+A+K+  T     + V IHP
Sbjct  405  GADEMIQGFGVAVKMNATKADFDNIVAIHP  434

>PYAR_17714
Length=444

 Score = 157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 142/467 (30%), Positives = 218/467 (47%), Gaps = 60/467 (13%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +VIGGGSGG+A ++ AA  G KV +++  + +      GLGGTCVN GC+PKK+M  
Sbjct  7    YDYIVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPKKVMWN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++   E L  + A +    G+   Q   FDW  + +   +YI  ++  Y+  + + ++  
Sbjct  64   AASHVEHLARN-ADYSIRSGA-EFQYGDFDWANMAAKRDAYILRLNGIYERNIGNAKIDL  121

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               + S      + +      T     +H+++AVGG P      G E A+ SDD F +K 
Sbjct  122  IEGIASLTAKDAVTV---DGKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDSDDFFKLKT  178

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   +   M+ + G+
Sbjct  179  -QPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMD-KHGV  236

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKL  424
             F+R++   +I K   G+L V+   +  D     FD VL A GR+P    LGL+  GVKL
Sbjct  237  HFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLESVGVKL  296

Query  425  NEKTGRIWVNN-EQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNEGTVQMDYDK  482
            ++  G I V+  E T+   VYAIGD      ELTP                         
Sbjct  297  SD-AGFIEVDKFENTSVDGVYAIGDATTTGYELTP-------------------------  330

Query  483  ICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV  542
                               ++ E++G D V+VY   FV L +++A+          +K+V
Sbjct  331  ------------------PEAVEKFGADHVKVYTSTFVNLLYAMADPDH--KSKTAMKLV  370

Query  543  CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            C    N  V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  371  C-VGENEQVVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHP  416

>PYAP_22645
Length=1565

 Score = 149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 141/478 (29%), Positives = 223/478 (47%), Gaps = 38/478 (8%)

Query  122   ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
             AS +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  1096  ASSEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSK  1147

Query  182   LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
              +  ++ +     HD + +G  V  V       ++  ++ +    +K+++   +   +  
Sbjct  1148  ALLHATHMYHAAQHDFSKYGIEVSDVK-----MNFDGMMKSKEKAVKTLTGGIEGLFKKN  1202

Query  242   QVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAVS  296
             +V Y    G  V  + + +     G + +  ++++IA G       P  +    G++ V 
Sbjct  1203  KVTYVKGFGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDNAAGKI-VD  1261

Query  297   SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRS-ILLRGFDQDMASKIG  355
             S     +K K P   +V+G   + LE     K +G  V V+  +  +  G DQ++  +  
Sbjct  1262  STGALELK-KVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKEFT  1320

Query  356   EYMEMQSGIEFIRKT-VPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAK  414
             + ++ Q G++F   T V  S    D   L V+          E  DTVL ATGR P    
Sbjct  1321  KLLKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVATGRRPFTKG  1378

Query  415   LGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYN-  472
             LGL++ G++  +K GRI V+N  +T  PN++AIGDVI  P L   A + G      +   
Sbjct  1379  LGLEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVENIAGL  1437

Query  473   EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRI  532
              G V  +YD I   ++T  E    G +EE  KEE        Y+    P+  +   + R 
Sbjct  1438  HGHV--NYDAIPGVIYTYPEVASVGKTEEQLKEEG-----VAYNVGKFPMMAN--SRARA  1488

Query  533   AAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              AES  +VKV+ DKT +  +LG H +  NAGE+     L M+ G   + +  T   HP
Sbjct  1489  VAESDGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHP  1545

>PYIR_20273
Length=505

 Score = 145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 138/484 (29%), Positives = 215/484 (44%), Gaps = 40/484 (8%)

Query  120  DDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIP  179
              AS +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP
Sbjct  28   SSASTEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIP  79

Query  180  KKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELR  239
             K +  S+ +     HD A +G  V  V     + ++ +++ +    +K+++   +   +
Sbjct  80   SKALLHSTHLYHSAQHDFAKYGIEVSEV-----SMNFGKMMKSKEKAVKTLTGGIEQLFK  134

Query  240  SKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELA  294
              +V Y    G  V  + + +     G + +T ++++IA G       P  +    G++ 
Sbjct  135  KNKVTYIKGHGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVPVDNAAGKI-  193

Query  295  VSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLR---GFDQDMA  351
            V S     +K K P   +VVGA  + LE     K +G   KV V   L R   G D ++ 
Sbjct  194  VDSTGALELK-KVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELG  250

Query  352  SKIGEYMEMQS-GIEFIRKTVPQSIT----KLDSGQLLVKWITEDGDCFEETFDTVLNAT  406
             +  + ++ Q  G EF  K     +      L             G       D VL AT
Sbjct  251  KEFTKLLKKQGLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIECDAVLVAT  310

Query  407  GRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRL  465
            GR P    LGL+  G++  +K GRI V++  +T  PN++AIGDVI  P L   A + G  
Sbjct  311  GRRPYTNGLGLENMGIQ-TDKFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIA  369

Query  466  LSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWS  525
             +  +  +    ++Y+ I   ++T  E    G +EE  KEE     V      F  L  S
Sbjct  370  CAETIAGKHG-HVNYNAIPGVIYTFPEVASVGKTEEQLKEE----GVTYNVGKFPMLANS  424

Query  526  LAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTV  585
             A    +      VKV+ DK  +  +LG H +  NAGE+     L M+ G + + +  T 
Sbjct  425  RARA--VGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSEDIARTC  481

Query  586  GIHP  589
              HP
Sbjct  482  HAHP  485

>PYVX_16175
Length=446

 Score = 141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 147/470 (31%), Positives = 224/470 (48%), Gaps = 66/470 (14%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD VV+GGGSGG+A ++ AAS G KV +++  + +      GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVLGGGSGGVASARRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPKKVMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++   E L+         +G    Q   FDW  + +   +YI  ++  Y+  L + ++  
Sbjct  64   AAAHVEHLNRAGDYSVTTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKIDV  123

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               +   V  + L++       K  T +++++A GG P      G E A+ SD  F ++Q
Sbjct  124  VQGVARVVARNQLEV-----DGKVYTGKNLLLAPGGVPTLPPIPGIEHAIDSDGFFKLEQ  178

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   +   ME ++G+
Sbjct  179  -QPRKVAVVGAGYIAVEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME-KNGV  236

Query  365  EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET---FDTVLNATGRDPDVAKLGLDEAG  421
            +F+R++    I KL+ G+L    IT + D   +T   FDTVL A GR+P  A LGL+  G
Sbjct  237  QFVRRSHITRIDKLEDGKL---QITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEAIG  293

Query  422  VKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNEGTVQMD  479
            V L++K G I V+  E T+   VYAIGD      ELTP                      
Sbjct  294  VDLDDK-GFIKVDAQENTSAAGVYAIGDATTTGWELTP----------------------  330

Query  480  YDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYV  539
                                  D+  +YG ++V+VY   FV L  ++A+       +  +
Sbjct  331  ---------------------PDAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKTAMKL  369

Query  540  KVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              V  +     V+G H  G  A E+ Q  G+A+KLG T     + V IHP
Sbjct  370  VTVGAQ---ETVVGVHVAGEGADEMIQGFGVAVKLGATKADFDNIVAIHP  416

>CCI10477
Length=494

 Score = 141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 139/481 (29%), Positives = 225/481 (47%), Gaps = 44/481 (9%)

Query  123  SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKL  182
            S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  24   SSEYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKA  75

Query  183  MHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQ  242
            +  SS +     HD  S G  V  +       ++ +++      +K ++   +   +  +
Sbjct  76   LLHSSHLFHTAQHDFKSIGIEVSDLR-----LNFGKMMKAKEKSVKVLTSGIEGLFKKNK  130

Query  243  VKYENVLGSFVDPH--TLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAV  295
            V Y    G  V  +  ++ L    KG + IT ++++IA G       P  +    G++  
Sbjct  131  VAYIKGHGKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKIVD  190

Query  296  SSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKI  354
            S+  +    +  P + +VVGA  + LE     + +G  V V+   + +  G D ++  + 
Sbjct  191  STGALVL--KSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREF  248

Query  355  GEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETF---DTVLNATGRDPD  411
             + ++ Q G++F   T   S TK++   + +    ED     ET    D VL ATGR P 
Sbjct  249  AKTLQKQ-GLKFKFATRVTS-TKVNGDNVTITM--EDAKGGNETSMECDVVLVATGRRPF  304

Query  412  VAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAG-RLLSRR  469
               LGL+  G++  +K GRI V++  +T  P++YAIGDVI  P L   A + G   +   
Sbjct  305  TNGLGLESMGIQ-TDKMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEGIAAVEIM  363

Query  470  LYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ  529
            L   G V  +Y+ I   ++T  E  C G +EE  KEE        Y+    P+  +   +
Sbjct  364  LGKHGHV--NYNAIPGVIYTHPEVACVGKTEEQLKEEGIS-----YNVGKFPMIAN--SR  414

Query  530  TRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIH  588
             R   E+  +VKV+  K  N+ +LG H +  NAGE+     L ++ G   + +  T   H
Sbjct  415  ARAVGETDGFVKVLAQKD-NDRILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAH  473

Query  589  P  589
            P
Sbjct  474  P  474

>CCA22989
Length=494

 Score = 141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 141/482 (29%), Positives = 224/482 (46%), Gaps = 44/482 (9%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
            +S +YDL+VIGGG GG   + +AA  G K VC+         GT   LGGTC+NVGCIP 
Sbjct  23   SSTEYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPS  73

Query  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
            K +  SS +     HD  + G     +       ++ +++      +K ++   +   + 
Sbjct  74   KALLHSSHMFHTAQHDFKAIGIEASDLR-----LNFGKMMKAKEKSVKVLTSGIEGLFKK  128

Query  241  KQVKYENVLGSFV--DPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGEL  293
             +V Y    G+ V  D  ++      KG + I  ++++IA G       P  +    G +
Sbjct  129  NKVAYIKGHGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRI  188

Query  294  AVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMAS  352
              S+  +    +  P + +VVGA  + LE     + +G  V V+   + +  G D ++  
Sbjct  189  VDSTGALVL--KSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGR  246

Query  353  KIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET---FDTVLNATGRD  409
            +  + ++ Q G +F   T   S TK++  ++ +    ED     ET    D VL ATGR 
Sbjct  247  EFAKTLQKQ-GFKFKFATKVTS-TKVNEDRVTITM--EDAKGGNETNMECDVVLVATGRR  302

Query  410  PDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAG-RLLS  467
            P    LGL+  G++  +K GRI V+N  +T  PN+YAIGDVI  P L   A + G   + 
Sbjct  303  PFTQNLGLENLGIQ-TDKLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEGIAAVE  361

Query  468  RRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLA  527
              L  +G V  +Y+ I   ++T  E  C G +EE  KEE     V      F  +  S A
Sbjct  362  IMLGKQGHV--NYNAIPGVIYTFPEVACVGRTEEQLKEE----GVSYNVGKFPMIANSRA  415

Query  528  EQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGI  587
                +     +VKV+  K  N+ +LG H +  NAGE+     L ++ G + + +  T   
Sbjct  416  RA--VGETDGFVKVLAQKD-NDRILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHA  472

Query  588  HP  589
            HP
Sbjct  473  HP  474

>HYAP_12621
Length=501

 Score = 132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 133/479 (28%), Positives = 220/479 (46%), Gaps = 45/479 (9%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  185  QSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
             S+ +     H+  S+G +  +V    P     Q++      +++++   +      +V 
Sbjct  86   HSTHLLHTAQHEFKSYGIDAPNVTANFP-----QMMKAKEKAVRTLTAGIESLFSKNKVT  140

Query  245  YENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGRPRQLACL-----GGELAVSSD  298
            Y   +G       + +    ++G   +T +++++A G     L  +      G++  S+ 
Sbjct  141  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  200

Query  299  DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKIGEY  357
             +   +   P   +VVGA  + LE     K +G  V V+        G D+    +  + 
Sbjct  201  ALALTRV--PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKL  258

Query  358  MEMQSGIEFIRKTVPQSITKLDSGQL---LVKWITE---DGDCFEETFDTVLNATGRDPD  411
            ++ Q G+EF      Q  TK+ + ++   +V   TE    GD      DTVL ATGR   
Sbjct  259  LKKQ-GLEF------QFGTKVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAF  311

Query  412  VAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRL  470
             A LGL++ G++  +K GRI V++  QT  P V+AIGDVI    L   A + G      +
Sbjct  312  TAGLGLEQMGIQ-TDKQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENI  370

Query  471  YNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQT  530
              +    ++Y  I   ++T  E+   G +EE+ K E     VE Y+    P+  +   +T
Sbjct  371  AGKHG-HVNYGAIPNVIYTFPEFASVGKTEEELKAE----GVE-YNVGKFPMMANSRART  424

Query  531  RIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             +A     VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   HP
Sbjct  425  -VAEADGMVKVLADK-KTDKLLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  481

>PYVX_21248
Length=502

 Score = 122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 120/431 (28%), Positives = 198/431 (46%), Gaps = 27/431 (6%)

Query  168  LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
            LGGTC+NVGCIP K +  S+ +     HD A +G  V  V       +   ++      +
Sbjct  70   LGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEGVKA-----NLGGMMKAKEKAV  124

Query  228  ksisfkykVELRSKQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGRPRQL  286
             +++   +   +  +V Y    G  V  + + +  +  KG + +T ++++IA G  P  L
Sbjct  125  TTLTGGIESLFKKNKVTYIKGHGKIVGKNEVAVALNDDKGNQTVTAKNIMIATGSEPAPL  184

Query  287  ACL---GGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILL  343
              +     +  +          K P   +VVGA  + LE     K +G   KV V   L 
Sbjct  185  PPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KVTVVEFLD  242

Query  344  R---GFDQDMASKIGEYMEMQSGIEFIRKT-VPQSITKLDSGQLLVKWITEDGDCFEETF  399
            R   G D +++ +  + ++ Q G+EF   T V  S  K D+  L V+  +  G       
Sbjct  243  RACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVEP-SAGGSAASIEC  300

Query  400  DTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPV  458
            DTVL ATGR P    LGL++ G++  +K GR+ V++  +T  PN+YA GDVI    L   
Sbjct  301  DTVLVATGRRPFTEGLGLEQMGIQ-TDKQGRVEVDSHFRTQIPNIYAFGDVIKGAMLAHK  359

Query  459  AIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKN  518
            A + G   +  +  +    ++YD I   ++T  E    G +EE+ K E        Y+  
Sbjct  360  AEEEGVACAEIISGKHG-HVNYDAIPGVIYTTPEVASVGKTEEELKNEG-----VTYNVG  413

Query  519  FVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTY  578
              P+  +   +T IA    +VK++ DK  +  +LG H +  NAGE+     L ++ G + 
Sbjct  414  KFPMMANSRART-IAEADGFVKILADKATDR-ILGVHIIAGNAGEMVAEGVLGLEYGASS  471

Query  579  DQLVDTVGIHP  589
            + +  T   HP
Sbjct  472  EDIARTCHAHP  482

>PHYSO_556052
Length=500

 Score = 116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 136/480 (28%), Positives = 224/480 (47%), Gaps = 47/480 (10%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  33   DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  84

Query  185  QSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
             S+ +     HD  S+G +   V    P     Q++      +K+++   +   +  +V 
Sbjct  85   HSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKAKEKAVKTLTGGIESLFKKNKVT  139

Query  245  YENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAVSSD  298
            Y    G       + +  +  KG + +  ++++IA G       P  +    G++ + S 
Sbjct  140  YIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKI-IDST  198

Query  299  DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKIGEY  357
                +K + P   +VVGA  + LE     K +G  V V+  +     G D++   +  + 
Sbjct  199  GALSLK-RVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKL  257

Query  358  MEMQSGIEFIRKTVPQSITKLDSGQL---LVKWITE---DGDCFEETFDTVLNATGRDPD  411
            ++ Q G+EF      Q  TK+ + ++   +VK  TE    GD      DTVL ATGR   
Sbjct  258  LKKQ-GLEF------QFGTKVTASEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAF  310

Query  412  VAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRL  470
             A LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L   A + G      +
Sbjct  311  TAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENI  369

Query  471  YNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQT  530
              +    ++Y  I   ++T  E+   G +EE+ K E     +E Y+    P+  +   + 
Sbjct  370  AGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YNVGKFPMMAN--SRA  421

Query  531  RIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            R  AES   VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   HP
Sbjct  422  RTVAESDGLVKVLADK-KTDKLLGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHP  480

>PHYRA_72215
Length=499

 Score = 116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 134/480 (28%), Positives = 222/480 (46%), Gaps = 41/480 (9%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
            AS DYD+VVIGGG GG   + +AA  G K  CV    K         LGGTC+NVGCIP 
Sbjct  29   ASSDYDVVVIGGGPGGYVAAIKAAQLGFKTACVESRGK---------LGGTCLNVGCIPS  79

Query  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
            K +  S+ +     HD  S+G +   V    P     Q++      + +++   +   + 
Sbjct  80   KALLHSTHLLHTAQHDFKSYGIDAPGVTANFP-----QMMKAKEKAVTTLTGGIESLFKK  134

Query  241  KQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELA  294
             +V Y    G       + +  +  KG + +  ++++IA G       P  +    G++ 
Sbjct  135  NKVTYIKGYGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKII  194

Query  295  VSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASK  353
             S+  +   +   P   +VVGA  + LE     K +G  V V+  +     G D++   +
Sbjct  195  DSTGALALTRV--PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKEAVKE  252

Query  354  IGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE---DGDCFEETFDTVLNATGRDP  410
              + ++ Q G++F   T    +T  +    +VK  TE    G+      DTVL ATGR  
Sbjct  253  FTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGNAATIECDTVLVATGRRA  308

Query  411  DVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRR  469
              A LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L   A + G      
Sbjct  309  FTAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVEN  367

Query  470  LYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ  529
            +  +    ++Y  I   ++T  E+   G +EE+ K E     +E Y+    P+  +   +
Sbjct  368  IAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YNVGKFPMMANSRAR  421

Query  530  TRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            T +A     VKV+ DK + + +LG H +  NAGE+     +A++ G + + +  T   HP
Sbjct  422  T-VAEADGLVKVLADK-KTDKMLGVHIIASNAGEMISEGVIALEYGASSEDIARTCHAHP  479

>SPRG_19943
Length=343

 Score = 112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 127/239 (53%), Gaps = 14/239 (6%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            A+YDY  +V+G GSGG++ +  A ++G KV V++    +      GLGGTCVNVGC+PKK
Sbjct  19   ATYDY--IVLGAGSGGVSSAHRAVAYGAKVLVIERGHAN---DGAGLGGTCVNVGCVPKK  73

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
            +M  ++L  E+L H   ++ +  G  + Q   FDW  + +   +Y+K ++  Y   +   
Sbjct  74   IMFNAALHAEML-HSARAYAFK-GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLED  131

Query  242  QVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIF  301
            +V        FVD HT+++          T +H++IAVGG P      G E A+SSD  F
Sbjct  132  KVDLVMGAAKFVDNHTVEV-----NGDRYTAKHILIAVGGVPAMPPLPGIEHAISSDGFF  186

Query  302  WMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYME  359
             + + +P K  VVGA Y+A+E AG    +     +  R + +LR FD  +   +   ME
Sbjct  187  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEME  244

 Score = 32.3 bits (72),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (51%), Gaps = 1/51 (2%)

Query  539  VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +K+VC       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  255  MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  304

>PITG_15359
Length=496

 Score = 114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 134/482 (28%), Positives = 225/482 (47%), Gaps = 45/482 (9%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  26   SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
             +  S+ +     HD  S+G +   V    P     Q++ +    +K+++   +   +  
Sbjct  78   ALLHSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKSKEKAVKTLTGGIESLFKKN  132

Query  242  QVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAV  295
            +V Y    G       + +  +  KG + +  ++++IA G       P  +    G++ +
Sbjct  133  KVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-I  191

Query  296  SSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKI  354
             S     +K + P   +VVGA  + LE     K +G  V V+        G D++   + 
Sbjct  192  DSTGALELK-RVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEF  250

Query  355  GEYMEMQSGIEFIRKTVPQSITKLDSGQL---LVKWITE---DGDCFEETFDTVLNATGR  408
             + ++ Q G++F      Q  TK+ + ++   +VK  TE    GD      DTVL ATGR
Sbjct  251  TKLLKKQ-GLDF------QFNTKVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGR  303

Query  409  DPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLS  467
                + LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L   A + G    
Sbjct  304  RAFTSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACV  362

Query  468  RRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLA  527
              +  +    ++Y  I   ++T  E+   G +EE+ K E     +E Y+    P+  +  
Sbjct  363  ENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YNVGKFPMMANSR  416

Query  528  EQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGI  587
             +T IA     VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   
Sbjct  417  ART-IAEADGLVKVLADK-KTDKLLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHA  474

Query  588  HP  589
            HP
Sbjct  475  HP  476

>PHYCA_123621
Length=495

 Score = 114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 131/479 (27%), Positives = 218/479 (46%), Gaps = 39/479 (8%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            ++ DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  25   STNDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  76

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
             +  S+ +     HD  S+G +   V    P     Q++      + +++   +   +  
Sbjct  77   ALLHSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKAKEKAVTTLTGGIESLFKKN  131

Query  242  QVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAV  295
            +V Y    G       + +  +  KG + +  ++++IA G       P  +    G++  
Sbjct  132  KVTYIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIID  191

Query  296  SSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKI  354
            S+  +   +   P   +VVGA  + LE     K +G  V V+        G D+    + 
Sbjct  192  STGALSLTRV--PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEF  249

Query  355  GEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE---DGDCFEETFDTVLNATGRDPD  411
             + ++ Q G++F   T    +T  +    +VK  TE    GD      DTVL ATGR   
Sbjct  250  TKLLKKQ-GLDFKFST---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAF  305

Query  412  VAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRL  470
             A LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L   A + G      +
Sbjct  306  TAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENI  364

Query  471  YNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQT  530
              +    ++Y  I   ++T  E+   G +EE+ K E     VE Y+    P+  +   +T
Sbjct  365  AGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GVE-YNVGKFPMMANSRART  418

Query  531  RIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             +A     VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   HP
Sbjct  419  -VAEADGLVKVLADK-KTDKLLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  475

>PHYKE_9680
Length=498

 Score = 114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 115/433 (27%), Positives = 201/433 (46%), Gaps = 31/433 (7%)

Query  168  LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
            LGGTC+NVGCIP K +  S+ +     HD  S+G +   V    P     Q++      +
Sbjct  66   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPGVKANFP-----QMMKAKEKAV  120

Query  228  ksisfkykVELRSKQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR----  282
            K+++   ++  +  +V Y    G       + +     KG + +  ++++IA G      
Sbjct  121  KTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTPL  180

Query  283  -PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRS  340
             P  +    G++  S+  +    ++ P   +VVGA  + LE     K +G  V V+  + 
Sbjct  181  PPVPVDNEAGKIIDSTGALVL--KRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQD  238

Query  341  ILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE---DGDCFEE  397
                G D++   +  + ++ Q G++F   T    +T  +    +VK  TE    GD    
Sbjct  239  AACPGMDKECVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEASI  294

Query  398  TFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELT  456
              DTVL ATGR    A LGL++ G++  +K GR+ V++  +T  P ++AIGDVI    L 
Sbjct  295  ECDTVLVATGRRAYTAGLGLEQMGIQ-TDKLGRVEVDDAFRTQVPGIFAIGDVIKGAMLA  353

Query  457  PVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYH  516
              A + G      +  +    ++Y  I   ++T  E+   G +EE+ K E     +E Y+
Sbjct  354  HKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YN  407

Query  517  KNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGF  576
                P+  +   +T +A     VKV+ DK + + +LG H +  NAGE+     +A++ G 
Sbjct  408  VGKFPMMANSRART-VAEADGLVKVLSDK-KTDKMLGVHIIASNAGEMIAEGVIALEYGA  465

Query  577  TYDQLVDTVGIHP  589
            + + +  T   HP
Sbjct  466  SSEDIARTCHAHP  478

>PYU1_G014259
Length=244

 Score = 107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 112/223 (50%), Gaps = 28/223 (13%)

Query  125  DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
            +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  34   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGGTCVNVGCVPKKIM  84

Query  184  HQSSLIGEILHHDCASFGWNV--GSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
            + ++ +  +LH D   +G+    G   G+  +F W +L             +    LR  
Sbjct  85   YLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKL----------KERRDAYVLRLN  134

Query  242  QVKYENVLGSFVDPHTLKLWHPKKGT-----KEITTRHVVIAVGGRPRQLACLGGELAVS  296
             +   N+  S VD          +G      KE+  ++++IAVGG+P      G E  + 
Sbjct  135  GIYERNLANSKVDLLQGTAAFNAQGNVEVDGKEVKAKNILIAVGGKPLIPDIPGKEHCID  194

Query  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR  339
            SD  F + +  P K  VVGA Y+A+E AG L G+G    +  R
Sbjct  195  SDGFFEL-EVLPKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>H257_01186
Length=496

 Score = 109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 125/481 (26%), Positives = 214/481 (44%), Gaps = 49/481 (10%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            +YDL+VIG G  GL C+ E+A  GK V ++D         S  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  185  QSSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
            ++ L +    HH      ++   +           +VS+    I++      V++   + 
Sbjct  80   EAVLHLSGFNHHGFYGKSYSRERITLSDILHRVNVVVSSEMDVIRAQLKAAHVQIIPGKA  139

Query  244  KYENVLGSFVDPHTLK----LWHPKKGTKEITTRHVVIAVGGRPRQ--LACLGGELAVSS  297
            ++EN     V+  T+     ++  KK          +IA G  P    +  + GE+ + S
Sbjct  140  RFENANEVSVENGTVHREAMIYRGKK---------FLIACGTYPAHSPVVPVDGEVILDS  190

Query  298  DDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQDMASKI  354
            D I    + E P   +VVGA  + +E A  L  + G AV V+  R  +L   D ++ S +
Sbjct  191  DGILEASKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSAL  250

Query  355  GEYMEMQ-SGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETF-DTVLNATGRDPDV  412
               MEM+  G  F+     QS+T++  G      +  D    + +F + +L   GR  + 
Sbjct  251  --KMEMRHKGARFLLGETIQSVTRVAKG------VRVDFASGKSSFAEALLYCVGRQANT  302

Query  413  AKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY  471
              L L+  G+  N K G + VN + QT+ P++YA GD I AP L   +++ GRL +  ++
Sbjct  303  DALNLEGVGLAKN-KRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMW  361

Query  472  N---EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAE  528
            +   + T Q+D       ++T  E    G +E+   +E  + +V +   +       LA+
Sbjct  362  HHEDQPTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKEGRNYAVGMAKYS------ELAK  415

Query  529  QTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIH  588
                  +   +K++ D    + VLG H +G  A E+     +AM +        D V  +
Sbjct  416  GMMAGGQKGALKILFDPDTQS-VLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFNY  474

Query  589  P  589
            P
Sbjct  475  P  475

>PYAR_20075
Length=469

 Score = 108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 132/470 (28%), Positives = 205/470 (44%), Gaps = 55/470 (12%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            +YDLVV+GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  30   EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  81

Query  185  QSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
             S+ +     HD   +G  V  V       D+  ++ +    +K+++   +   +  +V 
Sbjct  82   HSTHLFHTAQHDFKKYGIEVSDVQ-----MDFGGMMKSKEKAVKTLTAGIESLFKKNKVT  136

Query  245  YENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMK  304
            Y    G  V                     V +A+          G E  V S     +K
Sbjct  137  YIKGFGKIV-----------------AANEVAVALNDNN------GNETIVDSTGALALK  173

Query  305  QKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRS-ILLRGFDQDMASKIGEYMEMQSG  363
             K P   +V+G   + LE     K +G  V V+  +  +  G D ++  +  + ++ Q G
Sbjct  174  -KAPEHLVVIGGGVIGLELGSVYKRLGSKVTVVEYADRVCPGLDLELGKEFAKLLKKQ-G  231

Query  364  IEFIRKT-VPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGV  422
            ++   KT V  S    D   L V+     G+      DTVL ATGR P    LGL++ G+
Sbjct  232  LDLQFKTKVTASQVNGDKVTLTVEP-AAGGEATTIEADTVLVATGRRPFTNGLGLEQMGI  290

Query  423  KLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYN-EGTVQMDY  480
            +  +K GRI V+   +T  P++YAIGDVI  P L   A + G      +    G V  +Y
Sbjct  291  Q-TDKMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIAGLHGHV--NY  347

Query  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES-CYV  539
            + I   ++T  E    G +EE  KEE        Y+    P+  +   + R   E   +V
Sbjct  348  NAIPGVIYTHPEVASVGKTEEQLKEEG-----IAYNVGKFPMMAN--SRARAVGEGDGFV  400

Query  540  KVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            KV+ DKT +  +LG H +  NAGE+     L ++ G   + +  T   HP
Sbjct  401  KVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHP  449

>PHALS_09942
Length=496

 Score = 108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 140/504 (28%), Positives = 228/504 (45%), Gaps = 46/504 (9%)

Query  101  DTASASELNESRTPPIVVED-DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKP  159
            + AS S  +  R   I +    +S +YD+VVIGGG GG   + +AA  G K   ++    
Sbjct  4    NIASISRRSAIRHHSITLRAFSSSSEYDVVVIGGGPGGYVAAIKAAQLGMKTACIE----  59

Query  160  SPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQL  219
                +   LGGTC+NVGCIP K +  S+ +     H+  ++G +   V    P     Q+
Sbjct  60   ----SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHEFKNYGIDAPEVTANFP-----QM  110

Query  220  VSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIA  278
            +      +K+++   +   +  +V Y    G       + +  H  KG + +  ++++IA
Sbjct  111  MKAKDKAVKTLTSGIESLFKKNKVTYIKGSGKISAQGEVSVALHDHKGNETVKAKNIIIA  170

Query  279  VGGR-----PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYA  333
             G       P  +    G++ V S     +K + P   +VVGA  + LE     K +G  
Sbjct  171  TGSEVTPLPPVPVDNAAGKI-VDSTGALELK-RIPDHLVVVGAGVIGLELGSVYKRLG--  226

Query  334  VKVMVRSIL---LRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE  390
             KV V   L     G D+       + ++ Q G+EF   T    +T  +    +VK  TE
Sbjct  227  AKVTVVEYLDDACTGMDKGSVKDFIKLLKKQ-GLEFKFGT---KVTASEINGDVVKLTTE  282

Query  391  ---DGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAI  446
                GD      DTVL ATGR    A LGL++ G++  +K GRI V+   +T  P ++AI
Sbjct  283  PSQGGDAASIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKFGRIEVDEAFRTQVPGIFAI  341

Query  447  GDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEE  506
            GDVI    L   A + G   +  +  +    ++Y  I   ++T  E+   G +EE+ K E
Sbjct  342  GDVIKGAMLAHKAEEEGIACAEIIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE  400

Query  507  YGDDSVEVYHKNFVPLEWSLAEQTRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVT  565
                 +E Y+    P+  +   + R   ES   VKV+ DK + + +LG H +  NAGE+ 
Sbjct  401  ----GIE-YNVGKFPMMAN--SRARTVGESDGMVKVLADK-KTDKLLGVHIIASNAGEMI  452

Query  566  QAMGLAMKLGFTYDQLVDTVGIHP  589
                + ++ G   + +  T   HP
Sbjct  453  SEGVIGIEYGAASEDVARTSHAHP  476

>CCA16670
Length=520

 Score = 108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 126/480 (26%), Positives = 213/480 (44%), Gaps = 41/480 (9%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDL+VIG G     C+ +AA  GK V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++  V     T D   ++  V+  I+S     + + +S ++ 
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKHV-----TID--DILYRVNRVIQSEVDFLRTQFKSARID  134

Query  245  YENVLGSFVDPHTLKLWHP-----KKGTKEITTRHVVIAVGGRPRQLACL--GGELAVSS  297
            Y +    F D H + +        +K TK +     ++A G RP     +   G++   S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  298  DDIF-WMKQKEPGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQDMASKI  354
            D I  W  ++ P   +VVGA  + +E A  L  + G++V V+  R  +L   D ++ S +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  355  GEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAK  414
               M    G  F+   + +S+ K   G   V    + G       D +L   GR  +   
Sbjct  255  THEMR-NHGARFLLGEIIESVEKSSRG---VSVGLKSGKKVHG--DALLYVVGRQANTDG  308

Query  415  LGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNE  473
            L L+ AG+  N + G + VN + QT  P+++A+GD I AP L   +++ GRL S  ++NE
Sbjct  309  LNLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNE  367

Query  474  GTVQMDYDKICTAVFT-PIEYGCCGLSEED--SKEEYGDDSVEVYHKNFVPLEWSLAE-Q  529
               + + D I + + T    YG   + E     K E    S+++ ++  V     LA+ Q
Sbjct  368  N--EANDDSIPSQLTTGNFPYGIYTIPEISMVGKTEKELTSLKMNYEIGVAKYSELAKGQ  425

Query  530  TRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               A+    +K++ D        G H +G  A E+     +A+ +G T     D V  +P
Sbjct  426  MSGASADGMLKILFDPISLKL-YGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYP  484

>CCI50816
Length=807

 Score = 108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 125/484 (26%), Positives = 213/484 (44%), Gaps = 49/484 (10%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDL+VIG G     C+ +AA  GK V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++ +V     T D   ++  V+  I+S     +V+ +S +V 
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKNV-----TID--DILYRVNRVIQSEVDLLRVQFKSARVD  134

Query  245  YENVLGSFVDPHTLKLWHP-----KKGTKEITTRHVVIAVGGRPRQLACL--GGELAVSS  297
            Y +    F D H + +        +K TK +     ++A G RP     +   G++   S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  298  DDIF-WMKQKEPGKTLVVGASYVALECAGFLKGM-GYAVKVMV-RSILLRGFDQDMASKI  354
            D I  W  ++ P   +VVGA  + +E A  L  + G++V V+  R  +L   D ++ S +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  355  GEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAK  414
               M    G  F+     +S+ K   G L+     + G       D +L   GR  +   
Sbjct  255  THEMR-NHGARFLLGETIESVDKSSRGVLVG---LKSGKKVHG--DALLYVVGRQANTDG  308

Query  415  LGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNE  473
            L L+ AG+  N + G + VN + QT  P+++A+GD I AP L   +++ GRL S  ++NE
Sbjct  309  LNLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNE  367

Query  474  GT-------VQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL  526
                      Q+        ++T  E    G +E+         S ++ ++  V     L
Sbjct  368  DESNDDSIPSQLKTGNFPYGIYTIPEISMVGHTEKQLT------SQQINYEIGVAKYSEL  421

Query  527  AE-QTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTV  585
            A+ Q   A+    +K++ D   +  + G H +G  A E+     +A+ +G T     D V
Sbjct  422  AKGQMSGASADGMLKILFD-PHSLKLFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAV  480

Query  586  GIHP  589
              +P
Sbjct  481  FNYP  484

>H310_00561
Length=497

 Score = 107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 124/479 (26%), Positives = 217/479 (45%), Gaps = 45/479 (9%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            +YDL+VIG G  GL C+ E+A  GK V ++D         S  +GG CV+ G IP K   
Sbjct  29   EYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSKTFR  80

Query  185  QSSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
            ++ L +    HH     G+   S + +  T   + ++  V+  + S     + +L++  V
Sbjct  81   EAVLHLSGFNHH-----GFYGKSYSRERITL--RDILHRVNVVVSSEMDVIRAQLKAAHV  133

Query  244  KYENVLGSFVDPHTLKLWHPKKGTKEITTR--HVVIAVGGRPRQ--LACLGGELAVSSDD  299
            +       F + + + +     G++    R    +IA G  P    +  + GE+ + SD 
Sbjct  134  QIIPGKARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSDG  193

Query  300  IFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQDMASKIGE  356
            I    + E P   +VVGA  + +E A  L  + G +V V+  R  +L   D ++ S +  
Sbjct  194  ILDASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDDEIVSAL--  251

Query  357  YMEMQ-SGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETF-DTVLNATGRDPDVAK  414
             MEM+  G  F+     QS+ ++  G      +  D    + +F + +L   GR  +   
Sbjct  252  KMEMRHKGARFLLGETIQSVKRVRKG------VRVDFASGKSSFAEALLYCVGRQANTDT  305

Query  415  LGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY--  471
            L L+  G+  N K G + VN + QTT P+++A GD I AP L   +++ GRL +  ++  
Sbjct  306  LNLEGVGLSKN-KRGLLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRH  364

Query  472  -NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQT  530
             ++ T Q+D       ++T  E    G +E+   +E  + +V V   +       LA+  
Sbjct  365  EDQPTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKEGRNYAVGVAKYS------ELAKGM  418

Query  531  RIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                +   +K++ D   ++ VLG H +G  A E+     +AM +        D V  +P
Sbjct  419  MAGGQKGALKLLFDPDSHS-VLGVHAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFNYP  476

>SPRG_09825
Length=492

 Score = 105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 128/485 (26%), Positives = 216/485 (45%), Gaps = 57/485 (12%)

Query  125  DYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
            DYDLVV+GGG GG   + +AA  G K  CV         GT   LGGTC+NVGCIP K +
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACV------ESRGT---LGGTCLNVGCIPSKAL  75

Query  184  HQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
              ++       HD  + G  V  +       D+ +L+++    +K ++   +   +  +V
Sbjct  76   LSATHKYHAAQHDFKNVGIEVDGLR-----IDFAKLMASKDKSVKILTGGIEGLFKKNKV  130

Query  244  KYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAVSSD  298
             Y    G  V  + + +   + G K ++T++++IA G       P  +    G++  S+ 
Sbjct  131  DYIKGFGKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTG  190

Query  299  DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYM  358
             +    ++ P   +V+G   + LE       +G  + V+           + A KI   M
Sbjct  191  ALSL--KRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTM  237

Query  359  EMQSGIEFIRKTVPQSITKLDSGQLLVKWITE------------DGDCFEETFDTVLNAT  406
            + ++G EF +K + +       GQ +     E             G+      DTVL AT
Sbjct  238  DFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVAT  296

Query  407  GRDPDVAKLGLDEAGVKLNEKTGRIWVN--NEQTTTPNVYAIGDVIDAPELTPVAIQAGR  464
            GR P    LGL+E G++  +K GRI V+  N +T   N++AIGD I+   L   A + G 
Sbjct  297  GRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGI  355

Query  465  LLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEW  524
                 +   G   ++Y+ I   V+T  E    G +EE+ K      +   Y+    P+  
Sbjct  356  SCVESIAG-GHGHVNYNAIPGVVYTFPEVASVGKTEEELKA-----ANVAYNVGKFPMMA  409

Query  525  SLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDT  584
            +   +T +     +VK++  K  ++ +LG H +  NAGE+     L ++ G + + +  T
Sbjct  410  NSRART-VGETDGFVKILAAKD-DDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRT  467

Query  585  VGIHP  589
               HP
Sbjct  468  CHAHP  472

>PHYRA_47253
Length=481

 Score = 104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 125/498 (25%), Positives = 211/498 (42%), Gaps = 70/498 (14%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++ +V  +   +  +++VS+            + +L++ +V 
Sbjct  53   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSS-------EEDVVRAQLKAARVD  105

Query  245  YENVLGSFVDPHTLKLWH-----PKKGTKEITT---------RHVVIAVGGRPRQ--LAC  288
                   F   H + +        KKG    +T            +IA G RP    L  
Sbjct  106  VVPGFARFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVP  165

Query  289  LGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVMV-RSILLRG  345
            + G++ + SD I      + P   +VVGA  + +E A  +  + G++V V+  R  +L  
Sbjct  166  IDGQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSF  225

Query  346  FDQDMASKIGEYMEMQS-GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLN  404
             D+++ S +    EMQS G  F+   + ++I K+++    VK   + G     + D +L 
Sbjct  226  CDREIISNL--TYEMQSNGARFL---LGETIKKVETADNRVKVFFDSGKVL--SADALLY  278

Query  405  ATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAPELTPVAIQAG  463
              GR      L L+  G+  N + G I VN N QT  P++YA GD I AP L   +++ G
Sbjct  279  TVGRQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQG  337

Query  464  RLLSRRLYNEG-----TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKN  518
            RL S  ++        T Q++       ++T  E    G +E+               K+
Sbjct  338  RLASCHMWKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTEQQ------------LTKD  385

Query  519  FVPLEWSLAEQTRIAAESCY-------VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLA  571
             V  E  +A+ + +A            +K++ D      V G H +G  A E+     +A
Sbjct  386  CVNYEIGVAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVA  444

Query  572  MKLGFTYDQLVDTVGIHP  589
            M +  +     D V  +P
Sbjct  445  MAMDCSLTYFRDAVFNYP  462

>PHALS_10055
Length=516

 Score = 104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 125/498 (25%), Positives = 215/498 (43%), Gaps = 69/498 (14%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            +YDL+VIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  185  QSSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
            ++ L +    HH      +++ +V  +   +  +++VS+            + +L++ +V
Sbjct  83   EAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSS-------EEDVVRAQLKAARV  135

Query  244  KYENVLGSFVDPHTLKLWHP--KKGTKEITTRHV-----------VIAVGGRPRQ--LAC  288
                    F + H + +      +  KEI+   V           +IA G RP    L  
Sbjct  136  DVIPGFARFENEHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIP  195

Query  289  LGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRG  345
            + G++ + SD I        P   +V+GA  + +E A  +  + G++V V+  R  +L  
Sbjct  196  IDGKVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPF  255

Query  346  FDQDMASKIGEYMEMQS-GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLN  404
             D ++ S +    EMQS G  F+   + +++ K+++ +  VK     G     + D +L 
Sbjct  256  CDLEIISNLT--YEMQSNGARFL---LGETVKKVETTKNQVKVFFNSGKVL--SADALLY  308

Query  405  ATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAPELTPVAIQAG  463
              GR      L L+  G+  N + G I VN N QT  P++YA GD I AP L   +++ G
Sbjct  309  TVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQG  367

Query  464  RLLSRRLY--NE---GTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKN  518
            RL S  ++  NE    T Q++       ++T  E    G +E+               KN
Sbjct  368  RLASCHMWKPNEELAATSQLESGNYPYGIYTIPEISMVGQTEQQ------------LTKN  415

Query  519  FVPLEWSLAEQTRIAAESCY-------VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLA  571
             +  E  +A+ + +A            +K++ D    +  LG H +G  A E      +A
Sbjct  416  CINYEIGIAKYSELAKGQMMGAMAGGTLKILFDPETLSL-LGVHAIGEGATETIHIGQVA  474

Query  572  MKLGFTYDQLVDTVGIHP  589
            M +G +     D V  +P
Sbjct  475  MAMGCSLTYFRDAVFNYP  492

>SDRG_06945
Length=492

 Score = 103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 127/485 (26%), Positives = 215/485 (44%), Gaps = 57/485 (12%)

Query  125  DYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
            DYDLVV+GGG GG   + +AA  G K  CV         GT   LGGTC+NVGCIP K +
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACV------ESRGT---LGGTCLNVGCIPSKAL  75

Query  184  HQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
              ++       HD  + G  V  +       D+ +L+++    +K ++   +   +  ++
Sbjct  76   LSATHKYHAAQHDFKNVGIEVDGLR-----IDFAKLMASKDKSVKILTGGIEGLFKKNKI  130

Query  244  KYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAVSSD  298
             Y    G  V  + + +     G K ++T++++IA G       P  +    G++  S+ 
Sbjct  131  DYIKGFGKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTG  190

Query  299  DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYM  358
             +    ++ P   +V+G   + LE       +G  + V+           + A KI   M
Sbjct  191  ALSL--KRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTM  237

Query  359  EMQSGIEFIRKTVPQSITKLDSGQLLVKWITE------------DGDCFEETFDTVLNAT  406
            + ++G EF +K + +       GQ +     E             G+      DTVL AT
Sbjct  238  DFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVAT  296

Query  407  GRDPDVAKLGLDEAGVKLNEKTGRIWVN--NEQTTTPNVYAIGDVIDAPELTPVAIQAGR  464
            GR P    LGL+E G++  +K GRI V+  N +T   N++AIGD I+   L   A + G 
Sbjct  297  GRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGI  355

Query  465  LLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEW  524
                 +   G   ++Y+ I   V+T  E    G +EE+ K      +   Y+    P+  
Sbjct  356  SCVESIAG-GHGHVNYNAIPGVVYTFPEVASVGKTEEELKA-----AGVAYNVGKFPMMA  409

Query  525  SLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDT  584
            +   +T +     +VK++  K  ++ +LG H +  NAGE+     L ++ G + + +  T
Sbjct  410  NSRART-VGETDGFVKILAAKD-DDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRT  467

Query  585  VGIHP  589
               HP
Sbjct  468  CHAHP  472

>PYVX_20512
Length=528

 Score = 102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 125/494 (25%), Positives = 208/494 (42%), Gaps = 58/494 (12%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            DYDLVVIG G     C+ E+A  GK+V ++D            +GG CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  88

Query  185  QSSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
            ++ L +    HH      +++ ++     T D   ++  V   + S     K +L++ +V
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKNI-----TID--DILYRVQRVVASEVDVIKAQLKAARV  141

Query  244  KYENVLGSFVDPHTLKLWHPKKGT----------------KEITTRHVVIAVGGRPRQ--  285
             Y     SF  PH L +      +                  +     +IA G RP    
Sbjct  142  DYIAGTASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNP  201

Query  286  LACLGGELAVSSDDIFWMK-QKEPGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSIL  342
            L  + G++   SD I   +  + P   +VVGA  + +E A  +  + G++V V+  R  +
Sbjct  202  LVPVDGKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDI  261

Query  343  LRGFDQDMASKIGEYMEMQS-GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDT  401
            L   D ++ S +    EM+S G  F+     +SI K + G   VK     G     T D 
Sbjct  262  LSFCDTEIISNL--MYEMRSKGARFLLGETIKSIEKSERG---VKVFFNSGKV--ATADA  314

Query  402  VLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAPELTPVAI  460
            +L   GR      L L+  G+  N + G + VN N QT   ++YA GD I AP L   ++
Sbjct  315  LLYTVGRQASTDGLNLEAVGLSRNPR-GLLTVNKNYQTDQAHIYAAGDCIGAPALASTSM  373

Query  461  QAGRLLSRRLYN-----EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVY  515
            + GRL +  +++     + T Q+D       ++T  E    G +E+   +E  +  V + 
Sbjct  374  EQGRLAACHMWDDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQQLTKEGVNYEVGIA  433

Query  516  HKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLG  575
              +    E +  + T   A      + C  +   F  G H +G  A E+     +A+ +G
Sbjct  434  KYS----ELAKGQMTGAIAGGMLKILFCPDSLELF--GVHAIGEGATEIIHIGQVAIAMG  487

Query  576  FTYDQLVDTVGIHP  589
             +     + V  +P
Sbjct  488  CSLTYFRNAVFNYP  501

>PYAR_16840
Length=536

 Score = 102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 123/509 (24%), Positives = 211/509 (41%), Gaps = 79/509 (16%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVVIG G     C+ E+A  GK+V V+D        T  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++ +V      +  K++V +            K +L++ ++ 
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDS-------EVDVIKAQLKAARID  141

Query  245  YENVLGSFVDPHTLKLW-------HPKKGTKEITTRHVVIAVGGRPRQ--LACLGGELAV  295
            Y   L  F + H + +                +     +IA G RP    L  + G++ +
Sbjct  142  YLPGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVIL  201

Query  296  SSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-----VRSILLRGFDQ  348
             SD I     +E P   +VVGA  + +E A  L  + G++V V+     VR++L     +
Sbjct  202  DSDQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---SR  258

Query  349  DMASK------------------IGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE  390
            DM+ +                  I   ++ +  ++  R  + ++I K++     VK    
Sbjct  259  DMSLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFLT  318

Query  391  DGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDV  449
             G     + D +L   GR      L L+  G+  N K G + VN   QT  P++YA+GD 
Sbjct  319  SGKV--TSGDALLYTVGRQASTDGLNLEAVGLGRN-KRGLLTVNKAYQTEKPHIYAVGDC  375

Query  450  IDAPELTPVAIQAGRLLSRRLYNEG---TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEE  506
            I AP L   +++ GRL +  ++ +    T Q++       ++T  E    G +E+    E
Sbjct  376  IGAPSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSE  435

Query  507  YGDDSVEVYHKNFVPLEWSLAEQTRIAAESC------YVKVVCDKTRNNFVLGFHYLGPN  560
                         V  E  LA+ + +A           +K++ D      V G H +G  
Sbjct  436  K------------VNYEIGLAKYSELAKGQMSGGAFGMLKILFDPDTLR-VHGVHAIGEG  482

Query  561  AGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            A E+     +A+ +G +     D V  +P
Sbjct  483  ATEIIHIGQVAIAMGCSLTYFRDAVFNYP  511

>PPTG_09121
Length=520

 Score = 101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 122/501 (24%), Positives = 208/501 (42%), Gaps = 73/501 (15%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  32   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  83

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++ +V  +   +  +++VS+            + +L++ +V 
Sbjct  84   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSS-------EEDVVRAQLKAARVD  136

Query  245  YENVLGSFVDPHTLKLWHPKKGTKE-----------------ITTRHVVIAVGGRPRQ--  285
                   F + H + +       K+                 I     +IA G RP    
Sbjct  137  VVPGFARFENEHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNP  196

Query  286  LACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSIL  342
            L  + G++ + SD I      + P   +V+GA  + +E A  +  + G+ V V+  R  +
Sbjct  197  LIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDI  256

Query  343  LRGFDQDMASKIGEYMEMQS-GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDT  401
            L   D ++ S +    EMQS G  F+   + +++ K+++    VK     G     + D 
Sbjct  257  LSFCDSEIISNL--TYEMQSNGARFL---LGETVKKVETTDKRVKVFFNSGKVL--SADA  309

Query  402  VLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAPELTPVAI  460
            +L   GR      L L+  G+  N + G I VN N QT  P++YA GD I AP L   ++
Sbjct  310  LLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSM  368

Query  461  QAGRLLSRRLYN-----EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVY  515
            + GRL S  ++N       T Q++       ++T  E    G +E+              
Sbjct  369  EQGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQTEQQ------------L  416

Query  516  HKNFVPLEWSLAEQTRIAAESCY-------VKVVCDKTRNNFVLGFHYLGPNAGEVTQAM  568
             K+ V  E  +A+ + +A            +K++ D      V G H +G  A E+    
Sbjct  417  TKDCVNYEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIG  475

Query  569  GLAMKLGFTYDQLVDTVGIHP  589
             +AM +  +     D V  +P
Sbjct  476  QVAMAMDCSLTYFRDAVFNYP  496

>H310_02523
Length=494

 Score = 101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 119/441 (27%), Positives = 194/441 (44%), Gaps = 47/441 (11%)

Query  168  LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
            LGGTC+NVGCIP K +   + +     HD  S G  V +V     + D+ QL+ +    +
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHAAQHDFKSVGIKVDNV-----SIDFNQLMKSKEKTV  116

Query  228  ksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----  282
            K ++   +   +  +V Y    G  V    L +     G + + T++++IA G       
Sbjct  117  KILTGGIEGLFKKNKVDYVKGFGKIVAKGQLSVALNGGGNQTLHTKNILIATGSEVTPLP  176

Query  283  PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSIL  342
            P  +   GG++ V S     +K + P   +VVG   + LE       +G  + V+     
Sbjct  177  PVPVDNEGGKI-VDSTGALSLK-RIPNHLVVVGGGVIGLEMGSVYGRLGSKITVV-----  229

Query  343  LRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSIT----------KLDSGQL-LVKWITED  391
                  + A KI   M+ +   EF +    Q +T          K+D   + L       
Sbjct  230  ------EYADKICPTMDHELTKEFQKLLTKQGMTFKLGQKVTASKVDGDTVTLTVEPAAG  283

Query  392  GDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN--NEQTTTPNVYAIGDV  449
            GD      D VL ATGR P  A LGL++ G++  ++ GRI VN  N QT    +YAIGDV
Sbjct  284  GDATTIEADCVLVATGRRPYTAGLGLEDMGIQ-TDRFGRIKVNLSNFQTNVDGIYAIGDV  342

Query  450  IDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGD  509
            I+   L   A + G  +   +  +    ++YD I   ++T  E    G +EE+ K     
Sbjct  343  IEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAIPGVIYTFPEVASVGKTEEELKA----  397

Query  510  DSVEVYHKNFVPLEWSLAEQTRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAM  568
             +   Y+    P+  +   + R   E+  +VKV+  K  ++ +LG H +  NAGE+    
Sbjct  398  -ANVAYNVGKFPMMAN--SRARAVGETDGFVKVLAAKD-DDKILGIHIIASNAGEMISEG  453

Query  569  GLAMKLGFTYDQLVDTVGIHP  589
             L ++ G + + +  T   HP
Sbjct  454  VLGIEYGASAEDIGRTCHAHP  474

>PHYRA_73883
Length=551

 Score = 101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 128/521 (25%), Positives = 213/521 (41%), Gaps = 83/521 (16%)

Query  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
            E  AS  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G +
Sbjct  39   ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTV  90

Query  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
            P K   +++L      H     G       G    F  + ++  V     + +   + +L
Sbjct  91   PSKTFREAALHLTGYRHKAFYNGQA-----GPSKRFGVEDILQRVRKVEDAETDITRHQL  145

Query  239  RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITT---RHV--------------VIAVGG  281
                V+  N    F+  +   +      + E  T   RH               ++ VG 
Sbjct  146  MRNGVQLINGTARFLPGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKFLVCVGT  205

Query  282  RPRQLACL--GGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
            RP +   +   GE    SD + W K K  P + +VVGA  V +E A  +  + G  V V+
Sbjct  206  RPARHPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVI  265

Query  338  -VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFE  396
              R  +L   D++++  +  Y   Q+G  F+ +   +S+ K D+G++ V    E G    
Sbjct  266  DGRKEILNMADKEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIFVHL--ESGKTV-  321

Query  397  ETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-NNEQTTTPNVYAIGDVIDAPEL  455
               D +L   GR  +V  L L+  G+   +K GRI V NN QT  P++YA GD+I  P L
Sbjct  322  -VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAAPHIYAAGDIIGFPGL  379

Query  456  TPVAIQAGRL----------LSRRLYNEGTVQMDYDKICT----------AVFTPIEYGC  495
               +++ GRL          L+ ++ ++     D D++ T           ++T  E   
Sbjct  380  ASTSMEQGRLASVHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISM  439

Query  496  CGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC------YVKVV-CDKTRN  548
             G +E+   +E              P E  +A    +A          ++K++ C  T  
Sbjct  440  VGKNEQQLTKEQ------------TPYEVGMARYEELARGQMLGGVPGFLKIIFCPDTLK  487

Query  549  NFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              +LG H +G  A E+     + M  G   +   + V  +P
Sbjct  488  --ILGVHAIGEGATEIIHIGQVVMSTGGNLEYFRNAVFNYP  526

>PYU1_G001737
Length=133

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
            M V+YP  + F  H F DRDAF+ WL  S +DF T FG  S A TH +SPFVW SN   F
Sbjct  59   MQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVW-SNAGEF  117

Query  61   VGGCDDLLAVFRSGIA  76
            VGGCD LLA  R  I+
Sbjct  118  VGGCDALLATIRGSIS  133

>H310_07641
Length=548

 Score = 100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 129/517 (25%), Positives = 212/517 (41%), Gaps = 79/517 (15%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            AS  +DLVVIG G  G  C+ ++A  GKKV ++D  K   HG      G CV+ G IP K
Sbjct  37   ASEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIID--KKDMHG------GVCVHTGTIPSK  88

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               ++ L   +  H    F  N  + +        ++++  V    ++ +   + +L   
Sbjct  89   TFREAVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEEAETDLTRNQLTRN  146

Query  242  QVKYENVLGSFV---DPHTLKLWHPKKGTKE---------------ITTRHVVIAVGGRP  283
             +   N    F+   D  T+ +      T++               +T   V+IAVG RP
Sbjct  147  GIILINGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRP  206

Query  284  RQLACL--GGELAVSSDDIFWMK-QKEPGKTLVVGASYVALECAGFLKGM-GYAVKVM-V  338
             +   L   G L   SD + W      P + +VVGA  + +E A  +  + G  V V+  
Sbjct  207  ARHPDLEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDG  266

Query  339  RSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET  398
            R  +L   D++++  +  YM  Q G  F+ +     +   D  +++V   +  G      
Sbjct  267  RKEILDMADKEVSDALCYYMR-QRGSRFLTEESILKVETKDDSEVVVHLTS--GKVI--M  321

Query  399  FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTP  457
             D +L   GR  +VA L L+  G+  N K G + VNN  QT  P++YA GD I  P L  
Sbjct  322  GDALLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALAS  380

Query  458  VAIQAGRLLSRRLY-NEGTVQMDYDK-----------------ICTAVFTPIEYGCCGLS  499
             +++ GRL S  +  +E T ++  D                      ++T  E    G S
Sbjct  381  TSMEQGRLASVHMRTSEPTNKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMVGKS  440

Query  500  EEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC------YVKVV-CDKTRNNFVL  552
            E+   +E             +P E  +A    +A          ++K++ C  T    +L
Sbjct  441  EQQLSKEN------------IPYEVGIARYEELAKGQMLGGMPGFLKLIFCPTTLK--LL  486

Query  553  GFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            G H +G  A E+     + M  G T +   + V  +P
Sbjct  487  GVHAIGEGATEIIHIGQVVMSTGGTMEYFRNAVFNYP  523

>PHYCA_504445
Length=548

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 133/550 (24%), Positives = 224/550 (41%), Gaps = 74/550 (13%)

Query  87   REDGETLDGTAPMDDTASASELNESRTPPI---VVEDDASYDYDLVVIGGGSGGLACSKE  143
            R    +L  + P+   A+ S    +   P+   + E  AS  +DL+VIG G  G  C+ +
Sbjct  4    RRAVSSLRPSRPLLRAAAFSTEAPAENKPLTDALRELRASEHFDLIVIGSGPAGQKCAID  63

Query  144  AASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWN  203
            +A  GK V ++D            +GG CV+ G +P K   +++L      H     G  
Sbjct  64   SAKSGKSVAIID--------KRDMMGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGHG  115

Query  204  VGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFV--DPHTLK-L  260
                 G    F  + ++  V     + +   + +L    V+  N    F+  + H +  L
Sbjct  116  -----GPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLINGTARFLPGNNHMVAVL  170

Query  261  WHPKKGTKEITTRH--------------VVIAVGGRP--RQLACLGGELAVSSDDIFWMK  304
             +    T     RH               ++ VG RP  R      GE    SD + W K
Sbjct  171  SNESYETATDAQRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGK  230

Query  305  QKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQ  361
             K  P + ++VGA  V +E A  +  + G  V V+  R  +L   D++++  +  Y   Q
Sbjct  231  VKTVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQ  289

Query  362  SGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAG  421
            +G  F+     +S+ K   G++ V    E G       D +L   GR  +V  L L+  G
Sbjct  290  TGTRFLTGETIKSVEKTAKGEVFVHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVG  345

Query  422  VKLNEKTGRIWV-NNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM--  478
            ++  +K GRI V NN QT  P++YA GD+I  P L   +++ GRL S  +    T+    
Sbjct  346  LE-PDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKTLNTKE  404

Query  479  --------DYDKICT----------AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  520
                    D D++ T           ++T  E    G +E+   +E      +V ++   
Sbjct  405  LSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKE------QVPYEVGK  458

Query  521  PLEWSLAEQTRIAAESCYVKVV-CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYD  579
                 LA    +     ++K++ C +T    +LG H +G  A E+     + M  G   +
Sbjct  459  ARYEELARGQMLGGVPGFLKIIFCPETLK--ILGVHAIGEGATEIIHIGQVVMSTGGDLE  516

Query  580  QLVDTVGIHP  589
               + V  +P
Sbjct  517  YFRNAVFNYP  526

>PYAP_19280
Length=512

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 121/493 (25%), Positives = 214/493 (43%), Gaps = 64/493 (13%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVVIG G     C+ E+A  GK+V V+D       G+S  +GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE  81

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++ +V      +  K++V +            K +L++ +V 
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDS-------EVDVIKAQLKAARVD  134

Query  245  YENVLGSFVDPHTLKLWH-------PKKGTKEITTR----HVVIAVGGRPRQ--LACLGG  291
            Y      F + H + +          ++    + TR      +IA G RP    L  + G
Sbjct  135  YIPGFARFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPIDG  194

Query  292  ELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQ  348
            ++   SD I     +E P   +VVGA  + +E A  L  + G++V V+  R  +L   D 
Sbjct  195  KVVFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCDN  254

Query  349  DMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGR  408
            ++ S +   M ++ G  F+   + +SI K++     VK +   G     + D +L   GR
Sbjct  255  EVVSMLQHEMRVK-GARFL---LGESIQKVEKTAKGVKVLLNSGKV--TSADALLYTVGR  308

Query  409  DPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLS  467
              +   L ++  G+  N++ G + VN   QT   ++YA+GD I AP L   +++ GRL +
Sbjct  309  QANTDGLNIEAVGLSRNQR-GLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAA  367

Query  468  RRLYNE----GTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLE  523
              +++      T Q++       ++T  E    G +E+    E             V  E
Sbjct  368  CHMWDGNCDIATSQLENGNYPYGIYTIPEISMVGKTEQQLTAEK------------VNYE  415

Query  524  WSLAEQTRIA-------AESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGF  576
              +A+ + +A       + +  +K++ D        G H +G  A E+     +A+ +G 
Sbjct  416  IGIAKYSELAKGQMGGGSHNGILKILFDPDTLKL-HGVHAIGEGATEIIHIGQVAIAMGC  474

Query  577  TYDQLVDTVGIHP  589
            +     D V  +P
Sbjct  475  SLTYFRDAVFNYP  487

>CCI39993
Length=550

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 131/515 (25%), Positives = 215/515 (42%), Gaps = 79/515 (15%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            AS  YDL+VIG G  G  C+ ++A  GK V ++D  K   H      GG CV+ G +P K
Sbjct  41   ASEHYDLIVIGSGPAGQKCAIDSAKHGKSVAIID--KNEMH------GGVCVHTGTVPSK  92

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               ++ L   +  H   +F   + S   +   F  + +++ V     + +   + +L   
Sbjct  93   TFREAIL--HLTAHRHRNFYTGLSSPKKR---FGIEDILTRVRKVENAETDITRHQLVRN  147

Query  242  QVKYENVLGSFV-DPHTLKLW----HPKKGTKEI-------------TTRHVVIAVGGRP  283
             V+  N    F+ DP    L+    H K+   EI             T    +IAVG RP
Sbjct  148  NVELINGTARFLPDPSKKMLYYQIAHLKQQRMEIAIFELIFVNGKILTADKFLIAVGTRP  207

Query  284  --RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGMGYAVKVMV--  338
              R      G++   SD I W   K  P + +VVGA  + +E A  +  +  A   ++  
Sbjct  208  ARRDDIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDG  267

Query  339  RSILLRGFDQDMASKIGEYMEMQSGIEF-IRKTVP--------QSITKLDSGQLLVKWIT  389
            R  +L   D+++   +  Y   Q+G  F + +T+         + I  L+SG+ +V    
Sbjct  268  RKEILEMADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNKDEVIIHLNSGKTIVG---  323

Query  390  EDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGD  448
                      D +L   GR  +   L L   G++  +K G I VN N QT+ P++YA GD
Sbjct  324  ----------DGLLYTVGRQGNTEGLDLSAIGLQ-TDKRGLIKVNENFQTSVPHIYAAGD  372

Query  449  VIDAPELTPVAIQAGRLLSRRL----------YNEGT-VQMDYDKICTAVFTPIEYGCCG  497
                P L   +++ GRL S  +          + E T  Q    ++ +  F P  +G   
Sbjct  373  CTGFPALASTSMEQGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGDFFP--FGIYT  430

Query  498  LSEED--SKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV-CDKTRNNFVLGF  554
            + E     K EY      + ++  V     LA+   +     ++K++ C  T N  +LG 
Sbjct  431  VPEISMVGKNEYQLTKEGIAYEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN--ILGV  488

Query  555  HYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            H +G  A E+     + M  G T +   + V  +P
Sbjct  489  HAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  523

>PHALS_12028
Length=579

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 103/369 (28%), Positives = 161/369 (44%), Gaps = 42/369 (11%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            AS  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G IP K
Sbjct  32   ASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTIPSK  83

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               +++L      H     G       G    F  + ++  V     + +   + +L   
Sbjct  84   TFREAALHLTGYRHKAFYNGQG-----GPSKRFGVEDILQRVKKVESAETDITRHQLLRN  138

Query  242  QVKYENVLGSFV--DPHTLK-LWHPKKGTKEITTRH--------------VVIAVGGRPR  284
             V+  N    F+    H +  L +    T     RH               ++ VG RP 
Sbjct  139  GVQLINGTARFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFLLCVGTRPA  198

Query  285  QLACL--GGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VR  339
            + A +   GE    SD + W K K  P + +VVGA  + +E A  +  + G  V V+  R
Sbjct  199  RRADIPFDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDAR  258

Query  340  SILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETF  399
              +L   D +++  +   M  Q+G  F+   V +S+ K   G++ V    E G       
Sbjct  259  KEILNMADNEVSEALCFSMA-QTGTRFLTGEVIKSVEKSAMGEVFVHL--ESGKTV--VG  313

Query  400  DTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-NNEQTTTPNVYAIGDVIDAPELTPV  458
            D +L   GR  +V  L L+  G+ + +K G+I V NN QT  P++YA GD+I  P L   
Sbjct  314  DGLLYTVGRQGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLAST  372

Query  459  AIQAGRLLS  467
            +++ GRL S
Sbjct  373  SMEQGRLAS  381

>PPTG_00938
Length=550

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 130/537 (24%), Positives = 214/537 (40%), Gaps = 80/537 (15%)

Query  97   APMDDTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDY  156
            AP ++      L E R         AS  +DL+VIG G  G  C+ ++A  GK V ++D 
Sbjct  28   APAENRPLTDTLRELR---------ASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID-  77

Query  157  VKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDW  216
                       LGG CV+ G +P K   +++L      H     G       G    F  
Sbjct  78   -------KRDMLGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQA-----GPSKRFGV  125

Query  217  KQLVSNVssyiksisfkykVELRSKQVKYENVLGSFV------------DPHTLKLWHPK  264
            + ++  V     + +   + +L    V+  N    F+            + +       +
Sbjct  126  EDILQRVRKVENAETDITRHQLLRNGVQLINGTARFLPGSKNMVAVLSNESYETATDAKR  185

Query  265  KGTKEITTR-----HVVIAVGGRP--RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGA  316
              + +I  R       ++ VG RP  R      GE    SD++ W K K  P + ++VGA
Sbjct  186  HSSADICKRVLTADKFLVCVGTRPARRPDIPFDGETIFDSDELLWGKVKSVPRRLIIVGA  245

Query  317  SYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQS  374
              V +E A  +  + G  V V+  R  +L   D+ ++  +  Y   Q+G  F+     +S
Sbjct  246  GVVGMEYASMMTIIPGTDVTVIDGRQEILNMADKQVSEALC-YSMTQTGTRFLTGETIKS  304

Query  375  ITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-  433
            + K   G++ V    E G       D +L   GR  +V  L L+  G+   +K GRI V 
Sbjct  305  VEKSPKGEVFVHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLS-PDKRGRIKVD  359

Query  434  NNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQ----------MDYDKI  483
            NN QT  P++YA GD+I  P L   +++ GRL S  +     +            D D++
Sbjct  360  NNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRV  419

Query  484  CT----------AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIA  533
             T           ++T  E    G +E+   +E      +V ++  V     LA    + 
Sbjct  420  RTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKE------QVPYEVGVARYEELARGQMLG  473

Query  534  AESCYVKVV-CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                ++K++ C  T   F  G H +G  A E+     + M  G T +   + V  +P
Sbjct  474  GVPGFLKIIFCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  528

>SPRG_12054
Length=558

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 127/520 (24%), Positives = 211/520 (41%), Gaps = 85/520 (16%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            AS  +DLVVIG G  G  C+ ++A  GKKV ++D  K   HG      G CV+ G IP K
Sbjct  45   ASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIID--KKDMHG------GVCVHTGTIPSK  96

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               ++ L   +  H    F  N  S          + ++  V     +     + +L   
Sbjct  97   TFREAVL--HLTAHRHKGFYGNAYSATSG-KRMSIQDILDRVQKVESAEMDLTRNQLLRN  153

Query  242  QVKYENVLGSFV---DPHTLKLWHPKKGT---------------KEITTRHVVIAVGGRP  283
             +   N    F+   D  T+ +      T               + +T    +I+VG RP
Sbjct  154  GIYLINGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRP  213

Query  284  RQLACLG--GELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-V  338
             +   +   GEL   SD + W      P + +VVGA  + +E A  +  + G  V V+  
Sbjct  214  ARHPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDG  273

Query  339  RSILLRGFDQDMASKI-------GEYMEMQSGIEFIRKTVPQS--ITKLDSGQLLVKWIT  389
            R  +L   D++++  +       G     +  I+F+ K + +   +  L SG+++V    
Sbjct  274  RKEILEMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG---  330

Query  390  EDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGD  448
                      D +L   GR  +V  L L+  G++ N + G + VNN  QT+ P++YA GD
Sbjct  331  ----------DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGD  379

Query  449  VIDAPELTPVAIQAGRLLSRRLYNE---GTVQMDYDKICTA---------------VFTP  490
             I  P L  V+++ GRL S  +         + D D   T+               ++T 
Sbjct  380  CIGYPALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTV  439

Query  491  IEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV-CDKTRNN  549
             E    G SE+   +E       V ++  V     LA+   +     ++K++ C  T   
Sbjct  440  PEISMVGKSEQQLTKE------NVPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK-  492

Query  550  FVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             +LG H +G  A E+     + M  G T +   + V  +P
Sbjct  493  -LLGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  531

>SDRG_05060
Length=559

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 125/520 (24%), Positives = 214/520 (41%), Gaps = 85/520 (16%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            AS  +DLVVIG G  G  C+ ++A  GKKV ++D  K   HG      G CV+ G IP K
Sbjct  46   ASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIID--KKDMHG------GVCVHTGTIPSK  97

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               ++ ++    H     +G    + +G+      + ++  V     +     + +L   
Sbjct  98   TFREA-VLHLTAHRHKGFYGNAYSATSGK--RMSIQDILDRVQKVESAEMDLTRNQLLRN  154

Query  242  QVKYENVLGSFV---DPHTLKLWHPKKGT---------------KEITTRHVVIAVGGRP  283
             +   N    F+   D  T+ +      T               + +T    +I+VG RP
Sbjct  155  GIYLINGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRP  214

Query  284  RQLACLG--GELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-V  338
             +   +   GEL   SD + W      P + +VVGA  + +E A  +  + G  V V+  
Sbjct  215  ARHPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDG  274

Query  339  RSILLRGFDQDMASKI-------GEYMEMQSGIEFIRKTVPQS--ITKLDSGQLLVKWIT  389
            R  +L   D++++  +       G     +  I+F+ K + +   +  L SG+++V    
Sbjct  275  RKEILEMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG---  331

Query  390  EDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGD  448
                      D +L   GR  +V  L L+  G++ N + G + VNN  QT+ P++YA GD
Sbjct  332  ----------DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGD  380

Query  449  VIDAPELTPVAIQAGRLLSRRLYNE---GTVQMDYDKICTA---------------VFTP  490
             I  P L  V+++ GRL S  +         + D D   T+               ++T 
Sbjct  381  CIGYPALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTV  440

Query  491  IEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV-CDKTRNN  549
             E    G SE+   +E       V ++  V     LA+   +     ++K++ C  T   
Sbjct  441  PEISMVGKSEQQLTKE------NVPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK-  493

Query  550  FVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             +LG H +G  A E+     + M  G T +   + V  +P
Sbjct  494  -LLGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  532

>PYU1_G011605
Length=524

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 122/496 (25%), Positives = 209/496 (42%), Gaps = 67/496 (14%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            DYDLVVIG G     C+ E+A  GK+V ++D            +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFR  91

Query  185  QSSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
            ++ L +    HH      +++ +V      +  K++V++            K +L++ +V
Sbjct  92   EAVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNS-------EVDVIKAQLKAARV  144

Query  244  KYENVLGSFVDPHTLKLWH-PKKGTK----EITTR-------HVVIAVGGRPRQ--LACL  289
            +Y      F + H + +   P+ G      EIT           +IA G RP       +
Sbjct  145  EYIPGFARFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPI  204

Query  290  GGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGF  346
             G++   SD I     ++ P   +VVGA  + +E A  L  + G++V V+  R  +L   
Sbjct  205  DGKVIFDSDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFC  264

Query  347  DQDMASKIGEYMEMQS-GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNA  405
            D ++ S +    EM+S G  F+       + K  +G   V      G     + D +L  
Sbjct  265  DNEIISNL--TYEMRSKGARFLLGETINRVEKTGNG---VTVYLNSGKV--TSADAMLYT  317

Query  406  TGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGR  464
             GR      L L+   +  N + G + VN   QT  P++YA+GD I AP L   +++ GR
Sbjct  318  VGRQASTDGLNLEAVNLSRNPR-GLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGR  376

Query  465  LLSRRLYNEG----TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  520
            L +  ++++     T Q++       ++T  E    G +E+   +E             V
Sbjct  377  LAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKE------------GV  424

Query  521  PLEWSLAEQTRIA-------AESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMK  573
              E  +A+ + +A            +K++ D T      G H +G  A E+     +A+ 
Sbjct  425  NFEIGIAKYSELAKGQMSGSTAGGMLKILFDPTTLKL-FGVHAIGEGATEIIHIGQVAIA  483

Query  574  LGFTYDQLVDTVGIHP  589
            +G +     D V  +P
Sbjct  484  MGCSVTYFRDAVFNYP  499

>H257_16541
Length=494

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 118/443 (27%), Positives = 194/443 (44%), Gaps = 51/443 (12%)

Query  168  LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
            LGGTC+NVGCIP K +   + +     H+  S G  V +V     + D+ QL+ +    +
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHSAQHNFKSVGIKVDNV-----SIDFDQLMKSKDKTV  116

Query  228  ksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----  282
            K ++   +   +  +V Y    G  V    + +     G + + T++++IA G       
Sbjct  117  KILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVALNAGGNQTVNTKNILIATGSEVTPLP  176

Query  283  PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSIL  342
            P  +   GG++  S+  +    ++ P   +VVG   + LE       +G  + V+     
Sbjct  177  PVPVDNEGGKIIDSTGALAL--KRVPKHLVVVGGGVIGLEMGSVYGRLGSKITVV-----  229

Query  343  LRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETF---  399
                  + A KI   M+ +   EF +    Q +T    GQ  V     DGD    T    
Sbjct  230  ------EYADKICPTMDHEVTKEFQKLLTKQGMT-FKLGQ-KVTASKVDGDVVTLTVEPA  281

Query  400  ----------DTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN--NEQTTTPNVYAIG  447
                      D VL ATGR P  A LGL+E G++  +K GRI VN  N QT    ++AIG
Sbjct  282  AGGEATTIEADCVLVATGRRPFTAGLGLEEMGIQ-TDKFGRIKVNLSNFQTNVDGIFAIG  340

Query  448  DVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEY  507
            DVI+   L   A + G  +   +  +    ++YD I   ++T  E    G +EE+ K   
Sbjct  341  DVIEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAIPGVIYTFPEVASVGKTEEELK---  396

Query  508  GDDSVEVYHKNFVPLEWSLAEQTRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQ  566
               +   Y+    P+  +   + R   E+  +VKV+  K  ++ +LG H +  NAGE+  
Sbjct  397  --TANVAYNVGKFPMMAN--SRARAVGETDGFVKVLAAKD-DDKILGIHIIASNAGEMIS  451

Query  567  AMGLAMKLGFTYDQLVDTVGIHP  589
               L ++ G + + +  T   HP
Sbjct  452  EGVLGIEYGASAEDIGRTCHAHP  474

>H257_07450
Length=567

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 105/387 (27%), Positives = 172/387 (44%), Gaps = 40/387 (10%)

Query  105  ASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGT  164
            ++E+  S    ++    AS  +DLVVIG G  G  C+ ++A  GKKV ++D  K   HG 
Sbjct  18   SAEVKPSDFSEVLRNLRASEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIID--KKDMHG-  74

Query  165  SWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVs  224
                 G CV+ G IP K   ++ L   +  H    F  N  + +        ++++  V 
Sbjct  75   -----GVCVHTGTIPSKTFREAVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVK  127

Query  225  syiksisfkykVELRSKQVKYENVLGSFV---DPHTLKLWHPKKGTKE------------  269
                + +   + +L    +   N    F+   D  T+ +      T++            
Sbjct  128  KVEDAETDLTRNQLTRNGIILINGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANIC  187

Query  270  ---ITTRHVVIAVGGRPRQLACLG--GELAVSSDDIFWMK-QKEPGKTLVVGASYVALEC  323
               +T   V+IAVG RP +   L   G L   SD + W      P + +VVGA  + +E 
Sbjct  188  KRVLTADKVLIAVGTRPARRPDLDYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEY  247

Query  324  AGFLKGM-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSG  381
            A  +  + G  V V+  R  +L   D++++  +  YM  + G  F+ +     +   D+ 
Sbjct  248  ASMISIIPGTQVTVIDGRKEILDMADKEVSDALCYYMR-KRGSRFLTEESIVKVETKDNS  306

Query  382  QLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTT  440
            ++LV ++T  G       D +L   GR  +VA L L+  G+  N K G + VNN  QT  
Sbjct  307  EVLV-YLT-SGKVI--VGDALLYTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDV  361

Query  441  PNVYAIGDVIDAPELTPVAIQAGRLLS  467
            P++YA GD I  P L   +++ GRL S
Sbjct  362  PHIYAAGDCIGYPALASTSMEQGRLAS  388

>PYIW_19795
Length=519

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 121/495 (24%), Positives = 210/495 (42%), Gaps = 68/495 (14%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVVIG G     C+ E+A  GK+V V+D            +GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFRE  88

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++ +V      +  K++V++            K +L++ +V+
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNS-------EVDVIKAQLKAARVE  141

Query  245  YENVLGSFVDPHTLKLWHPKKGTKE--------ITTRHV---VIAVGGRPRQ--LACLGG  291
            Y   L  F   H + +       +         ++  H    +IA G RP    L  + G
Sbjct  142  YIPGLARFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDG  201

Query  292  ELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQ  348
            ++   SD I     +E P   +VVGA  + +E A  L  + G++V V+  R  +L   D 
Sbjct  202  KVIFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDN  261

Query  349  DMASKIGEYMEMQS-GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFE------ETFDT  401
            ++ S +    EM+S G  F+     + + K           TEDG           T D 
Sbjct  262  EIISNL--TYEMRSKGARFLLGETIKQVEK-----------TEDGVTVHFNSGKTATADA  308

Query  402  VLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAI  460
            +L   GR      L L+   +  N + G + VN   QT   ++YA GD I AP L   ++
Sbjct  309  LLYTVGRQASTDGLNLEAVNLARNPR-GLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSM  367

Query  461  QAGRLLSRRLYNEG----TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYH  516
            + GRL +  ++++     T Q++       ++T  E    G +E+   +E  +  + +  
Sbjct  368  EQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGANYEIGI--  425

Query  517  KNFVPLEWSLAEQTRIAAESC--YVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKL  574
                  ++S   + +++  +    +K++ D T     LG H +G  A E+     +AM +
Sbjct  426  -----AKYSELAKGQMSGSTAGGMLKILFDPTTLKL-LGVHAIGEGATEIIHIGQVAMAM  479

Query  575  GFTYDQLVDTVGIHP  589
            G +     D V  +P
Sbjct  480  GCSVTYFRDAVFNYP  494

>PITG_18935
Length=480

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 126/481 (26%), Positives = 210/481 (44%), Gaps = 59/481 (12%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  26   SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
             +  S+ +     HD  S+G +   V    P     Q++ +    +K+++   ++  +  
Sbjct  78   ALLHSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKSKEKAVKTLTGGIELLFKKN  132

Query  242  QVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAV  295
            +V Y    G       + +  +  KG + +  ++++IA G       P  +    G++  
Sbjct  133  KVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIID  192

Query  296  SSDDIFWMKQKE---PGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMAS  352
            S+  +   +  E        V    ++   C G  K    AVK   + +  +G D    +
Sbjct  193  STGALELKRVPEHLVVVGAGVTVVEFLDAACPGSDK---EAVKEFTKLLKKQGLDFQFNT  249

Query  353  KIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE---DGDCFEETFDTVLNATGRD  409
            K                     +T  +    +VK  TE    GD      DTVL ATGR 
Sbjct  250  K---------------------VTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRR  288

Query  410  PDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSR  468
               + LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L   A + G     
Sbjct  289  AFTSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVE  347

Query  469  RLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAE  528
             +  +    ++Y  I   ++T  E+   G +EE+ K E     +E Y+    P+  +   
Sbjct  348  NIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YNVGKFPMMANSRA  401

Query  529  QTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIH  588
            +T IA     VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   H
Sbjct  402  RT-IAEADGLVKVLADK-KTDKLLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAH  459

Query  589  P  589
            P
Sbjct  460  P  460

>SDRG_14446
Length=495

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 118/477 (25%), Positives = 205/477 (43%), Gaps = 43/477 (9%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            +YDLVVIG G   + C+ E+   GK V V+D           G+GG CV+ G IP K   
Sbjct  28   EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  79

Query  185  QSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            +S L      H    +G +    N          ++  V++ +       + +L++ +V 
Sbjct  80   ESVLHLSGFRHQ-GFYGKSYARDN-----ITLNDILGRVNTVVSKEMDVIQAQLKAARVD  133

Query  245  YENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQ--LACLGGELAVSSDDIFW  302
                L  F + + + +         +  +  ++A G RP    L    G++ + SD I  
Sbjct  134  LVPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGKVILDSDQILN  193

Query  303  M-KQKEPGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQDMASKIGEYME  359
                K P   +VVGA  + +E A  L  + G  V V+  R+ +L   D ++ S +   ME
Sbjct  194  HGTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSL--KME  251

Query  360  MQ-SGIEFIRKTVPQSITKLDSGQLLVKWITEDGDC-FEETFDTVLNATGRDPDVAKLGL  417
            M+  G  F+     +S+    +G   VK     G   F E     L   GR  +   L L
Sbjct  252  MRHKGARFLLGESIKSVEHFKNG---VKVEFNSGKAMFAEAL---LYCVGRQANTDGLNL  305

Query  418  DEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY---NE  473
            +  G+  N + G I VN + QT+ P++YA GD I AP L   +++ GRL +  ++   ++
Sbjct  306  EAVGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQ  364

Query  474  GTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIA  533
             T Q++       ++T  E    G +E+   +E  + +V +        ++S   + +++
Sbjct  365  TTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGANYAVGLA-------KFSELAKGQMS  417

Query  534  AE-SCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             +    +K++ D       LG H +G  A E+     +AM +        D V  +P
Sbjct  418  GDIEGILKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKLTYFRDAVFNYP  473

>PHYCA_555180
Length=521

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 123/506 (24%), Positives = 208/506 (41%), Gaps = 81/506 (16%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  31   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  82

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++ +V  +   +  +++VS+    +++     +V++     +
Sbjct  83   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFAR  142

Query  245  YEN----------------------VLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR  282
            +EN                        GS  +  +L   H  K          +IA G R
Sbjct  143  FENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADK---------FLIACGTR  193

Query  283  PRQ--LACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-  337
            P    L  + G++ + SD I      + P   +V+GA  + +E A  +  + G++V V+ 
Sbjct  194  PAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVD  253

Query  338  VRSILLRGFDQDMASKIGEYMEMQS-GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFE  396
             R  +L   D+++ S +    EMQS G  F+     + +   D     VK   + G    
Sbjct  254  GRPDILSFCDREIISNL--TYEMQSNGARFLLGETVKKVEVTDR----VKVFFDSGKVL-  306

Query  397  ETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAPEL  455
             + D +L   GR      L L+  G+  N + G I VN N QT  P++YA GD I AP L
Sbjct  307  -SADALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPAL  364

Query  456  TPVAIQAGRLLSRRLYNEG-----TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDD  510
               +++ GRL S  ++N       T Q++       ++T  E    G +E+         
Sbjct  365  ASTSMEQGRLASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQ--------  416

Query  511  SVEVYHKNFVPLEWSLAEQTRIAAESCY-------VKVVCDKTRNNFVLGFHYLGPNAGE  563
                  K  +  E  +A+ + +A            +K++ D      V G H +G  A E
Sbjct  417  ----LTKACINYEIGVAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATE  471

Query  564  VTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +     +AM +  +     D V  +P
Sbjct  472  IIHIGQVAMAMDCSLTYFRDAVFNYP  497

>PYIW_20257
Length=503

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 100/367 (27%), Positives = 154/367 (42%), Gaps = 74/367 (20%)

Query  116  IVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNV  175
            ++ E  AS  +DL+VIG G  G  C+ + A  GK V V+D            LGG C++ 
Sbjct  40   MLRELKASEHFDLIVIGSGPAGQKCAIDHAKHGKTVAVID--------KRDMLGGVCIHT  91

Query  176  GCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkyk  235
            G +P K   +++L      H     G +  +                             
Sbjct  92   GTVPSKTFREATLHLTAYRHRSFYEGQSTPA-----------------------------  122

Query  236  VELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKE-ITTRHV---VIAVGGRP--RQLACL  289
                 K+   E++L        +K  H + G +  +  RH+   +IAVG RP  R     
Sbjct  123  -----KRFGIEDIL------QRVKKLHDRHGRQTPLERRHLQAFLIAVGTRPARRPDIPF  171

Query  290  GGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLK---GMGYAVKVMVRSILLRG  345
             GE    SD + W   K  P + +VVGA  + +E A  +    GM   +    R IL   
Sbjct  172  DGETIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREIL---  228

Query  346  FDQDMASK-IGE---YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDT  401
               DMA + + E   Y   Q+G  F  +   +S+ K D+G+++V      G       D 
Sbjct  229  ---DMADREVSEALCYSMRQTGARFFVEETIKSVEKADNGEVIVHL--NSGKTL--VGDG  281

Query  402  VLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAI  460
            +L   GR  +   L L+  G+K  +K G I V+++ QT  P++YA GD I  P L   ++
Sbjct  282  LLYTLGRQGNTEGLNLEAIGLK-ADKRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSM  340

Query  461  QAGRLLS  467
            + GRL S
Sbjct  341  EQGRLAS  347

>CCA14030
Length=560

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 123/518 (24%), Positives = 206/518 (40%), Gaps = 85/518 (16%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            AS  YDL+V+G G  G  C+ ++A  GK V ++D  K   HG      G CV+ G +P K
Sbjct  51   ASEHYDLIVVGSGPAGQKCAIDSAKHGKSVAIID--KNEMHG------GVCVHTGTVPSK  102

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               ++ L   +  H   +F   + S   +   F  + +++ V     + +   + +L   
Sbjct  103  TFREAIL--HLTAHRHRNFYTGMSSPKKR---FGIEDILTRVRKVENAETDITRHQLVRN  157

Query  242  QVKYENVLGSFV-DPHTLKLWHPKKGTKEITT---RHV--------------VIAVGGRP  283
             V+  N    F+ DP    +      + E  T   RH               +IAVG RP
Sbjct  158  NVELINGTARFLPDPSKNMVAVLSNSSYETATDGNRHFRANICQRILTADKFLIAVGTRP  217

Query  284  --RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGMGYAVKVMV--  338
              R      G++   SD I W   K  P + +VVGA  + +E A  +  +  A   ++  
Sbjct  218  ARRDDVVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDG  277

Query  339  RSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVP--------QSITKLDSGQLLVKWITE  390
            R  +L   D+++   +   M       ++ +T+         + IT L+SG+ +V     
Sbjct  278  RKEILEMADREVVEALTYAMRQTGSRFYMEETIKCVELSNKDEVITHLNSGKTVVG----  333

Query  391  DGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDV  449
                     D +L   GR  +   L L   G++  +K G I VN N QT+ P++YA GD 
Sbjct  334  ---------DGLLYTVGRQGNTEGLDLSAIGLE-TDKRGLIKVNENFQTSVPHIYAAGDC  383

Query  450  IDAPELTPVAIQAGRLLSRRLYNE-----------------GTVQMDYDKICTAVFTPIE  492
               P L   +++ GRL S  +                     T     D     ++T  E
Sbjct  384  TGFPALASTSMEQGRLASVHMRTSMPTNTTGHAEPTDPQHMRTRMRSGDFFPFGIYTVPE  443

Query  493  YGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV-CDKTRNNFV  551
                G +E    +E       + ++  V     LA+   +     ++K++ C  T N  +
Sbjct  444  ISMVGKNEHQLTKE------GIAYEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN--I  495

Query  552  LGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            LG H +G  A E+     + M  G T +   + V  +P
Sbjct  496  LGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  533

>PYU1_G005699
Length=550

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 131/519 (25%), Positives = 212/519 (41%), Gaps = 76/519 (15%)

Query  116  IVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNV  175
            ++ E  AS  +DL+VIG G  G  C+ ++A  GK V ++D  K   HG      G CV+ 
Sbjct  40   MLRELKASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--KRDMHG------GVCVHT  91

Query  176  GCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkyk  235
            G +P K   +++L      H   SF     S   +    D  Q V  V      I+    
Sbjct  92   GTVPSKTFREATLHLTAYRHR--SFYDGQSSPTKRFGIEDILQRVKKVEHAETDITRHQL  149

Query  236  ----VELRSKQVKY-----ENVLGSFV-DPHTLKLWHPKKGTKEITTR-----HVVIAVG  280
                VEL +   ++     +N++     D +T      +  + +I  R       +IAVG
Sbjct  150  LRNGVELINGTARFLPDANKNMIAVLSNDSYTTATDAKRHASADICKRVLTADKFLIAVG  209

Query  281  GRP--RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKV  336
             RP  R      G+    SD + W   K  P + +VVGA  + +E A  +  + G  V +
Sbjct  210  TRPARRPDIPFDGQAVFDSDQLLWGGVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTI  269

Query  337  M-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCF  395
            +  R  +L   D++++  +  Y   Q+G  F  +   +S+ K++ G+++V      G   
Sbjct  270  IDGRKEILDMADREVSEALC-YSMRQTGARFFVEETIKSVEKVN-GEVIVHL--NSGKTL  325

Query  396  EETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAPE  454
                D +L   GR  +   L L   G++  +K G I V+ N QT  P++YA GD I  P 
Sbjct  326  --VGDGLLYTLGRQGNTDGLNLPAVGLE-ADKRGLIQVDENFQTAVPHIYAAGDCIGFPA  382

Query  455  LTPVAIQAGRLLSRRLYNEGTVQMDYDKICT-----------------AVFTPIEYGCCG  497
            L   +++ GRL S  +  E       D   T                  ++T  E    G
Sbjct  383  LASTSMEQGRLASVHMRTEKPTNKTGDSESTDPQFMRTRMRSGDVFPFGIYTVPEISMVG  442

Query  498  LSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC------YVKVV-CDKTRNNF  550
             +E+   +E             VP E  LA    +A          ++K++ C KT    
Sbjct  443  KNEQQLTKEN------------VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPKTLQ--  488

Query  551  VLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +LG H +G  A E+     + M  G T +   + V  +P
Sbjct  489  LLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYP  527

>PHYKE_9807
Length=557

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 133/547 (24%), Positives = 222/547 (41%), Gaps = 101/547 (18%)

Query  97   APMDDTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDY  156
            AP++ +     L E R         AS  +DL+VIG G  G  C+ ++A  GK V ++D 
Sbjct  36   APVEKSVLVDTLRELR---------ASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIVD-  85

Query  157  VKPSPHGTSWGLGGTCVNVGCIPKKL-MHQSSLIGEILHHDCASFGWNVGSVNGQVPTFD  215
                       LGG CV+ G   ++  MH +        +   +F    G ++ ++   D
Sbjct  86   -------KRDMLGGVCVHTGTTFREAAMHLTG-------YRHRAFYNGHGGISKRIGVED  131

Query  216  WKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFV--DPHTLKLWH---------PK  264
              Q V  V +    I+     +L+   V+  +    F+  D H L +            K
Sbjct  132  ILQRVKKVEAAETDITRH---QLQRNGVQLISGTARFLAGDSHMLAVLSNEEYETATDAK  188

Query  265  KGT------KEITTRHVVIAVGGRPRQLACL--GGELAVSSDDIFWMKQKE-PGKTLVVG  315
            + T      + +T    ++ VG RP +   +   GE    SD + W K K  P + ++VG
Sbjct  189  RHTEADICKRVLTADKFLVCVGTRPARHPDIPFDGETIFDSDQLLWGKVKMVPRRLIIVG  248

Query  316  ASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQ  373
               V +E A  +  + G  V V+  R  +L   D++++  +  Y   Q+G  F+     +
Sbjct  249  GGVVGMEYASMMTIIPGTDVTVIDGRKEILNMADKEVSEALC-YSMAQTGTRFLVGETIK  307

Query  374  SITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV  433
             + K   G++LV+   + G       D +L   GR  +V  L L+  G+   +K GRI V
Sbjct  308  KVEKNSKGEVLVRL--DSGKTV--VGDGLLYTVGRQGNVEGLHLESVGIH-PDKRGRIKV  362

Query  434  -NNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM-------------D  479
             NN QT  P++YA GD+I  P L   +++ GRL S  +     V               D
Sbjct  363  DNNFQTEVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRTASPVATKPSKELPDDKLMDD  422

Query  480  YDKICT----------AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ  529
             D++ T           ++T  E    G +E+   +E             VP E  +A  
Sbjct  423  PDRMRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTQEQ------------VPYEVGMARY  470

Query  530  TRIAAESC------YVKVV-CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLV  582
              +A          ++K++ C  T    +LG H +G  A E+     + M  G T +   
Sbjct  471  EELARGQMLGGVPGFLKIIFCPNTLQ--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFR  528

Query  583  DTVGIHP  589
            + V  +P
Sbjct  529  NAVMNYP  535

>PYIR_14132
Length=513

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 120/513 (23%), Positives = 207/513 (40%), Gaps = 61/513 (12%)

Query  116  IVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNV  175
            ++ E  AS  +DL+VIG G  G  C+ + A  GK V V+D            LGG C++ 
Sbjct  1    MLRELKASEHFDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHT  52

Query  176  GCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkyk  235
            G +P K   +++L      H     G +          F  + ++  V     + +   +
Sbjct  53   GTVPSKTFREATLHLTAYRHRSFYDGQS-----NPTKRFGIEDILQRVKKVEHAETDITR  107

Query  236  VELRSKQVKYENVLGSFV-------------DPHTLKLWHPKKGTKEITTR-----HVVI  277
             +L    ++  N    F+             D +T      +  + +I  R       +I
Sbjct  108  HQLLRNNIELINGTARFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLI  167

Query  278  AVGGRP--RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYA  333
            AVG RP  R      G+    SD + W   K  P + +VVGA  + +E A  +  + G  
Sbjct  168  AVGTRPARRPDIPFDGQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGME  227

Query  334  VKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDG  392
            V ++  R  +L   D++++  +  Y   Q+G  F  +   +S+ K D+G+++V      G
Sbjct  228  VTIIDGRKEILDMADREVSEALC-YSMRQTGARFFVEETIKSVEKADNGEVIVHL--NSG  284

Query  393  DCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVID  451
                   D +L   GR  +   L L   G++ + K G I V+++ QT  P++YA GD I 
Sbjct  285  KTL--VGDGLLYTLGRQGNTEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIG  341

Query  452  APELTPVAIQAGRLLSRRLYN--------EGTVQMDYDKICTAVFTPIEYGCCGLSEEDS  503
             P L   +++ GRL S  +          E   +    +         E    G+     
Sbjct  342  FPALASTSMEQGRLASVHMRTSKPTNKKGESETESTDPQYMRTRMRSGEVFPFGIYTVPE  401

Query  504  KEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC------YVKVV-CDKTRNNFVLGFHY  556
                G +  ++  +N +P E  +A    +A          ++K++ C KT    VLG H 
Sbjct  402  ISMVGKNEQQLTSQN-IPYEVGVARYEELAKGQMLGGVPGFLKIIFCPKTLQ--VLGVHA  458

Query  557  LGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +G  A E+     + M  G T +   + V  +P
Sbjct  459  IGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYP  491

>PYIW_25190
Length=206

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 88/177 (50%), Gaps = 5/177 (3%)

Query  415  LGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLYN-  472
            LGL+  GVKLN+    +    E T+   +YAIGD  I   ELTPVAI AGR L+ RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  473  EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRI  532
            E    + Y +I T VF+    G  G +E  + E++G  +V+ Y   FV L  ++A+    
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMADPDHK  121

Query  533  AAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                  +K+V        V   H  G  A E+ Q  G+AMK+  T     + V IHP
Sbjct  122  G--KTAMKLVTVGEDEVVVG-VHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHP  175

>PYIW_24688
Length=259

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 130/261 (50%), Gaps = 25/261 (10%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD + IGGGSGG+A ++ AA+FG KV V++  +   +G + GLGGTCV+ GC+PKK+M  
Sbjct  7    YDYISIGGGSGGMASARRAATFGAKVLVVE--RGRKYGGA-GLGGTCVHYGCVPKKIMFN  63

Query  186  SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
            ++   E L+          G+   Q   FDW  + +   +YI  ++  Y+  L + QV  
Sbjct  64   AATHVEHLNRAADYSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYERNLGNAQVDL  123

Query  246  ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
               +   V  + +++          T +H+++AVGG+P               D F+  +
Sbjct  124  VEGVAKLVAKNQVEV-----DGVVYTGKHILVAVGGKP---------------DGFFKLE  163

Query  306  KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
             +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   I E  E ++GI
Sbjct  164  AQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE-KAGI  222

Query  365  EFIRKTVPQSITKLDSGQLLV  385
             F+R +  + I K   G L +
Sbjct  223  NFVRNSRIERIEKQADGSLTI  243

>PYVX_23499
Length=519

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 129/525 (25%), Positives = 205/525 (39%), Gaps = 89/525 (17%)

Query  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
            E  AS  +DL+V+G G  G  C+ ++A  GK V ++D            LGG CV+ G +
Sbjct  8    ELKASEHFDLIVVGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTV  59

Query  179  PKKLMHQSSLIGEILHH----DCASFG----------WNVGSVNGQVPTFDWKQLVSNVs  224
            P K   +++L      H    D AS              V  V G        QL+ N  
Sbjct  60   PSKTFREATLHLTGYRHRAFYDSASVSSRRLEIDDILQRVHKVEGAETDITRHQLMRNNV  119

Query  225  syiksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEI-TTRHVVIAVGGRP  283
              I   +     E R+      N    +  P   K        K + T    +I VG RP
Sbjct  120  ELIHGTARFLPDEKRNMVAVLSN--AKYDTPTDAKRHTSADICKRVLTADKFLICVGTRP  177

Query  284  --RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-V  338
              R+     G+    SD + W   K  P + +VVGA  + +E A  +  + G  V V+  
Sbjct  178  ARREDIPFDGKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIPGTEVTVIDG  237

Query  339  RSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLV-----KWITEDGD  393
            R  +L   D++++  +  Y   Q+G  F  +   + + K ++G+++      K I  DG 
Sbjct  238  RKEILDMADKEVSESLC-YSMRQTGTRFYTEESIKKVEKRENGEVVAHLNSGKVIVGDG-  295

Query  394  CFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDA  452
                    +L   GR  +   L L   G++  +K G + VN++ QT  P++YA GD I  
Sbjct  296  --------LLYTLGRQGNTDGLNLQAVGLE-TDKRGFLNVNDDFQTEVPHIYAAGDCIGY  346

Query  453  PELTPVAIQAGRLLSRRLYNEGTVQM-----------DYDKI----------CTAVFTPI  491
            P L   +++ GRL S  +  E                D ++I             ++T  
Sbjct  347  PALASTSMEQGRLASVHMRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFPFGIYTIP  406

Query  492  EYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC------YVKVV-CD  544
            E    G +E+   +E             VP E  LA    +A          ++K++ C 
Sbjct  407  EISMVGKNEQQLTKEN------------VPYEVGLARYEELAKGQMLGGVPGFLKIIFCP  454

Query  545  KTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             T    VLG H +G  A E+     + M  G T +   + V  +P
Sbjct  455  DTLK--VLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYP  497

>HYAP_04149
Length=564

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 127/533 (24%), Positives = 221/533 (41%), Gaps = 74/533 (14%)

Query  107  ELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSW  166
            E N+      + E  AS  +DL+VIG G  G  C+ ++A  G  V ++D           
Sbjct  34   EANKQLLTETLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGYSVAIVD--------KRD  85

Query  167  GLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssy  226
             LGG CV+ G +P K   +++L   +  +   +F       + +V   D  Q V+ V   
Sbjct  86   MLGGVCVHTGTVPSKTFREAAL--HLTGYRHRAFYNGQAGPSKRVGVEDILQRVNKVEKA  143

Query  227  ----iksisfkykVELRSKQVKY----ENVLGSFVDPHTLKLWHPKKGT------KEITT  272
                 +    +  V+L +   ++     +++    +         K+ +      + +T 
Sbjct  144  ETDITRHQLMRNGVQLITGTARFMPGNSHMIAVLSNESYETATDAKRHSSANICKRVLTA  203

Query  273  RHVVIAVGGRPRQLACL--GGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKG  329
             + ++ VG RP + A +   GE    SD + W K K  P + +VVGA  V +E A  +  
Sbjct  204  DNFLVCVGTRPARRADIPFDGETIFDSDQLLWGKVKAVPRRLIVVGAGVVGMEYASMMSI  263

Query  330  M-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKW  387
            + G  V V+  R  +L   D++++  +  Y   Q+G  F+   V +S+ K   G++ V  
Sbjct  264  IPGTDVTVIDGRKEILEMADKEVSEALC-YSMAQTGTRFLVDEVIKSVEKSAKGEVGVHL  322

Query  388  ITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-NNEQTTTPNVYA-  445
              E G       D +L   GR  +V  L L+  G+   +K GRI V NN QT  P++YA 
Sbjct  323  --ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIIVDNNFQTAVPHMYAQ  377

Query  446  --------IGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM----------DYDKICT--  485
                     GD+I  P L   +++ GRL S  +    +             D D++ T  
Sbjct  378  SRLIADQNAGDIIGFPALASTSMEQGRLASVHMRTSKSFYTKEISDDKKMDDPDRVRTRM  437

Query  486  --------AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC  537
                     ++T  E    G +E+    E      +V ++  +     LA+   +     
Sbjct  438  RSGEVFPFGIYTVPEISMVGKNEQQLTRE------QVPYEVGIARYEELAKGQMLGGVPG  491

Query  538  YVKVV-CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            ++K++ C KT    +LG H +G  A E+     + M    T +   + V  +P
Sbjct  492  FLKIIFCPKTLK--LLGVHAIGEGATEIIHIGQVVMSTDGTLEYFRNAVFNYP  542

>PYAP_19148
Length=535

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 129/525 (25%), Positives = 209/525 (40%), Gaps = 81/525 (15%)

Query  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
            E  AS  +DL+VIG G  G  C+ + A  GK V ++D  K   HG      G CV+ G +
Sbjct  4    ELKASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIID--KKDMHG------GVCVHTGTV  55

Query  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
            P K   ++ L   +  H   SF         +    D  Q V  V +    I+     +L
Sbjct  56   PSKTFREAIL--HLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDITRH---QL  110

Query  239  RSKQVKYENVLGSFVDPHTLK----LWHPKKGTKEITTRHV-------------------  275
                ++  N    F+   + K    L +    T   T RH                    
Sbjct  111  LRNGIELINGTARFLPDPSKKMVAVLSNDSYETATDTKRHTSADICKRTGADSSILLISV  170

Query  276  ------VIAVGGRPRQLACL--GGELAVSSDDIFWMK-QKEPGKTLVVGASYVALECAGF  326
                  ++AVG RP + A +   G+    SD I W      P + +VVGA  + +E A  
Sbjct  171  LTADKFLVAVGTRPARRADIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASM  230

Query  327  LKGM-GYAVKVMV-RSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLL  384
            +  + G  V V+  R  +L   D+++A  + +Y   Q+G  F       ++ K  +G+++
Sbjct  231  MSIIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVI  289

Query  385  VKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNV  443
            VK     G       D +L   GR  +   L L   G++ + K G + V+ N +T+ P++
Sbjct  290  VKL--NSGKTI--VGDGLLYTVGRQGNTDGLNLAAVGLEAD-KRGLLKVDDNFRTSVPHI  344

Query  444  YAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM----------DYDKICT--------  485
            YA GD I  P L   +++ GRL S  + +E  V             Y +           
Sbjct  345  YAAGDCIGYPALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPF  404

Query  486  AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV-CD  544
             ++T  E    G SE+    E       + ++  V     LA+   +     ++K+V C 
Sbjct  405  GIYTVPEISMVGKSEQQLTRE------NIPYEVGVARYEELAKGQMLGGVPGFLKIVFCP  458

Query  545  KTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            K+    VLG H +G  A E+     + M  G T +   + V  +P
Sbjct  459  KSLQ--VLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYP  501

>PPTG_13000
Length=387

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 94/336 (28%), Positives = 157/336 (47%), Gaps = 27/336 (8%)

Query  265  KGTKEITTRHVVIAVGGR-----PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYV  319
            KG + +  ++++IA G       P  +    G++ + S     +K + P   +VVGA  +
Sbjct  48   KGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDSTGALELK-RVPEHLVVVGAGVI  105

Query  320  ALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKL  378
             LE     K +G  V V+        G D++   +  + ++ Q G++F   T    +T  
Sbjct  106  GLELGSVYKRLGAKVTVVEFLDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KVTSS  161

Query  379  DSGQLLVKWITE---DGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN  435
            +    +VK  TE    GD      DTVL ATGR    A LGL++ G++  +K GRI V++
Sbjct  162  EVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIEVDD  220

Query  436  E-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYG  494
              +T  P ++AIGDVI    L   A + G      +  +    ++Y  +   ++T  E+ 
Sbjct  221  AFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG-HVNYGAVPGVIYTFPEFA  279

Query  495  CCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES-CYVKVVCDKTRNNFVLG  553
              G +EE+ K E     +E Y+    P+  +   + R  AES   VKV+ DK + + +LG
Sbjct  280  SVGKTEEELKAE----GIE-YNVGKFPMMAN--SRARTVAESDGLVKVLADK-KTDKLLG  331

Query  554  FHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             H +  NAGE+     + ++ G   + L  T   HP
Sbjct  332  VHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHP  367

>PHYKE_2864
Length=486

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 114/491 (23%), Positives = 197/491 (40%), Gaps = 89/491 (18%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTSLGGVCVHTGTIPSKTFRE  85

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++ +V  +   +  +++VS+ +  +++     +V++     +
Sbjct  86   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDVIPGFAR  145

Query  245  YEN------VLGSFVDPHTLKLWHPKKGTKEITTR----HVVIAVGGRPRQ--LACLGGE  292
            +EN      V G   D  +  +        +  +R      +IA G RP    L  + G+
Sbjct  146  FENEHEISIVRGE--DEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLVPIDGK  203

Query  293  LAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVMVRSILLRGFDQDM  350
            + + SD I      + P   +VVGA  + +E A  +  + G++V V      + G     
Sbjct  204  VIIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTV------VDGRPDTT  257

Query  351  ASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDP  410
              ++  +                     +SG++L             + D +L   GR  
Sbjct  258  DKRVKVF--------------------FNSGKVL-------------SADALLYTVGRQA  284

Query  411  DVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRR  469
                L L+  G+  N + G I VN N QT  P++YA GD I AP L   +++ GRL S  
Sbjct  285  STDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCH  343

Query  470  LYN-----EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEW  524
            ++N       T Q++       ++T  E    G +E+               K+ V  E 
Sbjct  344  MWNPDEELAATSQLESGNYPYGIYTIPEISMVGQTEQQ------------LTKDCVNYEI  391

Query  525  SLAEQTRIAAESCYVKVVCDKTRNNF------VLGFHYLGPNAGEVTQAMGLAMKLGFTY  578
             +A+ + +A       +     +  F      V G H +G  A E+     +AM +G + 
Sbjct  392  GIAKYSELAKGQMMGAMAGGTLKILFDPDTLKVFGVHAIGEGATEIIHIGQVAMAMGCSL  451

Query  579  DQLVDTVGIHP  589
                D V  +P
Sbjct  452  TYFRDAVFNYP  462

>PHYSO_489418
Length=471

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 113/472 (24%), Positives = 190/472 (40%), Gaps = 75/472 (16%)

Query  168  LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
            +GG CV+ G +P K   +++L      H     G       G    F  + ++  V    
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQA-----GPSKRFGVEDILQRVKKVE  56

Query  228  ksisfkykVELRSKQVKYENVLGSFV--DPHTLKLWH---------PKKGT------KEI  270
             + +   + +L    V+  N    F+  + H + +            K+ T      + +
Sbjct  57   DAETDITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAKRHTSADICKRVL  116

Query  271  TTRHVVIAVGGRP--RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFL  327
            T    ++ VG RP  R      GE    SD + W K K  P + +VVGA  V +E A  +
Sbjct  117  TADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMM  176

Query  328  KGM-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLV  385
              + G  V V+  R  +L   D++++  +  Y   Q+G  F+     +S+ K   G++ V
Sbjct  177  TIIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLVGETIKSVEKTPKGEVFV  235

Query  386  KWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-NNEQTTTPNVY  444
                E G       D +L   GR  +V  L L+  G+ + +K GRI V NN QT  P++Y
Sbjct  236  HL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGL-VPDKRGRIKVDNNFQTAVPHIY  290

Query  445  AIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM----------DYDKICT---------  485
            A GD+I  P L   +++ GRL S  +     +            D D++ T         
Sbjct  291  AAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSGEVFP  350

Query  486  -AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC------Y  538
              ++T  E    G +E+   +E             VP E  +A    +A          +
Sbjct  351  FGIYTVPEISMVGKNEQQLTKEQ------------VPYEVGMARYEELARGQMLGGLPGF  398

Query  539  VKVV-CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +K++ C +T    +LG H +G  A E+     + M  G T +   + V  +P
Sbjct  399  LKIIFCPETLK--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  448

>PYAR_16664
Length=577

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 104/415 (25%), Positives = 166/415 (40%), Gaps = 62/415 (15%)

Query  122  ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
            AS  +DL+VIG G  G  C+ + A  GK V ++D            +GG C++ G +P K
Sbjct  60   ASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIID--------KRDMVGGVCIHTGTVPSK  111

Query  182  LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkyk----VE  237
               ++ L   +  H   SF         +    D  Q V  V S    I+        +E
Sbjct  112  TFREAIL--HLTAHRHRSFYDGESEPKKRFGIEDVLQRVRKVESAETDITRHQLLRNGIE  169

Query  238  LRSKQVKYE------------------NVLGSFVDPHTLK----LWHPKKGTKEITTRHV  275
            L +   ++                   N    F+   ++K    L +    T   T RH 
Sbjct  170  LINGTARFXXXXCDRALILLRNGIELINGTARFLPDPSMKMVAVLSNDSYDTPTDTKRHT  229

Query  276  --------------VIAVGGRP--RQLACLGGELAVSSDDIFWMK-QKEPGKTLVVGASY  318
                          +IAVG RP  R+     G+    SD I W      P + +VVGA  
Sbjct  230  SADICKRVLTADKFLIAVGTRPARREDIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGV  289

Query  319  VALECAGFLKGM-GYAVKVMV-RSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSIT  376
            + +E A  +  + G  V V+  R  +L   D+++A  + +Y   QSG  F      +S+ 
Sbjct  290  IGMEYASMMSIIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQSGTRFYTDETIKSVE  348

Query  377  KLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-NN  435
            K  +G+++VK     G       D +L   GR      L L   G++  +K G + V +N
Sbjct  349  KAANGEVIVKL--NSGKTI--IGDGLLYTVGRQGSTDGLNLAAVGLE-TDKRGLLQVDDN  403

Query  436  EQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTP  490
             +T+ P++YA GD I  P L   +++ GRL S  + +   +    D     +  P
Sbjct  404  FRTSVPHIYAAGDCIGYPALASTSMEQGRLASVHMRSAKPINKKRDTDANQLSDP  458

>PHYSO_562795
Length=415

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 149/333 (45%), Gaps = 40/333 (12%)

Query  276  VIAVGGRPRQ--LACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-G  331
            +IA G RP    L  + G++ + SD I      + P   +V+GA  + +E A  +  + G
Sbjct  80   LIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPG  139

Query  332  YAVKVMV-RSILLRGFDQDMASKIGEYMEMQS-GIEFIRKTVPQSITKLDSGQLLVKWIT  389
            ++V V+  R  +L   D+++ S +    EMQS G  F+   + +++ K+++ +  VK   
Sbjct  140  HSVTVVDGRPDILSFCDREIISNL--TYEMQSNGARFL---LGETVKKVETTENRVKVFF  194

Query  390  EDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGD  448
            + G     + D +L   GR      L L+  G+  N + G I VN N QT  P++YA GD
Sbjct  195  DSGKVL--SADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNQNYQTDQPHIYAAGD  251

Query  449  VIDAPELTPVAIQAGRLLSRRLYN-----EGTVQMDYDKICTAVFTPIEYGCCGLSEEDS  503
             I AP L   +++ GRL S  ++N     + T Q+D       ++T  E    G +E+  
Sbjct  252  CIGAPALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYGIYTIPEISMVGQTEQQ-  310

Query  504  KEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY-------VKVVCDKTRNNFVLGFHY  556
                         K+ V  E  +A+ + +A            +K++ D        G H 
Sbjct  311  -----------LTKDCVNYEVGIAKYSELAKGQMMGAMAGGTLKILFDPDTLKL-FGVHA  358

Query  557  LGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +G  A E+     +AM +G +     D V  +P
Sbjct  359  IGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYP  391

>PYIR_21896
Length=518

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 117/498 (23%), Positives = 206/498 (41%), Gaps = 74/498 (15%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            +YDLVVIG G     C+ E+A  GK+V V+D            +GG CV+ G IP K   
Sbjct  37   NYDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFR  88

Query  185  QSSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
            ++ L +    HH      +++ +V      +  K++V++            +V++   + 
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNS------------EVDISIVRD  136

Query  244  KYENVLGSFVDPHTLKLWHPKKGT-KEITTRHVVIAVGGRPRQ--LACLGGELAVSSDDI  300
              +   G   D       H    T   +     +IA G RP    L  + G++   SD I
Sbjct  137  TPDAAGGDAGDSD-----HDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKVIFDSDQI  191

Query  301  FWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQDMASKIGEY  357
                 +E P   +VVGA  + +E A  +  + G++V V+  RS +L   D ++ S +   
Sbjct  192  LSGDIRELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIISNL--T  249

Query  358  MEMQS-GIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
             EM+S G  F+     + + K +SG   V      G     + D +L   GR      L 
Sbjct  250  YEMRSKGARFLLGETIKHVEKTESG---VTVHFNSGKI--TSADALLYTVGRQAATDGLN  304

Query  417  LDEAGVKLNEKTGRIWVNNE-QTTTPNV------------------YAIGDVIDAPELTP  457
            L+   +  N + G + VN   QT  P++                  YA GD I AP L  
Sbjct  305  LEAVDLSRNPR-GLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSLAS  363

Query  458  VAIQAGRLLSRRLYNEG----TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVE  513
             +++ GRL +  ++++     T Q++       ++T  E    G +E+   +E  +  + 
Sbjct  364  TSMEQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGLNFEIG  423

Query  514  VYHKNFVPLEWSLAEQTRIAAESC--YVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLA  571
            +        ++S   + +++  +    +K++ D T      G H +G  A E+     +A
Sbjct  424  I-------AKYSELAKGQMSGSTAGGMLKILFDPTTLKL-FGVHAIGEGATEIIHIGQVA  475

Query  572  MKLGFTYDQLVDTVGIHP  589
            M +G +     D V  +P
Sbjct  476  MAMGCSITYFRDAVFNYP  493

>PITG_19065
Length=416

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 146/333 (44%), Gaps = 40/333 (12%)

Query  276  VIAVGGRPRQ--LACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-G  331
            +IA G RP    L  + G++ + SD I      + P   +V+GA  + +E A  +  + G
Sbjct  81   LIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPG  140

Query  332  YAVKVMV-RSILLRGFDQDMASKIGEYMEMQS-GIEFIRKTVPQSITKLDSGQLLVKWIT  389
            + V V+  R  +L   D+++ S +    EMQS G  F+   + +++ K+++    VK   
Sbjct  141  HTVTVVDGRPDILSFCDREIISNL--TYEMQSNGARFL---LGETVKKVETTDKRVKVFF  195

Query  390  EDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGD  448
              G     + D +L   GR      L L+  G+  N + G I VN N QT  P++YA GD
Sbjct  196  NSGKAL--SADALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGD  252

Query  449  VIDAPELTPVAIQAGRLLSRRLYN-----EGTVQMDYDKICTAVFTPIEYGCCGLSEEDS  503
             I AP L   +++ GRL S  ++N       T Q++       ++T  E    G +E+  
Sbjct  253  CIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQTEQQ-  311

Query  504  KEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY-------VKVVCDKTRNNFVLGFHY  556
                         K+ V  E  +A+ + +A            +K++ D      V G H 
Sbjct  312  -----------LTKDCVNYEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHA  359

Query  557  LGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +G  A E+     +AM +G +     D V  +P
Sbjct  360  IGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYP  392

>PITG_01778
Length=470

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 110/466 (24%), Positives = 182/466 (39%), Gaps = 63/466 (14%)

Query  168  LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
            LGG CV+ G +P K   +++L      H     G       G    F  + ++  V    
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQA-----GPSRRFGVEDILQRVRKVE  56

Query  228  ksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITT---RHV---------  275
             + +   + +L    V+  N    F+  +   +      + E  T   RH          
Sbjct  57   DAETDITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETATDAKRHTSADICKRVL  116

Query  276  -----VIAVGGRP--RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFL  327
                 ++ VG RP  R      GE    SD + W   K  P + ++VGA  V +E A  +
Sbjct  117  TADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMM  176

Query  328  KGM-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLV  385
              + G  V V+  R  +L   D+ ++  +  Y   Q+G  F+     +S+ K   G++  
Sbjct  177  TIIPGTDVTVIDGRQEILNMADKQVSEALC-YSMAQTGTRFLTGETIKSVEKSPKGEVFA  235

Query  386  KWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-NNEQTTTPNVY  444
                E G       D +L   GR  +V  L L+  G+   +K GRI V NN QT  P++Y
Sbjct  236  HL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAVPHIY  290

Query  445  AIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQ----------MDYDKICT---------  485
            A GD+I  P L   +++ GRL S  +     +            D D++ T         
Sbjct  291  AAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFP  350

Query  486  -AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVV-C  543
              ++T  E    G +E+   +E      +V ++  V     LA    +     ++K++ C
Sbjct  351  FGIYTVPEISMVGKNEQQLTKE------QVPYEVGVARYEELARGQMLGGVPGFLKIIFC  404

Query  544  DKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              T   F  G H +G  A E+     + M  G T +   + V  +P
Sbjct  405  PDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  448

>HYAP_08069
Length=255

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 99/219 (45%), Gaps = 21/219 (10%)

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  185  QSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
             S+ +     H+  S+G +  +V    P     Q++      +++++   +      +V 
Sbjct  86   HSTHLLHTAQHEFKSYGIDAPNVTANFP-----QMMKAKEKAVRTLTAGIESLFSKNKVT  140

Query  245  YENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGRPRQLACL-----GGELAVSSD  298
            Y   +G       + +    ++G   +T +++++A G     L  +      G++  S+ 
Sbjct  141  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  200

Query  299  DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM  337
             +     + P   +VVGA  + LE     K +G  V V+
Sbjct  201  ALAL--TRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  237

>SPRG_04114
Length=376

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 87/363 (24%), Positives = 155/363 (43%), Gaps = 25/363 (7%)

Query  237  ELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQ--LACLGGELA  294
            +L++ +V     L  F + + + +         +  +  ++A G RP    L    G++ 
Sbjct  7    QLKAARVDLVPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGKII  66

Query  295  VSSDDIFWM-KQKEPGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQDMA  351
            + SD I      K P   +VVGA  + +E A  L  + G  V V+  R+ +L   D ++ 
Sbjct  67   LDSDQILNHDTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIV  126

Query  352  SKIGEYMEMQ-SGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDP  410
            S +   MEM+  G  F+     +S+    +G   VK     G       + +L   GR  
Sbjct  127  SSL--KMEMRHKGARFLLGESIKSVEHFKNG---VKVEFNSGKAM--FAEALLYCVGRQA  179

Query  411  DVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRR  469
            +   L L+  G+  N + G I VN + QT+ P++YA GD I AP L   +++ GRL +  
Sbjct  180  NTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACD  238

Query  470  LY---NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL  526
            ++   ++ T Q++       ++T  E    G +E+   +E  + +V +   +       L
Sbjct  239  MWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGANYAVGLAKFS------EL  292

Query  527  AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVG  586
            A+          +K++ D       LG H +G  A E+     +AM +        D V 
Sbjct  293  AKGQMSGDIEGILKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKITYFRDAVF  351

Query  587  IHP  589
             +P
Sbjct  352  NYP  354

>PPTG_24712
Length=67

 Score = 52.8 bits (125),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 3/62 (5%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YD +VIGGGSGG+A ++ AA+FG KV V   V+        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  186  SS  187
            ++
Sbjct  64   TA  65

>HYAP_13613
Length=423

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 102/225 (45%), Gaps = 21/225 (9%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            YDLVVIG G     C+ ++A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  33   YDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  84

Query  186  SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
            + L +    HH      +++ +V  +   +  +++VS+    +++     +V++     +
Sbjct  85   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFAR  144

Query  245  YENVL-------GSFVD-PHTLKLWHPKKGTKEITTRHVVIAVGGRPRQ--LACLGGELA  294
            +E+         G+  D   T +  +       +     ++A G RP    L  + G++ 
Sbjct  145  FESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPAHNPLVPIDGKIV  204

Query  295  VSSDDIFWM-KQKEPGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
            + SD I     Q+ P   +VVGA  + +E A  +  + G++V V+
Sbjct  205  IDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMINVVPGHSVTVV  249

>PITG_19802
Length=185

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 71/158 (45%), Gaps = 8/158 (5%)

Query  432  WVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPI  491
            W      + P ++AIGDVI    L   A + G      +  +    ++Y  I   ++T  
Sbjct  16   WPLERIKSVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFP  74

Query  492  EYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFV  551
            E+   G +EE+ K E     +E Y+    P+  +   +T IA     VKV+ DK + + +
Sbjct  75   EFASVGKTEEELKAE----GIE-YNVGKFPMMANSRART-IAEADGLVKVLADK-KTDKL  127

Query  552  LGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            LG H +  NAGE+     + ++ G   + L  T   HP
Sbjct  128  LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHP  165

>SPRG_18643
Length=85

 Score = 39.7 bits (91),  Expect = 0.003, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 10/74 (14%)

Query  90   GETLDGTAPMDDTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGK  149
            G + +  A  DD +S +         I+    AS  +DLVVIG G  G  C+ ++A  GK
Sbjct  21   GLSTEAEAKADDASSFTN--------ILRNLRASEHFDLVVIGSGPSGQKCAIDSAKHGK  72

Query  150  KVCVLDYVKPSPHG  163
            KV ++D  K   HG
Sbjct  73   KVAIID--KKDMHG  84

>PYIW_27568
Length=128

 Score = 38.1 bits (87),  Expect = 0.028, Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 51/114 (45%), Gaps = 9/114 (8%)

Query  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
             ++Y+ I   ++T  E    G +EE  KEE        Y+    P+  +   + R   E+
Sbjct  3    HVNYNAIPGVIYTFPEVASVGKTEEQLKEEG-----VAYNVGKFPMMAN--SRARAVGEA  55

Query  537  -CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               VKV+ DK  +  +LG H +  NAGE+     L M+ G   + +  T   HP
Sbjct  56   DGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHP  108

>PYAP_15943
Length=139

 Score = 34.7 bits (78),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLD  155
            +D VV+GGG  GL  +   A  GK+VCVL+
Sbjct  14   WDAVVVGGGHNGLVAAAYLAKAGKRVCVLE  43

>CCI40989
Length=552

 Score = 35.8 bits (81),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 8/75 (11%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            +D V+IGGG  GL  +   A  GK+VCVL+            +GG  V     P  L  +
Sbjct  14   WDAVIIGGGHNGLVAAAYLAKAGKQVCVLE--------KRHVIGGAAVTEEIFPGFLFSR  65

Query  186  SSLIGEILHHDCASF  200
            +S +  +   D   +
Sbjct  66   ASYVFSLFRPDIIEY  80

>PYU1_G000378
Length=1070

 Score = 35.0 bits (79),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 82/172 (48%), Gaps = 11/172 (6%)

Query  312  LVVGASYVALECAGFLKGMGYAVKVMVR--SILLRGFDQDMASKIGEYMEMQSGIEFIRK  369
            LV+G   + LE A  +  +  +V+++ R   ++ R  D   A  +   +  + GIE +  
Sbjct  160  LVIGGGLLGLEAAKAIHDLQLSVRIVNRGSRLMSRQLDDAGAKVLHNEIVSKFGIEVLY-  218

Query  370  TVPQSITKLDSGQLLVKWIT-EDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKT  428
                  TK   G  +V+ +   DG+ +++ F  V  ATG  P    LG D +G+ + ++ 
Sbjct  219  ---HKTTKYIHGTTVVEGVDFTDGESYDDVFMIVF-ATGIKPR-DDLGRD-SGLDVAQRG  272

Query  429  GRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMD  479
            G I VN+  +T+  +VYAIG+ +   ++T   +  G  ++  L    T   D
Sbjct  273  GGILVNDLLETSHKDVYAIGECVSHRDVTYGLVAPGYEMADNLAKNFTANGD  324

>SPRG_04231
Length=90

 Score = 32.0 bits (71),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 23/43 (53%), Gaps = 0/43 (0%)

Query  547  RNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            ++  V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  51

>PITG_02760
Length=165

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLD  155
            +D +V+GGG  GL  +   A  GK VCVL+
Sbjct  12   WDAIVVGGGHNGLVAASYLAKAGKSVCVLE  41

>SDRG_06690
Length=657

 Score = 33.9 bits (76),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (52%), Gaps = 3/58 (5%)

Query  303  MKQKEPGKTLV---VGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEY  357
            + Q  PG  +V    G+  + L CA F  G+G A  V  RS+   G  +DMA+  GE+
Sbjct  202  LAQVRPGDWVVDPFAGSGGILLACAHFGIGLGLAHDVSFRSLQGDGPGRDMAANFGEF  259

>HYAP_08068
Length=100

 Score = 31.6 bits (70),  Expect = 3.4, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (2%)

Query  532  IAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
            +A     VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   HP
Sbjct  9    VAEADGMVKVLADK-KTDKLLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  65

>PYU1_G014369
Length=703

 Score = 33.9 bits (76),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 39/164 (24%), Positives = 78/164 (48%), Gaps = 18/164 (11%)

Query  275  VVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEP-GKTL-VVGASYVALECAGFLKGMGY  332
            VVIA G  PR L   GG+ +     I  +K K P GK + V+GA  +  + + FL  +G 
Sbjct  462  VVIATGVLPRDLKIPGGDHSKVLSYIDVLKHKAPVGKRVAVIGAGGIGFDVSEFLTHIGK  521

Query  333  AVKVMVRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDG  392
            +  + V ++  + +  D ++ +      + G++ +++ VP    ++    L+ +  T+ G
Sbjct  522  SASLDV-NLFAKEWGIDTSNSV------RGGVQGVKQEVPAPEREV---YLMQRKSTKHG  571

Query  393  DCFEETFDTVLNATGRDPDVAKLG------LDEAGVKLNEKTGR  430
                +T   +   + +  DV  +G      +D+AG+   +K G+
Sbjct  572  KDLGKTTGWIHRLSLKHRDVKMIGGVNYDKVDDAGLHYTDKEGK  615

>SPRG_01865
Length=638

 Score = 33.9 bits (76),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 31/65 (48%), Gaps = 3/65 (5%)

Query  94   DGTAPMDDTASASELNESRTPPI---VVEDDASYDYDLVVIGGGSGGLACSKEAASFGKK  150
            DG A  +DT + +    +R P I    ++       D +V+G G GGL  +   A  G +
Sbjct  39   DGFAAFEDTKATTTPRPTRMPVIQDRYLKSKVPSTLDAIVVGSGIGGLGVAAILARMGWR  98

Query  151  VCVLD  155
            V VL+
Sbjct  99   VLVLE  103

>PYU1_G004385
Length=562

 Score = 33.5 bits (75),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLD  155
            +D +V+GGG  GL  +   A  GK+VCVL+
Sbjct  13   WDAIVVGGGHNGLVAAAYLAKAGKQVCVLE  42

>SDRG_05159
Length=551

 Score = 33.5 bits (75),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 31/72 (43%), Gaps = 8/72 (11%)

Query  118  VEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGC  177
            V    +  +D V++GGG  GL  +   A  GK VCVL+            LGG  V    
Sbjct  7    VRQHLTRQWDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEI  58

Query  178  IPKKLMHQSSLI  189
            IP     ++S +
Sbjct  59   IPDFHFSRASYV  70

>PYVX_18330
Length=558

 Score = 33.5 bits (75),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLD  155
            +D +V+GGG  GL  +   A  GK+VCVL+
Sbjct  13   WDAIVVGGGHNGLVAASYLAKAGKQVCVLE  42

>PPTG_16294
Length=406

 Score = 33.5 bits (75),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 5/45 (11%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLD-----YVKPSPHGTS  165
            YD+V++G G  G A +  AA  GK+V VL+     + K S HGTS
Sbjct  6    YDVVIVGAGLMGSAAAYYAAKQGKRVLVLEQFELLHGKGSSHGTS  50

>SDRG_08246
Length=817

 Score = 33.5 bits (75),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 31/65 (48%), Gaps = 3/65 (5%)

Query  94   DGTAPMDDTASASELNESRTPPI---VVEDDASYDYDLVVIGGGSGGLACSKEAASFGKK  150
            DG A  +DT + +    +R P I    ++       D +V+G G GGL  +   A  G +
Sbjct  218  DGFAAFEDTKATTTPRPTRMPVIQDRYLKSKVPSTLDAIVVGSGIGGLGVAAILARMGWR  277

Query  151  VCVLD  155
            V VL+
Sbjct  278  VLVLE  282

>H310_07705
Length=546

 Score = 33.5 bits (75),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 8/64 (13%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            +D +V+GGG  GL  +   A  GK VCVL+            LGG  V    +P     +
Sbjct  12   WDAIVVGGGHNGLVAATYLAKAGKAVCVLE--------KRHVLGGAAVTEEIVPNFRFSR  63

Query  186  SSLI  189
            +S +
Sbjct  64   ASYV  67

>SPRG_08354
Length=550

 Score = 33.1 bits (74),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 29/64 (45%), Gaps = 8/64 (13%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
            +D V++GGG  GL  +   A  GK VCVL+            LGG  V    IP     +
Sbjct  15   WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPNFHFSR  66

Query  186  SSLI  189
            +S +
Sbjct  67   ASYV  70

>SPRG_17626
Length=148

 Score = 32.0 bits (71),  Expect = 5.4, Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 52/116 (45%), Gaps = 7/116 (6%)

Query  474  GTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIA  533
            G   ++Y+ I   V+T  E    G +EE+ K      +   Y+    P+  +   +T + 
Sbjct  20   GHGHVNYNAIPGVVYTFPEVASVGKTEEELKA-----ANVAYNVGKFPMMANSRART-VG  73

Query  534  AESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                +VK++  K  +  +LG H +  NAGE+     L ++ G + + +  T   HP
Sbjct  74   ETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHP  128

>PHYCA_131139
Length=406

 Score = 33.1 bits (74),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 5/45 (11%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLD-----YVKPSPHGTS  165
            YD+V++G G  G A +  AA  GK+V VL+     + K S HGTS
Sbjct  5    YDVVIVGAGLMGSAAAYYAAKDGKRVLVLEQFELLHGKGSSHGTS  49

>PHYKE_5677
Length=211

 Score = 32.3 bits (72),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLD  155
            +D +V+GGG  GL  +   A  GK VCVL+
Sbjct  12   WDAIVVGGGHNGLVAAAYLAKAGKNVCVLE  41

>PYAP_22849
Length=1089

 Score = 33.1 bits (74),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 68/147 (46%), Gaps = 7/147 (5%)

Query  312  LVVGASYVALECAGFLKGMGYAVKVMVR--SILLRGFDQDMASKIGEYMEMQSGIEFIRK  369
            L+VG   + LE A  +  +G  V+++ R   ++ R  D   A  +   +E + GIE +  
Sbjct  173  LIVGGGLLGLEAAKAIHDLGLGVRIINRGGRLMSRQLDDAGAKVLQLEIERKFGIEVLYN  232

Query  370  TVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTG  429
               QS+  +D    +      DG    + F  V  ATG  P   +LG    G+++  + G
Sbjct  233  KTTQSL--IDDNGCVGGIEFTDGTNMRDVFLVVF-ATGIIPR-DELGAS-GGLRVARRRG  287

Query  430  RIWVNNEQTTTPNVYAIGDVIDAPELT  456
             +  +  +TT   VYA+G+ +   ++T
Sbjct  288  IVVNDQLETTVGGVYALGECVSHRDVT  314

>PHYSO_507629
Length=703

 Score = 33.1 bits (74),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 73/167 (44%), Gaps = 18/167 (11%)

Query  275  VVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEP--GKTLVVGASYVALECAGFLKGMGY  332
            VVIA G  PR+L   G +       I  +K K P   K  V+GA  +  + A F+  +G 
Sbjct  462  VVIATGVLPRELKIPGADHPKVLSYIDVLKNKAPVGKKVAVIGAGGIGFDVAEFITHVGE  521

Query  333  AVKVMVRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDG  392
            +    V +   R +  DM + +      + G+  I+ ++P    ++    L+ +  T+ G
Sbjct  522  STSSSVDA-FAREWGIDMTNSV------RGGVAGIKPSIPPPPREV---YLMQRKKTKHG  571

Query  393  DCFEETFDTVLNATGRDPDVAKLG------LDEAGVKLNEKTGRIWV  433
                +T   +   + +  DV  +G      +D+AG+   +K G+  V
Sbjct  572  KDLGKTTGWIHRLSLKHRDVKMIGGVSYDKVDDAGLHYTDKKGQKQV  618

>PITG_05097
Length=653

 Score = 32.7 bits (73),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 32/67 (48%), Gaps = 6/67 (9%)

Query  377  KLDSGQLLVKWITEDGDC-FEETFDTVLNATGRD--PDVAKLGLDEAGVKLNEKTGRIWV  433
             L +G   VKW T+D D  F+  F+T  N TG    P   K  LD   + +N  T  +W 
Sbjct  561  SLATGDFSVKWTTKDEDSFFQANFETPKNTTGSISVPTFGK-ALDTIEIFINGNT--VWA  617

Query  434  NNEQTTT  440
            N E + T
Sbjct  618  NGESSWT  624

>PPTG_05518
Length=554

 Score = 32.7 bits (73),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  126  YDLVVIGGGSGGLACSKEAASFGKKVCVLD  155
            +D +V+GGG  GL  +   A  GK VCVL+
Sbjct  12   WDAIVVGGGHNGLVAAAYLAKAGKSVCVLE  41

>PYAR_24210
Length=166

 Score = 31.6 bits (70),  Expect = 8.5, Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)

Query  403  LNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE  436
            LNA     DVA + + EA  +L  +  R W+NNE
Sbjct  53   LNAANSQKDVAAMLVQEASTQLFTRMQRYWINNE  86

Lambda      K        H        a         alpha
   0.318    0.136    0.415    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 47422841709

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40