Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_01513924824811465e-160
PPTG_1667292862234123e-48
PHYCA_50470692532223781e-43
PITG_0001191602023399e-39
PHYSO_47825391692023293e-37
PHALS_1083592642083172e-34
PHYKE_572092212172891e-30
PYVX_158639181651822e-15
PYU1_G00322593697227661165e-06
PYIW_16960502333291780.40
PHYSO_3001834848970187741.9
CCA2427515626439854704.4
PHYRA_7414757873515115697.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_01513

Length=248
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP_01513                                                            446        5e-160
PPTG_16672                                                            163        3e-48 
PHYCA_504706                                                          150        1e-43 
PITG_00011                                                            135        9e-39 
PHYSO_478253                                                          131        3e-37 
PHALS_10835                                                           126        2e-34 
PHYKE_5720                                                            115        1e-30 
PYVX_15863                                                            74.7       2e-15 
PYU1_G003225                                                          49.3       5e-06 
PYIW_16960                                                            34.7       0.40  
PHYSO_300183                                                          33.1       1.9   
CCA24275                                                              31.6       4.4   
PHYRA_74147                                                           31.2       7.5   

>HYAP_01513
Length=248

 Score = 446 bits (1146),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 248/248 (100%), Positives = 248/248 (100%), Gaps = 0/248 (0%)

Query  1    MSRLVEsvvsfassrappppvpvvtsprlvpESVSQPTEKKKKPHRGLIRAVGVFFKRKC  60
            MSRLVESVVSFASSRAPPPPVPVVTSPRLVPESVSQPTEKKKKPHRGLIRAVGVFFKRKC
Sbjct  1    MSRLVESVVSFASSRAPPPPVPVVTSPRLVPESVSQPTEKKKKPHRGLIRAVGVFFKRKC  60

Query  61   SDGDATVRPPVVSGASPNRMVQWIHGSQRQSMPDMPLEAVDPSLYQERETLTSVCPLMEE  120
            SDGDATVRPPVVSGASPNRMVQWIHGSQRQSMPDMPLEAVDPSLYQERETLTSVCPLMEE
Sbjct  61   SDGDATVRPPVVSGASPNRMVQWIHGSQRQSMPDMPLEAVDPSLYQERETLTSVCPLMEE  120

Query  121  TPVTITNKRVKQETKADKGERRKAETKANVSFVKAKPSPTDSSELLRAESSSGNESNVDP  180
            TPVTITNKRVKQETKADKGERRKAETKANVSFVKAKPSPTDSSELLRAESSSGNESNVDP
Sbjct  121  TPVTITNKRVKQETKADKGERRKAETKANVSFVKAKPSPTDSSELLRAESSSGNESNVDP  180

Query  181  LRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFFSLPLAERLRRSSAK  240
            LRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFFSLPLAERLRRSSAK
Sbjct  181  LRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFFSLPLAERLRRSSAK  240

Query  241  SDPKEYEL  248
            SDPKEYEL
Sbjct  241  SDPKEYEL  248

>PPTG_16672
Length=286

 Score = 163 bits (412),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 136/223 (61%), Gaps = 20/223 (9%)

Query  33   SVSQPTEKKKKPHRGLIRAVGVFFKRKCSDGDATVRPPVVSGASPNRMVQW--IHGSQRQ  90
            + ++P  K+K   RG++RA+G  FKRK SD D  + P   S AS  R  +W     S R 
Sbjct  77   AAAEPPTKRKT--RGIMRAIGGLFKRKASDVDDAMEP-SDSEASQRRTSRWSRWSHSHRG  133

Query  91   SMPDMPLE-----AVDPSLYQERETLTSVCPLMEETPVTITNKRVKQETKADKGERRKAE  145
            S P+ PLE     A + +  QE E+  S  P  +E P     K+VK+ T       +KA 
Sbjct  134  SFPEAPLEVAAVAAPETAPIQENESAAS-SPHPDEPPA----KKVKKATVEHPTTEKKA-  187

Query  146  TKANVSFVKAKPSPTDSSELLRAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSE  205
              + +SF K K SPTD SELL A+SS  +ES  +P RVSFL FGGS+VDSTF+PEL PSE
Sbjct  188  --SPLSFNKTKQSPTDPSELLMADSS--DESGAEPQRVSFLFFGGSDVDSTFQPELRPSE  243

Query  206  YDDVHGSEIRPVLQNKMPLFFSLPLAERLRRSSAKSDPKEYEL  248
             DD+H ++IRP LQ KMPLFFS PL E +RRSS   DPKEYE 
Sbjct  244  LDDLHENDIRPSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF  286

>PHYCA_504706
Length=253

 Score = 150 bits (378),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 128/222 (58%), Gaps = 19/222 (9%)

Query  34   VSQPTEKKKKPHRGLIRAVGVFFKRKCSDGDATVRPPVVSGASPNRMVQWIHGSQ--RQS  91
            V+QP    K+ HRGL+RA+G  FKRK SD D    P   S AS  R  +W   S   R S
Sbjct  44   VTQPELPTKRKHRGLMRAIGGLFKRKSSDADDATAP-SDSEASQRRTSRWSRWSHSNRGS  102

Query  92   MPDMPLEAV-----DPSLYQERETLTSVCPLMEETPVTITNKRVKQETKADKGERRKAET  146
            MP+ PLE       + +  QE E++ S  P MEE P     K   ++ K +   +  +  
Sbjct  103  MPEAPLEVAAVAEPETAPIQENESVAS-SPHMEEPPAKKVKKVKAEKPKKEAKIKPPS--  159

Query  147  KANVSFVKAKPSPTDSSELLRAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEY  206
                     K SPTD S L+ + SS G  S V+P R+SFL FGGS+ DSTF+PEL PSEY
Sbjct  160  ------FNTKQSPTDPSALVASGSSDG--SVVEPQRISFLFFGGSDTDSTFQPELRPSEY  211

Query  207  DDVHGSEIRPVLQNKMPLFFSLPLAERLRRSSAKSDPKEYEL  248
            D++H ++IRP LQ KMPLFFS P+ E +RRSS   DPKEYE 
Sbjct  212  DELHENDIRPSLQAKMPLFFSPPMVENMRRSSILPDPKEYEF  253

>PITG_00011
Length=160

 Score = 135 bits (339),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 106/202 (52%), Gaps = 44/202 (22%)

Query  49   IRAVGVFFKRKCSDGDATVRPP--VVSGASPNRMVQWIHGSQRQSMPDMPLEAVDPSLYQ  106
            +RA+G  FKRKCSD D    P     S    +R  +W H S R S+P+ PL+        
Sbjct  1    MRAIGGLFKRKCSDADDATAPSDSEASQRRTSRWSRWSH-SHRGSLPEAPLD--------  51

Query  107  ERETLTSVCPLMEETPVTITNKRVKQETKADKGERRKAETKANVSFVKAKPSPTDSSELL  166
                  +     E  P+   N   KQ                         SPTD S+LL
Sbjct  52   -----VAAVAAPETAPIQ-ENDSTKQ-------------------------SPTDPSDLL  80

Query  167  RAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFF  226
             A+SS  +ES  +P RVSFL FGGS+ DSTF+PEL PSE DD+H ++IRP LQ KMPLFF
Sbjct  81   LADSS--DESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFF  138

Query  227  SLPLAERLRRSSAKSDPKEYEL  248
            S PL E +RRSS   DPKEYE 
Sbjct  139  SPPLVENMRRSSILPDPKEYEF  160

>PHYSO_478253
Length=169

 Score = 131 bits (329),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 109/202 (54%), Gaps = 35/202 (17%)

Query  49   IRAVGVFFKRKCSDGDATVRPPVVSGASPNRMVQWIHGSQ--RQSMPDMPLEAVDPSLYQ  106
            +RA+G  FKRK  D D  + P     +      +W   SQ  RQS+P+ P+E        
Sbjct  1    MRAIGGLFKRKSIDADDPMAPSDSEASQRPSTSRWSRWSQSHRQSLPEAPME--------  52

Query  107  ERETLTSVCPLMEETPVTITNKRVKQETKADKGERRKAETKANVSFVKAKPSPTDSSELL  166
                +T+V  + E  P+                  ++ E  A  S VK   SPTD S LL
Sbjct  53   ----VTAVA-VPEAAPI------------------QENEPPAPSSPVKQ--SPTDPSALL  87

Query  167  RAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFF  226
             A   S +E   +P RVSFL FGGS+VDSTF+PEL PSE DD+H +EIRP LQ KMPLFF
Sbjct  88   LAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFF  147

Query  227  SLPLAERLRRSSAKSDPKEYEL  248
            S PL E +RRSS   DPKEYE 
Sbjct  148  SPPLVENMRRSSILPDPKEYEF  169

>PHALS_10835
Length=264

 Score = 126 bits (317),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 121/208 (58%), Gaps = 11/208 (5%)

Query  41   KKKPHRGLIRAVGVFFKRKCSDGDATVRPPVVSGASPNRMVQWIHGSQRQSMPDMPLEAV  100
            KK+ HRGL+RA+G FF+R CSD D+  RP   S +S  R  +W H S RQSMP+ P   V
Sbjct  68   KKRKHRGLMRAIGGFFRRNCSDADSDTRP-HDSESSQRRTSRWSH-SHRQSMPEAPSTVV  125

Query  101  DPSLYQERETLTSVCPLMEETPVTITNKRVKQETKADKGERRKAETKANVSFVKAKPSPT  160
                 QE    T      E  P+T   K    E    K  ++    KA  +    + SPT
Sbjct  126  ----VQEILETTRSQNAAENEPLT---KSPHTEEPPVKKVKKDKPKKAKNTPSPTEQSPT  178

Query  161  DSSELLRAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQN  220
            ++SE+L A  +  +E  V+  RVSFL FGGS+VD TF+PEL PSE DD+H ++IRP LQ 
Sbjct  179  ETSEMLSA--TLVDELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQA  236

Query  221  KMPLFFSLPLAERLRRSSAKSDPKEYEL  248
            KMPLF   PL + +RRSS   DP+EYE 
Sbjct  237  KMPLFLPPPLPKNVRRSSILPDPEEYEF  264

>PHYKE_5720
Length=221

 Score = 115 bits (289),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 124/217 (57%), Gaps = 4/217 (2%)

Query  33   SVSQPTEKKKKPHRGLIRAVGVFFKRKCSDGDATVRPPVVSGASPNRMVQWIHGSQRQSM  92
            SVS+PT  K++   G IRA+G  FKR+ SD +  +  P  S +S     +W   S R S+
Sbjct  8    SVSEPT--KRRHSGGFIRAIGGLFKRRSSDANG-LSAPSDSESSQRSTSRWSRFSLRHSL  64

Query  93   PDMPLEAVDPSLYQERETLTSVCPLMEETPVTITNKRVKQETKADKGERRKAETKANVSF  152
            P+ P+E    +  +      +                 K+  KA+K ++ K E K     
Sbjct  65   PEAPMEVEAVAAPEAAPIRENDSVSTPSPSPHPEEPPAKKAKKAEKPKKEKKEKKPKPPS  124

Query  153  VKAKPSPTDSSELL-RAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHG  211
             K+KPSPTD+ ELL  AES SG+E   +P R+SFL FGGS+ +STF P+L PS+ DD+H 
Sbjct  125  QKSKPSPTDTPELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHE  184

Query  212  SEIRPVLQNKMPLFFSLPLAERLRRSSAKSDPKEYEL  248
            +++RP LQ KMP FFS P+ E +RRSS   DP+EYE 
Sbjct  185  NDLRPSLQAKMPQFFSPPVVEHMRRSSILPDPREYEF  221

>PYVX_15863
Length=181

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 1/65 (2%)

Query  185  FLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFFSLPLAERLRRSSA-KSDP  243
            FL +GGS+VD  F+P+L PS  D V  S IRPV++  MP+FFS P  E LRRSS   +DP
Sbjct  117  FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADP  176

Query  244  KEYEL  248
            +EYE 
Sbjct  177  REYEF  181

>PYU1_G003225
Length=227

 Score = 49.3 bits (116),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query  185  FLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFFSLPL--AERLRRSSAKSD  242
            FL + GS  D++F+PE   S   ++  + IRP L  +MP+FFS P   +   RRSS  +D
Sbjct  126  FLFYPGSAEDNSFKPEKVTSSIVEIDYNAIRPSLTLQMPVFFSPPTEPSNFPRRSSILTD  185

Query  243  PKEYEL  248
            P+EYEL
Sbjct  186  PREYEL  191

>PYIW_16960
Length=332

 Score = 34.7 bits (78),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 46/91 (51%), Gaps = 8/91 (9%)

Query  120  ETPVTITNKRVKQETKADKGERR--KAETKANVSFVKAKPSPTDSSELLRAESSSGNESN  177
            E P+ + +++ +++ +  K ER    A+  A V  V+    P+  S  L A S SG++S 
Sbjct  53   EIPLNVVSRQARRQAR--KAERLPGGADGAAAVKGVRTSSLPSKISFALLAGSVSGSKSI  110

Query  178  VDPLRVSFL----IFGGSEVDSTFEPELHPS  204
             D L  +FL     FG ++V+  F P   PS
Sbjct  111  KDTLGATFLGDIYGFGATKVEELFRPFTEPS  141

>PHYSO_300183
Length=701

 Score = 33.1 bits (74),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 36/87 (41%), Gaps = 17/87 (20%)

Query  122  PVTITNKRVKQETKADKGERRKAETKANVSFVKAKPSPTDSSELLRAESSSGNESNVDPL  181
            P+T      +  T+A   +RR A+ K NV     KP     S +L            DP 
Sbjct  550  PITFIVANKRHHTRAFPVDRRDADHKGNV-----KPGTVVDSGVL------------DPH  592

Query  182  RVSFLIFGGSEVDSTFEPELHPSEYDD  208
            R  F ++G S +  T +P  +   YD+
Sbjct  593  RFDFFLYGHSSLQGTSKPCHYTVLYDE  619

>CCA24275
Length=398

 Score = 31.6 bits (70),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 28/54 (52%), Gaps = 2/54 (4%)

Query  40  KKKKPHRGLIRAVGVFFKRKCSDGDATVRPPVVSGASPNRMVQWIHGSQRQSMP  93
           + K P+R L R + +  ++KC     +  PPV+  A    +  W+ G QR++ P
Sbjct  30  RYKIPYRSLRRLINM--EKKCKQKKRSSPPPVLGNAVGKYLRDWVIGMQRKAFP  81

>PHYRA_74147
Length=515

 Score = 31.2 bits (69),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 53/115 (46%), Gaps = 11/115 (10%)

Query  121  TPVTITNKRVKQETKADKGERRKAETKANVSFVKAKPSPTD-SSELLRAE-SSSGNESNV  178
            TPV +T ++V   +  DK E R +  +A + F      P + + E+LRAE + + N+   
Sbjct  349  TPVELTGRQVSTSSLLDKSEGRMSHLRAALEF------PEEITEEMLRAEYTGTKNKLRY  402

Query  179  DPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFFSLPLAER  233
             PLR++  IF    + +    +    + +D  G+    V    MPL   L +  R
Sbjct  403  IPLRLA--IFAVLVIIAV-AAQNKFLDLEDFTGATAHTVNCMIMPLLIYLRIFWR  454

Lambda      K        H        a         alpha
   0.311    0.128    0.360    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13427522280

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40