Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_015126172876763763e-48
HYAP_0570763784314652082e-20
HYAP_0888465472289801862e-17
HYAP_0271362318101381753e-17
HYAP_0484963390258371763e-16
HYAP_0396162944265381765e-16
HYAP_002766106782381656e-16
HYAP_0196161955231381737e-16
HYAP_0717464527285381713e-15
HYAP_1365467856226381651e-14
HYAP_0976865920232381632e-14
HYAP_1358167811161351593e-14
HYAP_0403762987239271319e-10
HYAP_0837665195256271265e-09
HYAP_1196367044178211053e-06
HYAP_033536265116042760.031
HYAP_121486713814026690.31
PHALS_078643294610736670.40
PHALS_016493017012040660.63
HYAP_067916433512726651.1
CCI412022705141754642.2
HYAP_11990670596620602.6
CCA16522270559754632.9
PPTG_161911407687746623.2
PYAR_24024270550454623.5
PHALS_018293025513539613.8
PYVX_21090270559054623.8
PHYSO_321612270586554605.9
PHYCA_525182270562354606.2
CCA184041238026636606.2
CCA1832315347626636606.2
PHYRA_78212270561354606.4
PHALS_084703320140545606.5
PITG_03117270562054606.5
HYAP_00088270562254607.6
PITG_09539788612259588.2
PHYSO_286664788612557588.9
SPRG_12054156655827598.9
H257_10668549074032599.0
SDRG_05060156655927599.1
PHALS_13781270562054599.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_01512

Length=76
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP_01512                                                            149        3e-48
HYAP_05707                                                            84.7       2e-20
HYAP_08884                                                            76.3       2e-17
HYAP_02713                                                            72.0       3e-17
HYAP_04849                                                            72.4       3e-16
HYAP_03961                                                            72.4       5e-16
HYAP_00276                                                            68.2       6e-16
HYAP_01961                                                            71.2       7e-16
HYAP_07174                                                            70.5       3e-15
HYAP_13654                                                            68.2       1e-14
HYAP_09768                                                            67.4       2e-14
HYAP_13581                                                            65.9       3e-14
HYAP_04037                                                            55.1       9e-10
HYAP_08376                                                            53.1       5e-09
HYAP_11963                                                            45.1       3e-06
HYAP_03353                                                            33.9       0.031
HYAP_12148                                                            31.2       0.31 
PHALS_07864                                                           30.4       0.40 
PHALS_01649                                                           30.0       0.63 
HYAP_06791                                                            29.6       1.1  
CCI41202                                                              29.3       2.2  
HYAP_11990                                                            27.7       2.6  
CCA16522                                                              28.9       2.9  
PPTG_16191                                                            28.5       3.2  
PYAR_24024                                                            28.5       3.5  
PHALS_01829                                                           28.1       3.8  
PYVX_21090                                                            28.5       3.8  
PHYSO_321612                                                          27.7       5.9  
PHYCA_525182                                                          27.7       6.2  
CCA18404                                                              27.7       6.2  
CCA18323                                                              27.7       6.2  
PHYRA_78212                                                           27.7       6.4  
PHALS_08470                                                           27.7       6.5  
PITG_03117                                                            27.7       6.5  
HYAP_00088                                                            27.7       7.6  
PITG_09539                                                            26.9       8.2  
PHYSO_286664                                                          26.9       8.9  
SPRG_12054                                                            27.3       8.9  
H257_10668                                                            27.3       9.0  
SDRG_05060                                                            27.3       9.1  
PHALS_13781                                                           27.3       9.6  

>HYAP_01512
Length=76

 Score = 149 bits (376),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)

Query  1   MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRRLTSFVK  60
           MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRRLTSFVK
Sbjct  1   MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRRLTSFVK  60

Query  61  CLLPARRIPGKSPSCL  76
           CLLPARRIPGKSPSCL
Sbjct  61  CLLPARRIPGKSPSCL  76

>HYAP_05707
Length=314

 Score = 84.7 bits (208),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 3/65 (5%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRRLTSFVK  60
            MKISELLDPIEEDETAQPELTDN++LKEVLEADD+EE  +      ++LPEPRRLTSF  
Sbjct  200  MKISELLDPIEEDETAQPELTDNKMLKEVLEADDEEENSEDAAPVAELLPEPRRLTSF--  257

Query  61   CLLPA  65
             ++PA
Sbjct  258  -MMPA  261

>HYAP_08884
Length=289

 Score = 76.3 bits (186),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 52/80 (65%), Gaps = 11/80 (14%)

Query  2    KISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRRLTSFVKC  61
            KISELLDPIEEDET QP+LTDNEILKEVL+ADD+EE       S+   P   + T   K 
Sbjct  216  KISELLDPIEEDETVQPQLTDNEILKEVLDADDEEEN------SEDAAPVAEKFTRTEKI  269

Query  62   LL-----PARRIPGKSPSCL  76
             L        RIPGKSPSCL
Sbjct  270  NLLRDACSLLRIPGKSPSCL  289

>HYAP_02713
Length=101

 Score = 72.0 bits (175),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)

Query  1   MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEET  38
           MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEE 
Sbjct  1   MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEEN  38

>HYAP_04849
Length=258

 Score = 72.4 bits (176),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEE  37
            MKISELLDPIEEDETAQPELTDNEILKEVLEADD+EE
Sbjct  158  MKISELLDPIEEDETAQPELTDNEILKEVLEADDEEE  194

>HYAP_03961
Length=265

 Score = 72.4 bits (176),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEET  38
            MKISELLDPIEEDETAQPELTDNEILKEVLEADD+EE 
Sbjct  165  MKISELLDPIEEDETAQPELTDNEILKEVLEADDEEEN  202

>HYAP_00276
Length=82

 Score = 68.2 bits (165),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)

Query  1   MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEET  38
           MKISELLDPIEEDETA PELTDNEI KEVLEADDDEE 
Sbjct  1   MKISELLDPIEEDETAHPELTDNEITKEVLEADDDEEN  38

>HYAP_01961
Length=231

 Score = 71.2 bits (173),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEET  38
            MKISELLDPIEEDETAQPELTDNEILKEVLEADD+EE 
Sbjct  131  MKISELLDPIEEDETAQPELTDNEILKEVLEADDEEEN  168

>HYAP_07174
Length=285

 Score = 70.5 bits (171),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEET  38
            MKIS+LLDPIEEDETAQPELTDNEILKEVLEADD+EE 
Sbjct  185  MKISKLLDPIEEDETAQPELTDNEILKEVLEADDEEEN  222

>HYAP_13654
Length=226

 Score = 68.2 bits (165),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 37/38 (97%), Gaps = 0/38 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEET  38
            MKISELLDPIEED+TAQPELT+NEILKEVLEADD+EE 
Sbjct  108  MKISELLDPIEEDDTAQPELTENEILKEVLEADDEEEN  145

>HYAP_09768
Length=232

 Score = 67.4 bits (163),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEET  38
            MKISELLDPI EDETAQPELTDNEILK+VLEADD+EE 
Sbjct  161  MKISELLDPIGEDETAQPELTDNEILKKVLEADDEEEN  198

>HYAP_13581
Length=161

 Score = 65.9 bits (159),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDD  35
            MKISELLDPIEEDETAQPELTDNEILKE+L ADD+
Sbjct  127  MKISELLDPIEEDETAQPELTDNEILKEILGADDE  161

>HYAP_04037
Length=239

 Score = 55.1 bits (131),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/27 (96%), Positives = 26/27 (96%), Gaps = 0/27 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILK  27
            MKISE LDPIEEDETAQPELTDNEILK
Sbjct  142  MKISEFLDPIEEDETAQPELTDNEILK  168

>HYAP_08376
Length=256

 Score = 53.1 bits (126),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/27 (96%), Positives = 26/27 (96%), Gaps = 0/27 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILK  27
            MKISELLDPIEEDETAQ ELTDNEILK
Sbjct  145  MKISELLDPIEEDETAQTELTDNEILK  171

>HYAP_11963
Length=178

 Score = 45.1 bits (105),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/21 (100%), Positives = 21/21 (100%), Gaps = 0/21 (0%)

Query  1    MKISELLDPIEEDETAQPELT  21
            MKISELLDPIEEDETAQPELT
Sbjct  146  MKISELLDPIEEDETAQPELT  166

>HYAP_03353
Length=160

 Score = 33.9 bits (76),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 29/42 (69%), Gaps = 0/42 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLR  42
            M ++ L+  +EED++A  ELTD EI+K V E ++++E   LR
Sbjct  70   MSLACLVKLVEEDKSAHTELTDAEIIKLVQEPEEEKEGAALR  111

>HYAP_12148
Length=140

 Score = 31.2 bits (69),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 20/26 (77%), Gaps = 0/26 (0%)

Query  6    LLDPIEEDETAQPELTDNEILKEVLE  31
             L+P+EE+E+A  ELTD +I+K V E
Sbjct  115  FLNPVEEEESAHMELTDAKIMKLVQE  140

>PHALS_07864
Length=107

 Score = 30.4 bits (67),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 0/36 (0%)

Query  1   MKISELLDPIEEDETAQPELTDNEILKEVLEADDDE  36
           M I EL  P+ +D+TA  EL D+EI+    EA+++E
Sbjct  57  MAIKELFSPVTKDDTANLELNDDEIIAMDQEAEEEE  92

>PHALS_01649
Length=120

 Score = 30.0 bits (66),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 27/40 (68%), Gaps = 3/40 (8%)

Query  1   MKISELLDPIEEDETAQPELTDNEIL---KEVLEADDDEE  37
           M   ELL P+ ED+TA  E+ D+EI+   +EV E ++D++
Sbjct  41  MTFEELLSPVMEDDTANLEMNDDEIIAMKQEVEEEENDDQ  80

>HYAP_06791
Length=127

 Score = 29.6 bits (65),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  1   MKISELLDPIEEDETAQPELTDNEIL  26
           M I+ L++ +EED+ A  E+ D+EI+
Sbjct  1   MAIANLINSVEEDDVAHLEMNDSEII  26

>CCI41202
Length=1417

 Score = 29.3 bits (64),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1     MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
             +K+S ++  + E   A P   + ++ ++V + + + E   +R+L++K+ PE RR
Sbjct  1216  VKLSNMMRVLSEQAVADPSAIEKKVRQQVAQREKNHE---MRNLARKLTPEERR  1266

>HYAP_11990
Length=66

 Score = 27.7 bits (60),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 0/20 (0%)

Query  1   MKISELLDPIEEDETAQPEL  20
           M  SE LD IEEDETA P++
Sbjct  39  MTTSEFLDLIEEDETAYPDI  58

>CCA16522
Length=597

 Score = 28.9 bits (63),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
            +K+S ++  + E   A P   + ++ ++V + + + E   +R+L++K+ PE RR
Sbjct  396  VKLSNMMRVLSEQAVADPSAIEKKVRQQVAQREKNHE---MRNLARKLTPEERR  446

>PPTG_16191
Length=877

 Score = 28.5 bits (62),  Expect = 3.2, Method: Composition-based stats.
 Identities = 15/46 (33%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query  30   LEADDDEETVKLRHLSQKILPEPRRLTSFV-KCLLPARRIPGKSPS  74
            L  +DD    +   +S++ILP PRR T+   +   P R +P  +P+
Sbjct  390  LPGEDDSPVAEPSPVSEEILPRPRRNTTPASRTAPPTRGVPTNAPT  435

>PYAR_24024
Length=504

 Score = 28.5 bits (62),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
            +K+S ++  + E   A P   + ++ +++ + + + E   +R+L++K+ PE RR
Sbjct  297  VKLSNMMKVLGEQAVADPSAIERKVRQQIAQREKNHE---MRNLARKLTPEERR  347

>PHALS_01829
Length=135

 Score = 28.1 bits (61),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 4/39 (10%)

Query  3   ISELLDPIEEDETAQPELTDNEIL----KEVLEADDDEE  37
           I ELL  + ED+TA  EL D+EI+    K  +E +DD+E
Sbjct  12  IEELLSLVMEDDTADLELNDDEIITMAQKAEVEENDDQE  50

>PYVX_21090
Length=590

 Score = 28.5 bits (62),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
            +K+S ++  + E   A P   + ++ ++V + + + E   +R+L++K+ PE RR
Sbjct  384  VKLSNMMRVLSEQAVADPSAIEKKVREQVAQREKNHE---MRNLARKLTPEERR  434

>PHYSO_321612
Length=865

 Score = 27.7 bits (60),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
            +K+S ++  + E   A P   + ++ +++ + + + E   +R+L++K+ PE RR
Sbjct  416  VKLSNMMRVLSEQAVADPSAIERKVREQIAQREKNHE---MRNLARKLTPEERR  466

>PHYCA_525182
Length=623

 Score = 27.7 bits (60),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
            +K+S ++  + E   A P   + ++ +++ + + + E   +R+L++K+ PE RR
Sbjct  415  VKLSNMMRVLSEQAVADPSAIERKVREQIAQREKNHE---MRNLARKLTPEERR  465

>CCA18404
Length=266

 Score = 27.7 bits (60),  Expect = 6.2, Method: Composition-based stats.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 1/36 (3%)

Query  18   PELTDNEILKEVLEADDDEETVKLRHLSQKIL-PEP  52
            P L +     EVLE D + E ++LRH  +K L P P
Sbjct  184  PSLLEAMQCSEVLEFDQENEKIRLRHGWEKWLWPNP  219

>CCA18323
Length=266

 Score = 27.7 bits (60),  Expect = 6.2, Method: Composition-based stats.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 1/36 (3%)

Query  18   PELTDNEILKEVLEADDDEETVKLRHLSQKIL-PEP  52
            P L +     EVLE D + E ++LRH  +K L P P
Sbjct  184  PSLLEAMQCSEVLEFDQENEKIRLRHGWEKWLWPNP  219

>PHYRA_78212
Length=613

 Score = 27.7 bits (60),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
            +K+S ++  + E   A P   + ++ +++ + + + E   +R+L++K+ PE RR
Sbjct  405  VKLSNMMRVLSEQAVADPSAIERKVREQIAQREKNHE---MRNLARKLTPEERR  455

>PHALS_08470
Length=405

 Score = 27.7 bits (60),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 28/45 (62%), Gaps = 4/45 (9%)

Query  26   LKEVLEADDDEETVKLRHLSQKILP----EPRRLTSFVKCLLPAR  66
            +K+  +A+ D +  K++HL+QK++     E  +L+S    +LPA+
Sbjct  283  VKKSFQAEQDAQIKKVKHLTQKLMAAQDSERPQLSSNFGAILPAK  327

>PITG_03117
Length=620

 Score = 27.7 bits (60),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
            +K+S ++  + E   A P   + ++ +++ + + + E   +R+L++K+ PE RR
Sbjct  412  VKLSNMMRVLSEQAVADPSAIERKVREQIAQREKNHE---MRNLARKLTPEERR  462

>HYAP_00088
Length=622

 Score = 27.7 bits (60),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
            +K+S ++  + E   A P   + ++ +++ + + + E   +R+L++K+ PE RR
Sbjct  414  VKLSNMMRVLSEQAVADPSAIERKVREQIAQREKNHE---MRNLARKLTPEERR  464

>PITG_09539
Length=122

 Score = 26.9 bits (58),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 31/59 (53%), Gaps = 5/59 (8%)

Query  16  AQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRRLTSFVKCLLPARRIPGKSPS  74
           A P L D  +LK+VL A   +ET+++  +S   +   ++ T  ++ L   R +PG   S
Sbjct  18  ALPNLID--VLKDVLSASSTQETMRIGDISASAVSVKQKYTDALELL---RSLPGTDTS  71

>PHYSO_286664
Length=125

 Score = 26.9 bits (58),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 31/57 (54%), Gaps = 5/57 (9%)

Query  18  PELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRRLTSFVKCLLPARRIPGKSPS  74
           P L D  +LK+VL A+  +ET+++  +S   +   ++ T  ++ L   R +PG   S
Sbjct  23  PNLID--VLKDVLSANSTQETMRIGDVSASAVSVKQKYTEALELL---RSLPGTDTS  74

>SPRG_12054
Length=558

 Score = 27.3 bits (59),  Expect = 8.9, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 21/27 (78%), Gaps = 0/27 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILK  27
            M I ++LD +++ E+A+ +LT N++L+
Sbjct  126  MSIQDILDRVQKVESAEMDLTRNQLLR  152

>H257_10668
Length=740

 Score = 27.3 bits (59),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  10   IEEDETAQPELTDNEILKEVLEADDDEETVKL  41
            +E++ETA+  +    +L+  L+ DDDE+ + L
Sbjct  283  VEQEETARQSINQFSLLESWLDTDDDEDALAL  314

>SDRG_05060
Length=559

 Score = 27.3 bits (59),  Expect = 9.1, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 21/27 (78%), Gaps = 0/27 (0%)

Query  1    MKISELLDPIEEDETAQPELTDNEILK  27
            M I ++LD +++ E+A+ +LT N++L+
Sbjct  127  MSIQDILDRVQKVESAEMDLTRNQLLR  153

>PHALS_13781
Length=620

 Score = 27.3 bits (59),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 12/54 (22%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  1    MKISELLDPIEEDETAQPELTDNEILKEVLEADDDEETVKLRHLSQKILPEPRR  54
            +K+S ++  + E   A P   + ++ +++ + + + E   +R++++K+ PE RR
Sbjct  412  VKLSNMMRVLSEQAVADPSAIERKVREQIAQREKNHE---MRNIARKLTPEERR  462

Lambda      K        H        a         alpha
   0.313    0.134    0.375    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3367151004

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40