Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_01511569862062066645e-88
PYIW_1687397291496823281e-34
PYAR_1448756986467823261e-34
PHYRA_478659267381823203e-34
PHYRA_4787369035396823204e-34
HYAP_0154075345634823265e-34
PYIR_1585797291577823255e-34
PHYSO_4860859265653823222e-33
PHYSO_48001056986653823222e-33
PHYSO_4856149267653823222e-33
PYU1_G01392797291649823222e-33
PITG_112449262663823222e-33
PPTG_021229262657823222e-33
PHYCA_53291256986626823212e-33
PHYRA_724639262658823212e-33
PHYCA_10442940847645823212e-33
PHYCA_10433569035656823212e-33
PITG_112479265653823213e-33
PITG_112499267653823203e-33
PYVX_156419262629823194e-33
H310_02610148347650823204e-33
PHYCA_1044659267653823194e-33
PPTG_02120753451001823205e-33
PHYSO_3447059262798823195e-33
PYAP_1733497291650823178e-33
PYVX_2298180377612823161e-32
PYU1_G0139319262663823161e-32
SPRG_045339267652823133e-32
SDRG_118999267652823133e-32
PHYRA_7241556986655823124e-32
PYAP_173339262657823116e-32
CCA149671520391431823119e-32
CCA16151152456643823072e-31
CCI43221160520660823072e-31
H257_129589267649823063e-31
SPRG_00068122115643823063e-31
PYIW_168769262643823046e-31
PPTG_1969024837566823027e-31
PYAR_1980792621613823048e-31
H310_095579267644823021e-30
PHYKE_70169270650823011e-30
SDRG_11473122115636823002e-30
CCI40247152456643822983e-30
PHYSO_4827939270658822983e-30
HYAP_015379270651822967e-30
PYAP_1923599439643822941e-29
CCI402499267660822904e-29
CCA161539267663822904e-29
PITG_112529270654822834e-28
PHALS_098029270651822801e-27
PYIR_16737478511822781e-27
PHYRA_716559270653822782e-27
PYAP_13341478657822772e-27
PHALS_00833478652822772e-27
PHYRA_71042478654822772e-27
PYU1_G004098478656822772e-27
PITG_00527478656822772e-27
PYVX_16738478658822772e-27
PYIW_21755478658822772e-27
PPTG_08245478658822772e-27
PHYCA_510696478659822772e-27
PHYSO_286376478660822772e-27
PHYKE_7992478657822773e-27
HYAP_01005478660822773e-27
HYAP_0100493996660822773e-27
PYAR_183544781084822755e-27
PHYCA_1044449270644822702e-26
PYIR_158599262626792666e-26
H310_09434478658822667e-26
SPRG_00333478615822613e-25
SDRG_03564478658822613e-25
PYIR_1673893996555822595e-25
PYIW_26567165855564822525e-24
PYU1_G00409793996663822464e-23
HYAP_0681812728316822361e-22
CCI50234478665822412e-22
H310_0663112728651822384e-22
CCA24936478661822384e-22
H257_16775146079291652306e-22
H257_0127712728652822366e-22
PYIW_1714512728443822321e-21
SDRG_1104312728649822313e-21
SPRG_0229412728634822313e-21
PHYRA_4188868719586632304e-21
PHYSO_50048012728633822297e-21
PHYRA_7112312728633822297e-21
PHYKE_900812728650822288e-21
PHYCA_54113412728633822288e-21
PYU1_G00375412728650822288e-21
PPTG_1827412728648822288e-21
PITG_1578612728633822289e-21
PYVX_1505112728632822271e-20
PHALS_0761612728677822271e-20
PYIR_1969712728608822271e-20
PYAP_1973812728648822252e-20
CCA2151412728659822219e-20
PYAR_2218812728634822201e-19
CCI4598212728661822191e-19
PHYKE_297775345220442083e-19
H257_17322148347606821996e-17
PHALS_0066729702142371842e-16
PHALS_127909265214371812e-15
PYAR_24687105882618811704e-13
SPRG_10476127526270821659e-13
PHYSO_5495619761361821651e-12
PYAR_22140104646353791581e-11
HYAP_126609761786821591e-11
PPTG_031219761786821582e-11
PITG_119139761786821582e-11
PHYCA_5098209761786821582e-11
PYVX_181219761633821582e-11
PYAR_1993084937625821582e-11
PHYKE_108159761786821582e-11
PHALS_020799761786821582e-11
PHYRA_781939761786821582e-11
PYIW_2214484937633821572e-11
PYU1_G00154084937633821572e-11
PYIR_2438784937633821573e-11
H257_188859761786821563e-11
PYAP_2223884937633821563e-11
SDRG_057779761786821554e-11
SPRG_104779761762821545e-11
SDRG_05778127526618811538e-11
H310_10060146805187761471e-10
CCI460919761787821521e-10
CCA208289761787821521e-10
H257_18082146805187761461e-10
SDRG_05816127542479821483e-10
SPRG_10519127542782821441e-09
SDRG_100383097565751387e-09
SPRG_156953097581751379e-09
H310_14759127542787821352e-08
CCI45196160993136891282e-08
H257_00007127542787821342e-08
PYAP_162163097564801299e-08
PHYKE_698456986450411291e-07
PYAR_247043097525641262e-07
H257_076503097563551235e-07
PYU1_G0069403097565791202e-06
PHYKE_643097569801192e-06
PYVX_17117495651035791192e-06
HYAP_019933097569801182e-06
PHALS_0433031403785481183e-06
H310_127653097560521173e-06
PYIR_241233097567801174e-06
PITG_035463097569801174e-06
PHYCA_53220730971118801165e-06
PHYSO_5521163097570801158e-06
PPTG_101223097569801149e-06
PYVX_176923097551801141e-05
PHYRA_7223869419601821086e-05
H310_0391113310570881069e-05
CCI475823097582791061e-04
PHALS_003903097569801042e-04
PHYRA_715913097570801042e-04
CCA202293097583801042e-04
PHYSO_52542959845610741033e-04
PHYSO_3428175311818980994e-04
PHYSO_530254408477044925e-04
PYIW_191653097112454980.001
PHYKE_70771331063188970.001
PHYSO_383637542578144890.002
PHYSO_3396666941958571950.002
PHYSO_4933811331056288940.003
PHYRA_790541331056388940.003
PPTG_058191331056188930.005
PYU1_G0028951331056188920.005
PHALS_026921331055788920.006
PYAP_199031331052788910.009
PITG_165281331056188910.009
H257_016801331057188890.016
PYIR_136381331054388880.018
CCI452611331055865880.018
CCA223051331056165880.022
PHYCA_64581331056088860.033
PYVX_136151331058566850.051
SPRG_012551331056688850.053
HYAP_018571331049288840.060
SDRG_166211331053185830.082
SPRG_1113312787367630810.15
PYIW_173201331056386800.19
SPRG_1100712780242630731.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_01511

Length=206
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP_01511                                                            260        5e-88
PYIW_16873                                                            130        1e-34
PYAR_14487                                                            130        1e-34
PHYRA_47865                                                           127        3e-34
PHYRA_47873                                                           127        4e-34
HYAP_01540                                                            130        5e-34
PYIR_15857                                                            129        5e-34
PHYSO_486085                                                          128        2e-33
PHYSO_480010                                                          128        2e-33
PHYSO_485614                                                          128        2e-33
PYU1_G013927                                                          128        2e-33
PITG_11244                                                            128        2e-33
PPTG_02122                                                            128        2e-33
PHYCA_532912                                                          128        2e-33
PHYRA_72463                                                           128        2e-33
PHYCA_104429                                                          128        2e-33
PHYCA_104335                                                          128        2e-33
PITG_11247                                                            128        3e-33
PITG_11249                                                            127        3e-33
PYVX_15641                                                            127        4e-33
H310_02610                                                            127        4e-33
PHYCA_104465                                                          127        4e-33
PPTG_02120                                                            127        5e-33
PHYSO_344705                                                          127        5e-33
PYAP_17334                                                            126        8e-33
PYVX_22981                                                            126        1e-32
PYU1_G013931                                                          126        1e-32
SPRG_04533                                                            125        3e-32
SDRG_11899                                                            125        3e-32
PHYRA_72415                                                           124        4e-32
PYAP_17333                                                            124        6e-32
CCA14967                                                              124        9e-32
CCA16151                                                              122        2e-31
CCI43221                                                              122        2e-31
H257_12958                                                            122        3e-31
SPRG_00068                                                            122        3e-31
PYIW_16876                                                            121        6e-31
PPTG_19690                                                            120        7e-31
PYAR_19807                                                            121        8e-31
H310_09557                                                            120        1e-30
PHYKE_7016                                                            120        1e-30
SDRG_11473                                                            120        2e-30
CCI40247                                                              119        3e-30
PHYSO_482793                                                          119        3e-30
HYAP_01537                                                            118        7e-30
PYAP_19235                                                            117        1e-29
CCI40249                                                              116        4e-29
CCA16153                                                              116        4e-29
PITG_11252                                                            113        4e-28
PHALS_09802                                                           112        1e-27
PYIR_16737                                                            111        1e-27
PHYRA_71655                                                           111        2e-27
PYAP_13341                                                            111        2e-27
PHALS_00833                                                           111        2e-27
PHYRA_71042                                                           111        2e-27
PYU1_G004098                                                          111        2e-27
PITG_00527                                                            111        2e-27
PYVX_16738                                                            111        2e-27
PYIW_21755                                                            111        2e-27
PPTG_08245                                                            111        2e-27
PHYCA_510696                                                          111        2e-27
PHYSO_286376                                                          111        2e-27
PHYKE_7992                                                            111        3e-27
HYAP_01005                                                            111        3e-27
HYAP_01004                                                            111        3e-27
PYAR_18354                                                            110        5e-27
PHYCA_104444                                                          108        2e-26
PYIR_15859                                                            107        6e-26
H310_09434                                                            107        7e-26
SPRG_00333                                                            105        3e-25
SDRG_03564                                                            105        3e-25
PYIR_16738                                                            104        5e-25
PYIW_26567                                                            101        5e-24
PYU1_G004097                                                          99.4       4e-23
HYAP_06818                                                            95.5       1e-22
CCI50234                                                              97.4       2e-22
H310_06631                                                            96.3       4e-22
CCA24936                                                              96.3       4e-22
H257_16775                                                            93.2       6e-22
H257_01277                                                            95.5       6e-22
PYIW_17145                                                            94.0       1e-21
SDRG_11043                                                            93.6       3e-21
SPRG_02294                                                            93.6       3e-21
PHYRA_41888                                                           93.2       4e-21
PHYSO_500480                                                          92.8       7e-21
PHYRA_71123                                                           92.8       7e-21
PHYKE_9008                                                            92.4       8e-21
PHYCA_541134                                                          92.4       8e-21
PYU1_G003754                                                          92.4       8e-21
PPTG_18274                                                            92.4       8e-21
PITG_15786                                                            92.4       9e-21
PYVX_15051                                                            92.0       1e-20
PHALS_07616                                                           92.0       1e-20
PYIR_19697                                                            92.0       1e-20
PYAP_19738                                                            91.3       2e-20
CCA21514                                                              89.7       9e-20
PYAR_22188                                                            89.4       1e-19
CCI45982                                                              89.0       1e-19
PHYKE_2977                                                            84.7       3e-19
H257_17322                                                            81.3       6e-17
PHALS_00667                                                           75.5       2e-16
PHALS_12790                                                           74.3       2e-15
PYAR_24687                                                            70.1       4e-13
SPRG_10476                                                            68.2       9e-13
PHYSO_549561                                                          68.2       1e-12
PYAR_22140                                                            65.5       1e-11
HYAP_12660                                                            65.9       1e-11
PPTG_03121                                                            65.5       2e-11
PITG_11913                                                            65.5       2e-11
PHYCA_509820                                                          65.5       2e-11
PYVX_18121                                                            65.5       2e-11
PYAR_19930                                                            65.5       2e-11
PHYKE_10815                                                           65.5       2e-11
PHALS_02079                                                           65.5       2e-11
PHYRA_78193                                                           65.5       2e-11
PYIW_22144                                                            65.1       2e-11
PYU1_G001540                                                          65.1       2e-11
PYIR_24387                                                            65.1       3e-11
H257_18885                                                            64.7       3e-11
PYAP_22238                                                            64.7       3e-11
SDRG_05777                                                            64.3       4e-11
SPRG_10477                                                            63.9       5e-11
SDRG_05778                                                            63.5       8e-11
H310_10060                                                            61.2       1e-10
CCI46091                                                              63.2       1e-10
CCA20828                                                              63.2       1e-10
H257_18082                                                            60.8       1e-10
SDRG_05816                                                            61.6       3e-10
SPRG_10519                                                            60.1       1e-09
SDRG_10038                                                            57.8       7e-09
SPRG_15695                                                            57.4       9e-09
H310_14759                                                            56.6       2e-08
CCI45196                                                              53.9       2e-08
H257_00007                                                            56.2       2e-08
PYAP_16216                                                            54.3       9e-08
PHYKE_6984                                                            54.3       1e-07
PYAR_24704                                                            53.1       2e-07
H257_07650                                                            52.0       5e-07
PYU1_G006940                                                          50.8       2e-06
PHYKE_64                                                              50.4       2e-06
PYVX_17117                                                            50.4       2e-06
HYAP_01993                                                            50.1       2e-06
PHALS_04330                                                           50.1       3e-06
H310_12765                                                            49.7       3e-06
PYIR_24123                                                            49.7       4e-06
PITG_03546                                                            49.7       4e-06
PHYCA_532207                                                          49.3       5e-06
PHYSO_552116                                                          48.9       8e-06
PPTG_10122                                                            48.5       9e-06
PYVX_17692                                                            48.5       1e-05
PHYRA_72238                                                           46.2       6e-05
H310_03911                                                            45.4       9e-05
CCI47582                                                              45.4       1e-04
PHALS_00390                                                           44.7       2e-04
PHYRA_71591                                                           44.7       2e-04
CCA20229                                                              44.7       2e-04
PHYSO_525429                                                          44.3       3e-04
PHYSO_342817                                                          42.7       4e-04
PHYSO_530254                                                          40.0       5e-04
PYIW_19165                                                            42.4       0.001
PHYKE_7077                                                            42.0       0.001
PHYSO_383637                                                          38.9       0.002
PHYSO_339666                                                          41.2       0.002
PHYSO_493381                                                          40.8       0.003
PHYRA_79054                                                           40.8       0.003
PPTG_05819                                                            40.4       0.005
PYU1_G002895                                                          40.0       0.005
PHALS_02692                                                           40.0       0.006
PYAP_19903                                                            39.7       0.009
PITG_16528                                                            39.7       0.009
H257_01680                                                            38.9       0.016
PYIR_13638                                                            38.5       0.018
CCI45261                                                              38.5       0.018
CCA22305                                                              38.5       0.022
PHYCA_6458                                                            37.7       0.033
PYVX_13615                                                            37.4       0.051
SPRG_01255                                                            37.4       0.053
HYAP_01857                                                            37.0       0.060
SDRG_16621                                                            36.6       0.082
SPRG_11133                                                            35.8       0.15 
PYIW_17320                                                            35.4       0.19 
SPRG_11007                                                            32.7       1.5  

>HYAP_01511
Length=206

 Score = 260 bits (664),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)

Query  1    MTLCSMASTSTRPSRGRVSRTCAVTISVKRWSLrrrccttpscrrvrctrWCLGAvrrvs  60
            MTLCSMASTSTRPSRGRVSRTCAVTISVKRWSLRRRCCTTPSCRRVRCTRWCLGAVRRVS
Sbjct  1    MTLCSMASTSTRPSRGRVSRTCAVTISVKRWSLRRRCCTTPSCRRVRCTRWCLGAVRRVS  60

Query  61   prcrsccQTFSTARsptkklqdlllldvtplslglETAGGVMTILITCNKTMTTKKSQTF  120
            PRCRSCCQTFSTARSPTKKLQDLLLLDVTPLSLGLETAGGVMTILITCNKTMTTKKSQTF
Sbjct  61   PRCRSCCQTFSTARSPTKKLQDLLLLDVTPLSLGLETAGGVMTILITCNKTMTTKKSQTF  120

Query  121  SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGIRPLagr  180
            SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGIRPLAGR
Sbjct  121  SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGIRPLAGR  180

Query  181  tpggmpgggappagaVDQASKIEEVD  206
            TPGGMPGGGAPPAGAVDQASKIEEVD
Sbjct  181  TPGGMPGGGAPPAGAVDQASKIEEVD  206

>PYIW_16873
Length=496

 Score = 130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI+ N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  250  ETAGGVMTTLISRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  309

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  310  IPPMPRGVPQIDVTFDIDANGI  331

>PYAR_14487
Length=467

 Score = 130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT+LI  N T+ TKK+QTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  222  ETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  281

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  282  IPPMPRGVPQIDVTFDIDANGI  303

>PHYRA_47865
Length=381

 Score = 127 bits (320),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKK+QTFS   DN PGVLI VF+G+R MTR+N+LLGKFNL+ 
Sbjct  131  ETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDA  190

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  191  IPPMPRGVPQIDVTFDIDANGI  212

>PHYRA_47873
Length=396

 Score = 127 bits (320),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKK+QTFS   DN PGVLI VF+G+R MTR+N+LLGKFNL+ 
Sbjct  150  ETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDA  209

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  210  IPPMPRGVPQIDVTFDIDANGI  231

>HYAP_01540
Length=634

 Score = 130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  370  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  429

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  430  IPPMPRGVPQIDVTFDIDANGI  451

>PYIR_15857
Length=577

 Score = 129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  333  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  392

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  393  IPPMPRGVPQIDVTFDIDANGI  414

>PHYSO_486085
Length=653

 Score = 128 bits (322),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  408  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PHYSO_480010
Length=653

 Score = 128 bits (322),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  408  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PHYSO_485614
Length=653

 Score = 128 bits (322),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  408  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PYU1_G013927
Length=649

 Score = 128 bits (322),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI+ N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  408  ETAGGVMTTLISRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PITG_11244
Length=663

 Score = 128 bits (322),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  408  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PPTG_02122
Length=657

 Score = 128 bits (322),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  408  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PHYCA_532912
Length=626

 Score = 128 bits (321),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  379  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  438

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  439  IPPMPRGVPQIDVTFDIDANGI  460

>PHYRA_72463
Length=658

 Score = 128 bits (321),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  409  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  468

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  469  IPPMPRGVPQIDVTFDIDANGI  490

>PHYCA_104429
Length=645

 Score = 128 bits (321),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  396  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  455

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  456  IPPMPRGVPQIDVTFDIDANGI  477

>PHYCA_104335
Length=656

 Score = 128 bits (321),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  409  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  468

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  469  IPPMPRGVPQIDVTFDIDANGI  490

>PITG_11247
Length=653

 Score = 128 bits (321),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  408  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PITG_11249
Length=653

 Score = 127 bits (320),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  408  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PYVX_15641
Length=629

 Score = 127 bits (319),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  384  ETAGGVMTTLIPRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  443

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  444  IPPMPRGVPQIDVTFDIDANGI  465

>H310_02610
Length=650

 Score = 127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKF+L+ 
Sbjct  407  ETAGGVMTTLIQRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDG  466

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQV+V+FDIDANGI
Sbjct  467  IPPMPRGVPQVDVTFDIDANGI  488

>PHYCA_104465
Length=653

 Score = 127 bits (319),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  409  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  468

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  469  IPPMPRGVPQIDVTFDIDANGI  490

>PPTG_02120
Length=1001

 Score = 127 bits (320),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  754  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDG  813

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  814  IPPMPRGVPQIDVTFDIDANGI  835

>PHYSO_344705
Length=798

 Score = 127 bits (319),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  549  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  608

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  609  IPPMPRGVPQIDVTFDIDANGI  630

>PYAP_17334
Length=650

 Score = 126 bits (317),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKK+QTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  408  ETAGGVMTTLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PYVX_22981
Length=612

 Score = 126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+  KKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKFNL+ 
Sbjct  371  ETAGGVMTTLIPRNTTVPAKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDA  430

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PPMPRGVPQ++V+FDIDANGI
Sbjct  431  LPPMPRGVPQIDVTFDIDANGI  452

>PYU1_G013931
Length=663

 Score = 126 bits (316),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+N+LLGKFNL+ 
Sbjct  414  ETAGGVMTTLIPRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFNLDG  473

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  474  IPPMPRGVPQIDVTFDIDANGI  495

>SPRG_04533
Length=652

 Score = 125 bits (313),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKF+L+ 
Sbjct  407  ETAGGVMTTLIQRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDG  466

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  467  IPPMPRGVPQIDVTFDIDANGI  488

>SDRG_11899
Length=652

 Score = 125 bits (313),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+NNLLGKF+L+ 
Sbjct  407  ETAGGVMTTLIQRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDG  466

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  467  IPPMPRGVPQIDVTFDIDANGI  488

>PHYRA_72415
Length=655

 Score = 124 bits (312),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKK+QTFS   DN PGVLI VF+G+R MTR+N+LLGKFNL+ 
Sbjct  409  ETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDA  468

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  469  IPPMPRGVPQIDVTFDIDANGI  490

>PYAP_17333
Length=657

 Score = 124 bits (311),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+N+LLGKF+L+ 
Sbjct  409  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDG  468

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PPMPRGVPQ++V+FDIDANGI
Sbjct  469  LPPMPRGVPQIDVTFDIDANGI  490

>CCA14967
Length=1431

 Score = 124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 68/82 (83%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   +N PGV I VF+G+R MTR+NNLLGKFNL+ 
Sbjct  419  ETAGGVMTTLIPRNTTLPTKKSQTFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDG  478

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ+ V+FDIDANGI
Sbjct  479  IPPMPRGVPQIEVTFDIDANGI  500

>CCA16151
Length=643

 Score = 122 bits (307),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT+LI  N T+ T+KSQTFS   DN PGVLI V++G+R MTR+N+LLGKFNL +
Sbjct  410  ETAGGVMTVLIPRNTTVPTRKSQTFSTYADNQPGVLIQVYEGERTMTRDNHLLGKFNLEE  469

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ+ V+F++DANGI
Sbjct  470  IPPMPRGVPQIEVTFEVDANGI  491

>CCI43221
Length=660

 Score = 122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQ FS   +N PGV I VF+G+R MTR+NNLLGKFNL+ 
Sbjct  407  ETAGGVMTTLIPRNTTLPTKKSQMFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDG  466

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ+ V+FDIDANGI
Sbjct  467  IPPMPRGVPQIEVTFDIDANGI  488

>H257_12958
Length=649

 Score = 122 bits (306),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MT++NNLLGKF+L+ 
Sbjct  407  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERVMTKDNNLLGKFSLDG  466

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PPMPRG+PQV+V+FDIDANGI
Sbjct  467  LPPMPRGMPQVDVTFDIDANGI  488

>SPRG_00068
Length=643

 Score = 122 bits (306),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI V++G+R MT +NNLLGKF+L+ 
Sbjct  406  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVYEGERSMTADNNLLGKFSLDG  465

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQV+V+FDIDANGI
Sbjct  466  IPPMPRGVPQVDVTFDIDANGI  487

>PYIW_16876
Length=643

 Score = 121 bits (304),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+N+ LGKF+L+ 
Sbjct  408  ETAGGVMTTLIPRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFSLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FDIDANGI
Sbjct  468  IPPMPRGVPQIDVTFDIDANGI  489

>PPTG_19690
Length=566

 Score = 120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 68/82 (83%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+  KK+QTFS   DN PGVLI VF+G+R MTR+N+LLGKFNL+ 
Sbjct  408  ETAGGVMTKLIPRNTTVPAKKTQTFSTYTDNQPGVLIQVFEGERTMTRDNHLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FD+D NGI
Sbjct  468  IPPMPRGVPQIDVTFDVDVNGI  489

>PYAR_19807
Length=1613

 Score = 121 bits (304),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+G+R MTR+N+LLGKF+L+ 
Sbjct  398  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDA  457

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PPMPRGVPQ++V+FDIDANGI
Sbjct  458  LPPMPRGVPQIDVTFDIDANGI  479

>H310_09557
Length=644

 Score = 120 bits (302),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI+ N T+ TKKSQTFS   DN PGVLI V++G+R MT +N+LLGKF+L+ 
Sbjct  406  ETAGGVMTTLISRNTTVPTKKSQTFSTYADNQPGVLIQVYEGERTMTHDNHLLGKFSLDG  465

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PPMPRGVPQV+V+FDIDANGI
Sbjct  466  LPPMPRGVPQVDVTFDIDANGI  487

>PHYKE_7016
Length=650

 Score = 120 bits (301),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ +KKSQTFS   DN PGVLI VF+G+R MTR+N+LLGKFNL+ 
Sbjct  410  ETAGGVMTTLIARNTTVPSKKSQTFSTYSDNQPGVLIQVFEGERTMTRDNHLLGKFNLDG  469

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPM RG+PQ++V+FDIDANGI
Sbjct  470  IPPMRRGIPQIDVTFDIDANGI  491

>SDRG_11473
Length=636

 Score = 120 bits (300),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI V++G+R MT +N+LLGKF+L+ 
Sbjct  405  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVYEGERSMTADNHLLGKFSLDG  464

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQV+V+FDIDANGI
Sbjct  465  IPPMPRGVPQVDVTFDIDANGI  486

>CCI40247
Length=643

 Score = 119 bits (298),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT+LI  N T+ T+KSQTFS   DN  GVLI V++G+R MTR+N+LLGKFNL  
Sbjct  410  ETAGGVMTVLIARNTTVPTRKSQTFSTYADNQSGVLIQVYEGERSMTRDNHLLGKFNLEG  469

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ+ V+F++DANGI
Sbjct  470  IPPMPRGVPQIEVTFEVDANGI  491

>PHYSO_482793
Length=658

 Score = 119 bits (298),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ +KK+Q+FS   DN PGVLI VF+G+R MTR+N+LLGKFNL+ 
Sbjct  408  ETAGGVMTKLIPRNTTIPSKKTQSFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FD+D NGI
Sbjct  468  IPPMPRGVPQIDVTFDVDVNGI  489

>HYAP_01537
Length=651

 Score = 118 bits (296),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+  KKSQ+FS   DN PGVLI VF+G+R MTR+N+LLGKF+L+ 
Sbjct  408  ETAGGVMTKLIPRNTTVPAKKSQSFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFSLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FD+D NGI
Sbjct  468  IPPMPRGVPQIDVTFDVDVNGI  489

>PYAP_19235
Length=643

 Score = 117 bits (294),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N  + TKKSQTFS   DN PGVLI VF+G+R MT++NNLLGKF+L+ 
Sbjct  407  ETAGGVMTTLIPRNTAVPTKKSQTFSTYADNQPGVLIQVFEGERSMTKDNNLLGKFSLDG  466

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRG P++ V+FDIDANGI
Sbjct  467  IPPMPRGKPEIEVTFDIDANGI  488

>CCI40249
Length=660

 Score = 116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQ---TFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT+LI  N T+ TKKSQ   TF DN   V I VF+G+R MTR+NNLLGKFNL+ 
Sbjct  404  ETAGGVMTVLIPRNTTIPTKKSQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDG  463

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ+ V +DIDANGI
Sbjct  464  IPPMPRGVPQIEVCYDIDANGI  485

>CCA16153
Length=663

 Score = 116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQ---TFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT+LI  N T+ TKKSQ   TF DN   V I VF+G+R MTR+NNLLGKFNL+ 
Sbjct  404  ETAGGVMTVLIPRNTTIPTKKSQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDG  463

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ+ V +DIDANGI
Sbjct  464  IPPMPRGVPQIEVCYDIDANGI  485

>PITG_11252
Length=654

 Score = 113 bits (283),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+ +KK+Q+FS   DN  GVLI VF+G+R MTR+N+ LGKFNL+ 
Sbjct  408  ETAGGVMTKLIPRNTTVPSKKTQSFSTYADNQSGVLIQVFEGERTMTRDNHHLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FD+D NGI
Sbjct  468  IPPMPRGVPQIDVTFDVDVNGI  489

>PHALS_09802
Length=651

 Score = 112 bits (280),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+  KK Q+FS   DN  GVLI VF+G+R MTR+N+LLGKF+L+ 
Sbjct  408  ETAGGVMTKLIPRNTTVPAKKMQSFSTYTDNQSGVLIQVFEGERTMTRDNHLLGKFSLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FD+D NGI
Sbjct  468  IPPMPRGVPQIDVTFDVDVNGI  489

>PYIR_16737
Length=511

 Score = 111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  283  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  342

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  343  LPPAPRGVPQIEVTFEIDANGI  364

>PHYRA_71655
Length=653

 Score = 111 bits (278),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+  KK+Q+FS   DN  GVLI VF+G+R MT +N+LLGKFNL+ 
Sbjct  408  ETAGGVMTKLIPRNTTVPAKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDG  467

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVPQ++V+FD+D NGI
Sbjct  468  IPPMPRGVPQIDVTFDVDVNGI  489

>PYAP_13341
Length=657

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  430  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERTMTKDNRLLGKFELTG  489

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ VSF++DANGI
Sbjct  490  LPPAPRGVPQIEVSFELDANGI  511

>PHALS_00833
Length=652

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  429  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  488

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  489  LPPAPRGVPQIEVTFEIDANGI  510

>PHYRA_71042
Length=654

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  426  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  485

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  486  LPPAPRGVPQIEVTFEIDANGI  507

>PYU1_G004098
Length=656

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  429  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  488

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  489  LPPAPRGVPQIEVTFEIDANGI  510

>PITG_00527
Length=656

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  429  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  488

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  489  LPPAPRGVPQIEVTFEIDANGI  510

>PYVX_16738
Length=658

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  429  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  488

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  489  LPPAPRGVPQIEVTFEIDANGI  510

>PYIW_21755
Length=658

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  430  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  489

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  490  LPPAPRGVPQIEVTFEIDANGI  511

>PPTG_08245
Length=658

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  430  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  489

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  490  LPPAPRGVPQIEVTFEIDANGI  511

>PHYCA_510696
Length=659

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  429  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  488

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  489  LPPAPRGVPQIEVTFEIDANGI  510

>PHYSO_286376
Length=660

 Score = 111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  430  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  489

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  490  LPPAPRGVPQIEVTFEIDANGI  511

>PHYKE_7992
Length=657

 Score = 111 bits (277),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  429  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  488

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  489  LPPAPRGVPQIEVTFEIDANGI  510

>HYAP_01005
Length=660

 Score = 111 bits (277),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  430  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  489

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  490  LPPAPRGVPQIEVTFEIDANGI  511

>HYAP_01004
Length=660

 Score = 111 bits (277),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N LLGKF L  
Sbjct  430  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTG  489

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  490  LPPAPRGVPQIEVTFEIDANGI  511

>PYAR_18354
Length=1084

 Score = 110 bits (275),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQTFS   DN P VLI VF+G+R MT++N +LGKF L  
Sbjct  431  ETVGGVMTKLINRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERSMTKDNRMLGKFELTG  490

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ VSF++DANGI
Sbjct  491  LPPAPRGVPQIEVSFELDANGI  512

>PHYCA_104444
Length=644

 Score = 108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQ---TFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT LI  N T+  KK+Q   T+SDN  GVLI VF+G+R +T++N+LLGKFNL+ 
Sbjct  409  ETAGGVMTKLIPRNTTVPAKKTQSFSTYSDNQSGVLIQVFEGERSLTQDNHLLGKFNLDG  468

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPM RGVPQ++V+FD+D NGI
Sbjct  469  IPPMQRGVPQIDVTFDVDVNGI  490

>PYIR_15859
Length=626

 Score = 107 bits (266),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 51/79 (65%), Positives = 62/79 (78%), Gaps = 4/79 (5%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPP  155
            ETAGGVMT LI       +    T++DN PGVLI VF+G+R MTR+N+ LGKFNL+ IPP
Sbjct  392  ETAGGVMTTLIPXXXXTFS----TYADNQPGVLIQVFEGERTMTRDNHSLGKFNLDGIPP  447

Query  156  MPRGVPQVNVSFDIDANGI  174
            MPRGVPQ++V+FDIDANGI
Sbjct  448  MPRGVPQIDVTFDIDANGI  466

>H310_09434
Length=658

 Score = 107 bits (266),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT +I  N  + TKKSQTFS   DN P V I VF+G+R MT++N++LGKF L  
Sbjct  430  ETVGGVMTKIINRNTVVPTKKSQTFSTYQDNQPAVSIQVFEGERAMTKDNHILGKFELTG  489

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ V+F++DANGI
Sbjct  490  IPPAPRGVPQIEVTFEVDANGI  511

>SPRG_00333
Length=615

 Score = 105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT +I  N  + TKKSQTFS   DN P V I V++G+R MT++N++LGKF L  
Sbjct  388  ETVGGVMTKIINRNTVVPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTG  447

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ V+F++DANGI
Sbjct  448  IPPAPRGVPQIEVTFEVDANGI  469

>SDRG_03564
Length=658

 Score = 105 bits (261),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT +I  N  + TKKSQTFS   DN P V I V++G+R MT++N++LGKF L  
Sbjct  431  ETVGGVMTKIINRNTVVPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTG  490

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ V+F++DANGI
Sbjct  491  IPPAPRGVPQIEVTFEVDANGI  512

>PYIR_16738
Length=555

 Score = 104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQ FS   DN P V I V++G+R + ++N+LLGKF+L  
Sbjct  313  ETVGGVMTKLINKNTAIPTKKSQVFSTHVDNQPAVSIKVYEGERALVKDNHLLGKFDLTG  372

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ V+F++DANGI
Sbjct  373  IPPAPRGVPQIQVTFEVDANGI  394

>PYIW_26567
Length=564

 Score = 101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  +  KKSQ FS   DN P V I V++G+R + ++N+LLGKF+L  
Sbjct  431  ETVGGVMTKLINRNTAIPNKKSQVFSTHVDNQPAVSIKVYEGERTLVKDNHLLGKFDLTG  490

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRG+PQ+ V+F+IDANGI
Sbjct  491  IPPAPRGIPQIEVTFEIDANGI  512

>PYU1_G004097
Length=663

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 59/82 (72%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT LI  N  + TKKSQ FS   DN   V I VF+G+R + ++N LLGKF+L  
Sbjct  434  ETVGGVMTKLINRNTAIPTKKSQVFSTHVDNQAAVSIKVFEGERTLVKHNRLLGKFDLAG  493

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +PP PRGVPQ+ V+F+IDANGI
Sbjct  494  LPPAPRGVPQIEVTFEIDANGI  515

>HYAP_06818
Length=316

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  86   ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMASDNKLLGNFDLVG  145

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  146  IPPAPRGVPQIEVSFDIDANGI  167

>CCI50234
Length=665

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT +I  N  + TKKSQ FS   DN   V I V +G+R M ++N LLGKF L  
Sbjct  436  ETVGGVMTKIINRNTVIPTKKSQVFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTG  495

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ V+F++DANGI
Sbjct  496  IPPAPRGVPQIEVTFEVDANGI  517

>H310_06631
Length=651

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 57/82 (70%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   DN   V I V +G+R M  +N LLG F+L +
Sbjct  421  ETLGGVFTKLIPRNTTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQN  480

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRG+PQ+ VSFDIDANGI
Sbjct  481  IPPAPRGIPQIEVSFDIDANGI  502

>CCA24936
Length=661

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGVMT +I  N  + TKK+Q FS   DN   V I V +G+R M ++N LLGKF L  
Sbjct  432  ETVGGVMTKIINRNTVIPTKKAQLFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTG  491

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ V+F++DANGI
Sbjct  492  IPPAPRGVPQIEVTFEVDANGI  513

>H257_16775
Length=291

 Score = 93.2 bits (230),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 1/65 (2%)

Query  111  TMTTKKSQTFS-DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDI  169
            ++  K+  TFS DN PG LI VF+G+R MTR+NNLLGKF+ + IPPM RGVPQV+V+FDI
Sbjct  92   SLGLKQPATFSTDNQPGALIQVFEGERSMTRDNNLLGKFSFDGIPPMHRGVPQVDVTFDI  151

Query  170  DANGI  174
            DANGI
Sbjct  152  DANGI  156

>H257_01277
Length=652

 Score = 95.5 bits (236),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 57/82 (70%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   DN   V I V +G+R M  +N LLG F+L +
Sbjct  421  ETLGGVFTKLIPRNTTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQN  480

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRG+PQ+ VSFDIDANGI
Sbjct  481  IPPAPRGIPQIEVSFDIDANGI  502

>PYIW_17145
Length=443

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LIT N T+ TKKSQ FS   D+   V I V +G+R M  +N  LG F+L  
Sbjct  217  ETLGGVFTKLITRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVG  276

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  277  IPPAPRGVPQIEVSFDIDANGI  298

>SDRG_11043
Length=649

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   DN   V I V +G+R M  +N  LG F+L +
Sbjct  420  ETLGGVFTKLIPRNTTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQN  479

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRG+PQ+ VSFDIDANGI
Sbjct  480  IPPAPRGIPQIEVSFDIDANGI  501

>SPRG_02294
Length=634

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   DN   V I V +G+R M  +N  LG F+L +
Sbjct  405  ETLGGVFTKLIPRNTTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQN  464

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRG+PQ+ VSFDIDANGI
Sbjct  465  IPPAPRGIPQIEVSFDIDANGI  486

>PHYRA_41888
Length=586

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 3/63 (5%)

Query  115  KKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDA  171
            KK+Q+FS   DN  GVLI VF+G+R MT +N+LLGKFNL+ IPPMPRGVPQ++V+FD+D 
Sbjct  367  KKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFDVDV  426

Query  172  NGI  174
            NGI
Sbjct  427  NGI  429

>PHYSO_500480
Length=633

 Score = 92.8 bits (229),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  404  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVG  463

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  464  IPPAPRGVPQIEVSFDIDANGI  485

>PHYRA_71123
Length=633

 Score = 92.8 bits (229),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  404  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVG  463

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  464  IPPAPRGVPQIEVSFDIDANGI  485

>PHYKE_9008
Length=650

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  421  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVG  480

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  481  IPPAPRGVPQIEVSFDIDANGI  502

>PHYCA_541134
Length=633

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  404  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVG  463

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  464  IPPAPRGVPQIEVSFDIDANGI  485

>PYU1_G003754
Length=650

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  423  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVG  482

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  483  IPPAPRGVPQIEVSFDIDANGI  504

>PPTG_18274
Length=648

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  420  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVG  479

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  480  IPPAPRGVPQIEVSFDIDANGI  501

>PITG_15786
Length=633

 Score = 92.4 bits (228),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  404  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVG  463

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  464  IPPAPRGVPQIEVSFDIDANGI  485

>PYVX_15051
Length=632

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  404  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMASDNKLLGNFDLVG  463

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ V+FDIDANGI
Sbjct  464  IPPAPRGVPQIEVAFDIDANGI  485

>PHALS_07616
Length=677

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  448  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVG  507

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  508  IPPAPRGVPQIEVSFDIDANGI  529

>PYIR_19697
Length=608

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 55/82 (67%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N  LG F+L  
Sbjct  380  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVG  439

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  440  IPPAPRGVPQIEVSFDIDANGI  461

>PYAP_19738
Length=648

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N LLG F+L  
Sbjct  422  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVG  481

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ V+FDIDANGI
Sbjct  482  IPPAPRGVPQIEVTFDIDANGI  503

>CCA21514
Length=659

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 55/82 (67%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N  LG F+L  
Sbjct  428  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVG  487

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  488  IPPAPRGVPQIEVSFDIDANGI  509

>PYAR_22188
Length=634

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 55/82 (67%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N  LG F+L  
Sbjct  380  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVG  439

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ V+FDIDANGI
Sbjct  440  IPPAPRGVPQIEVTFDIDANGI  461

>CCI45982
Length=661

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 55/82 (67%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET GGV T LI  N T+ TKKSQ FS   D+   V I V +G+R M  +N  LG F+L  
Sbjct  429  ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVG  488

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPP PRGVPQ+ VSFDIDANGI
Sbjct  489  IPPAPRGVPQIEVSFDIDANGI  510

>PHYKE_2977
Length=220

 Score = 84.7 bits (208),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 42/44 (95%), Gaps = 0/44 (0%)

Query  131  VFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGI  174
            VF+G+R MTR+NNLLGKFNL+ IPPMPRGVPQ++V+FDIDANGI
Sbjct  1    VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  44

>H257_17322
Length=606

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 52/82 (63%), Gaps = 18/82 (22%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVM  LI  N T+ TKKSQTFS   +N  GVLI VF+                L+ 
Sbjct  379  ETAGGVMATLIQRNTTVPTKKSQTFSTCANNQSGVLIQVFRW---------------LDG  423

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IPPMPRGVP V+V+FDIDANGI
Sbjct  424  IPPMPRGVPHVDVTFDIDANGI  445

>PHALS_00667
Length=142

 Score = 75.5 bits (184),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 36/37 (97%), Gaps = 0/37 (0%)

Query  138  MTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGI  174
            MTR+NNLLGKFNL+ IPPMPRGVPQ++V+FDIDANGI
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  37

>PHALS_12790
Length=214

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 36/37 (97%), Gaps = 0/37 (0%)

Query  138  MTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGI  174
            MTR+NNLLGKFNL+ IPPMPRGVPQ++V+FDIDANGI
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  37

>PYAR_24687
Length=618

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 53/81 (65%), Gaps = 3/81 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFSDNHPGVL---IYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVM  +++ ++   T+ +QT S  H   L   I VF+G+R +T++N+ +G+  L+ 
Sbjct  439  ETAGGVMLPVLSRHRLTPTRATQTVSTLHANQLDITIRVFEGERLLTKDNHFIGQLRLSG  498

Query  153  IPPMPRGVPQVNVSFDIDANG  173
            + P P+GVP++ V F+ DA G
Sbjct  499  LAPAPQGVPRIEVEFETDAMG  519

>SPRG_10476
Length=270

 Score = 68.2 bits (165),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTF---SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  KK++ +   SD    V + +++G+R    +NN LG+F ++ 
Sbjct  79   ETVGRVMSVLIKRNTAIPVKKTRVYTTESDYQTQVNVVIYEGERACVDHNNKLGEFTISG  138

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQV V+F+IDANGI
Sbjct  139  IERAKRGEPQVEVTFEIDANGI  160

>PHYSO_549561
Length=361

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  169  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISG  228

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  229  LERAKRGEPQVEVTFEIDANGI  250

>PYAR_22140
Length=353

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 2/79 (3%)

Query  96   ETAGGVMTILITCNKTMTTKKS--QTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDI  153
            ETAGGVM  +   N     KK    T   N   + I VF+G+R +T+NN+ LG+  L  +
Sbjct  167  ETAGGVMHRIFPRNSIYLAKKRTVSTLRANQTELTIRVFEGERILTKNNHFLGQLKLKGL  226

Query  154  PPMPRGVPQVNVSFDIDAN  172
             P P GVP++ V F+ID +
Sbjct  227  SPAPPGVPRIEVQFEIDVD  245

>HYAP_12660
Length=786

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  594  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISG  653

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  654  LERAKRGEPQVEVTFEIDANGI  675

>PPTG_03121
Length=786

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  594  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISG  653

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  654  LERAKRGEPQVEVTFEIDANGI  675

>PITG_11913
Length=786

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  594  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISG  653

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  654  LERAKRGEPQVEVTFEIDANGI  675

>PHYCA_509820
Length=786

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  594  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISG  653

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  654  LERAKRGEPQVEVTFEIDANGI  675

>PYVX_18121
Length=633

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  441  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDSNNKLGEFNISG  500

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQV V+F+IDANGI
Sbjct  501  IERAKRGEPQVEVTFEIDANGI  522

>PYAR_19930
Length=625

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  486  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERAHVDSNNKLGEFNISG  545

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQV V+F+IDANGI
Sbjct  546  IERAKRGEPQVEVTFEIDANGI  567

>PHYKE_10815
Length=786

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  594  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISG  653

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  654  LERAKRGEPQVEVTFEIDANGI  675

>PHALS_02079
Length=786

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  594  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISG  653

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  654  LERAKRGEPQVEVTFEIDANGI  675

>PHYRA_78193
Length=786

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+FN++ 
Sbjct  594  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISG  653

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  654  LERAKRGEPQVEVTFEIDANGI  675

>PYIW_22144
Length=633

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R  T  NN LG+FN++ 
Sbjct  441  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISG  500

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  501  LERAKRGEPQVEVTFEIDANGI  522

>PYU1_G001540
Length=633

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R  T  NN LG+FN++ 
Sbjct  441  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISG  500

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  501  LERAKRGEPQVEVTFEIDANGI  522

>PYIR_24387
Length=633

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R  T  NN LG+FN++ 
Sbjct  441  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISG  500

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  501  LERAKRGEPQVEVTFEIDANGI  522

>H257_18885
Length=786

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  KK++ ++   D    V + +++G+R    +NN LG+F ++ 
Sbjct  594  ETVGKVMSVLIKRNTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISG  653

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQV V+F+IDANGI
Sbjct  654  IERAKRGEPQVEVTFEIDANGI  675

>PYAP_22238
Length=633

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R     NN LG+FN++ 
Sbjct  441  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDANNKLGEFNISG  500

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQV V+F+IDANGI
Sbjct  501  IERAKRGEPQVEVTFEIDANGI  522

>SDRG_05777
Length=786

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTF---SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  KK++ +   SD    V + +++G+R    +NN LG+F ++ 
Sbjct  595  ETVGRVMSVLIKRNTAIPIKKTRVYTTESDYQTQVNVVIYEGERACVDHNNKLGEFTISG  654

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            +    RG PQV V+F+IDANGI
Sbjct  655  LERAKRGEPQVEVTFEIDANGI  676

>SPRG_10477
Length=762

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  KK++ ++   D    V + +++G+R    +NN LG+F ++ 
Sbjct  571  ETVGRVMSVLIKRNTAIPVKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISG  630

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQV V+F+IDANGI
Sbjct  631  IERAKRGEPQVQVTFEIDANGI  652

>SDRG_05778
Length=618

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 3/81 (4%)

Query  97   TAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDI  153
            T G VM++LI  N  +  KK++ ++   D    V + +++G+R    +NN LG+F ++ I
Sbjct  428  TVGRVMSVLIKRNTAIPIKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGI  487

Query  154  PPMPRGVPQVNVSFDIDANGI  174
                RG PQV V+F+IDANGI
Sbjct  488  ERAKRGEPQVQVTFEIDANGI  508

>H310_10060
Length=187

 Score = 61.2 bits (147),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (62%), Gaps = 3/76 (4%)

Query  102  MTILITCNKTMTTKKSQTF---SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPR  158
            M++LI  N  +  KK++ +   +D    V + +++G+R    +NN LG+F ++ I    R
Sbjct  1    MSVLIKRNTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKR  60

Query  159  GVPQVNVSFDIDANGI  174
            G PQV V+F+IDANGI
Sbjct  61   GEPQVEVTFEIDANGI  76

>CCI46091
Length=787

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+F ++ 
Sbjct  595  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISG  654

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQV V+F+IDANGI
Sbjct  655  IERARRGEPQVKVTFEIDANGI  676

>CCA20828
Length=787

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  N  +  +K++ ++   D    V + +++G+R    +NN LG+F ++ 
Sbjct  595  ETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISG  654

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQV V+F+IDANGI
Sbjct  655  IERARRGEPQVKVTFEIDANGI  676

>H257_18082
Length=187

 Score = 60.8 bits (146),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (62%), Gaps = 3/76 (4%)

Query  102  MTILITCNKTMTTKKSQTF---SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPR  158
            M++LI  N  +  KK++ +   +D    V + +++G+R    +NN LG+F ++ I    R
Sbjct  1    MSVLIKRNTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKR  60

Query  159  GVPQVNVSFDIDANGI  174
            G PQV V+F+IDANGI
Sbjct  61   GEPQVEVTFEIDANGI  76

>SDRG_05816
Length=479

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E  G VM++LI  N  +  KK++ ++   D      + +F+G+R    +NN LG+F ++ 
Sbjct  287  ELVGKVMSVLIKRNTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISG  346

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQ+ V+F+IDANGI
Sbjct  347  IERAKRGEPQIEVTFEIDANGI  368

>SPRG_10519
Length=782

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E  G VM++LI  N  +  KK++ ++   D      + +F+G+R    +NN LG+F ++ 
Sbjct  590  ELVGKVMSVLIKRNTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISG  649

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG PQ+ V+F+IDANGI
Sbjct  650  IERAKRGEPQIEVTFEIDANGI  671

>SDRG_10038
Length=565

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G +  +I  N  +     + F+   DN   V + +++G+R+M R+N LL    ++ IP
Sbjct  408  ADGSVYEMIQRNTVLPATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIP  467

Query  155  PMPRGVPQVNVSFDI  169
            PM +G P++ VSF++
Sbjct  468  PMEKGSPEIEVSFNV  482

>SPRG_15695
Length=581

 Score = 57.4 bits (137),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G +  +I  N  +     + F+   DN   V + +++G+R+M R+N LL    ++ IP
Sbjct  424  ADGSVYEMIQRNTVLPATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIP  483

Query  155  PMPRGVPQVNVSFDI  169
            PM +G P++ VSF++
Sbjct  484  PMEKGSPEIEVSFNV  498

>H310_14759
Length=787

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E  G VM++LI  N  +  KK++ ++   D      + +++G+R    +NN LG+F +  
Sbjct  595  ELVGKVMSVLIKRNTAIPVKKTRIYTTEEDFQTSEKVVIYEGERASVVDNNKLGEFEITG  654

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG P++ V+F+IDANGI
Sbjct  655  IERAKRGEPKLEVTFEIDANGI  676

>CCI45196
Length=136

 Score = 53.9 bits (128),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 12/89 (13%)

Query  96   ETAGGVMTILITCNKTMTT----KKSQTF---SDNHPGVLIYVFKGKRYMTRNNNLLGKF  148
            E  GGVM      NK+       KK+Q F   S++   V I + KG+R M ++N LLG+ 
Sbjct  41   EIVGGVMI-----NKSTVIPYLDKKAQLFISLSESSNSVSIAILKGERAMAKDNRLLGQV  95

Query  149  NLNDIPPMPRGVPQVNVSFDIDANGIRPL  177
             +  IPP+PR +PQ+ V+F  + N   PL
Sbjct  96   EVTGIPPVPRDIPQIEVTFRAEINITSPL  124

>H257_00007
Length=787

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E  G VM++LI  N  +  KK++ ++   D      + +++G+R    +NN LG+F +  
Sbjct  595  ELVGKVMSVLIKRNTAIPVKKTRIYTTEEDFQTTEKVVIYEGERASVVDNNKLGEFEITG  654

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            I    RG P++ V+F+IDANGI
Sbjct  655  IERAKRGEPKLEVTFEIDANGI  676

>PYAP_16216
Length=564

 Score = 54.3 bits (129),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 46/80 (58%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G ++ +I  +  + T  ++ F+   DN   + I V++G+R M ++N LL +  +  I 
Sbjct  408  ANGSVSEVIHRDTVLPTSATEVFTTSVDNQDSIFIQVYEGERVMAKDNTLLAQLKVTGIS  467

Query  155  PMPRGVPQVNVSFDIDANGI  174
            P+P+G  ++ V+F I + G+
Sbjct  468  PLPKGEAEIEVTFAISSKGV  487

>PHYKE_6984
Length=450

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 3/41 (7%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFK  133
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI VF+
Sbjct  410  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450

>PYAR_24704
Length=525

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 39/64 (61%), Gaps = 0/64 (0%)

Query  111  TMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDID  170
            T  T+   T +DN   + I V++G+R M ++N LL +  ++ I P+P+G  ++ V+F + 
Sbjct  400  TSATEVFTTSADNQDAIFIQVYEGERAMAKDNTLLAQLRVDGISPLPKGEAEIEVTFAVS  459

Query  171  ANGI  174
            + G+
Sbjct  460  SKGV  463

>H257_07650
Length=563

 Score = 52.0 bits (123),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (62%), Gaps = 0/55 (0%)

Query  119  TFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANG  173
            T +DN   V + V++G+R + ++N LL    L+ IPP P+G  +V VSF++   G
Sbjct  430  TNADNQDAVYLQVYEGQRVLKKDNTLLANLTLSGIPPAPKGESEVEVSFNVTRKG  484

>PYU1_G006940
Length=565

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 43/79 (54%), Gaps = 3/79 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G +T LI     +    ++TF+   DN   + + +++G+R M ++N LL    ++ I 
Sbjct  408  ANGSVTELIHRETVLPATATETFTTSQDNQTAIFLQIYEGERVMAKDNTLLASLAVSGIA  467

Query  155  PMPRGVPQVNVSFDIDANG  173
            P P+G  ++ V+F ++  G
Sbjct  468  PAPKGEAEIEVTFAVNTKG  486

>PHYKE_64
Length=569

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 44/80 (55%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G ++ LI     +    ++ F+   DN   V + +++G+R M ++N L+ + ++  IP
Sbjct  408  ANGSVSELIQRETILPATHTELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVAGIP  467

Query  155  PMPRGVPQVNVSFDIDANGI  174
            PM +G  ++ V+F +   G+
Sbjct  468  PMSKGDAEIEVTFTVSTKGV  487

>PYVX_17117
Length=1035

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 4/79 (5%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFSDNH---PGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETAGGVMT ++  N T+    S+ F+  H     V+  VF+G R  T +N  LG+  LN+
Sbjct  813  ETAGGVMTTVVNRNTTIPHVGSRIFTPIHEQQSTVVFKVFEGCRIWTAHNRFLGQLELNN  872

Query  153  IPPMPR-GVPQVNVSFDID  170
            +       +PQV V+FD+D
Sbjct  873  LQRRSDLRLPQVKVTFDMD  891

>HYAP_01993
Length=569

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 45/80 (56%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTF---SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G ++ LI  +  +    ++ F   SDN     + +++G+R M ++N L+ + ++  I 
Sbjct  408  ANGSVSELIQRDTILPASATEVFTTSSDNQEAAFLQIYEGQRLMAKDNTLVAQLSVAGIT  467

Query  155  PMPRGVPQVNVSFDIDANGI  174
            P+P+G  +++V+F +   G+
Sbjct  468  PLPKGDAEIDVTFTVSTKGV  487

>PHALS_04330
Length=785

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 3/48 (6%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTR  140
            ETAGGVMT LI  N T+ TKKSQTFS   DN PGVLI   +  +Y+ +
Sbjct  408  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQDQQIAQYVNQ  455

>H310_12765
Length=560

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 0/52 (0%)

Query  122  DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANG  173
            DN   V + V++G+R + ++N LL    L  IPP P+G  +V VSF +   G
Sbjct  433  DNQHAVYLQVYEGQRVLKKDNTLLANLTLTGIPPAPKGESEVEVSFTVTRKG  484

>PYIR_24123
Length=567

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 44/80 (55%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G +  +I  +  +    ++TF+   DN   + + V++G+R M ++N LL   ++  I 
Sbjct  408  ANGSVAEVIHRDTVLPATATETFTTSQDNQTAIFLQVYEGERVMAKDNTLLASLSVAGIA  467

Query  155  PMPRGVPQVNVSFDIDANGI  174
            P P+G  ++ V+F ++  G+
Sbjct  468  PAPKGEAEIEVTFTVNTKGV  487

>PITG_03546
Length=569

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 46/80 (58%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G ++ LI  +  +    ++ F+   DN   V + +++G+R M ++N L+ + +++ I 
Sbjct  407  ANGSVSELIQRDTILPATATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGIT  466

Query  155  PMPRGVPQVNVSFDIDANGI  174
            P P+G  ++ V+F + + G+
Sbjct  467  PQPKGDAEIEVTFTVSSKGV  486

>PHYCA_532207
Length=1118

 Score = 49.3 bits (116),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 46/80 (58%), Gaps = 3/80 (4%)

Query  98    AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
             A G ++ LI  +  +    ++ F+   DN   V + +++G+R M ++N L+ + +++ I 
Sbjct  956   ANGSVSELIQRDTILPATATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGIT  1015

Query  155   PMPRGVPQVNVSFDIDANGI  174
             P+P+G  ++ V+F +   G+
Sbjct  1016  PLPKGDAEIEVTFTVSTKGV  1035

>PHYSO_552116
Length=570

 Score = 48.9 bits (115),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 45/80 (56%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G ++ LI  +  +    ++ F+   DN   V + +++G+R M ++N L+ + ++  I 
Sbjct  408  ANGSVSELIQRDTVLPATATELFTTSEDNQEAVYLQIYEGQRLMAKDNTLVAQLSVAGIT  467

Query  155  PMPRGVPQVNVSFDIDANGI  174
            P+P+G  ++ V+F +   G+
Sbjct  468  PLPKGDAEIEVTFTVSTKGV  487

>PPTG_10122
Length=569

 Score = 48.5 bits (114),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 45/80 (56%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G ++ LI  +  +    ++ F+   DN   V + +++G+R M ++N L+ + +++ I 
Sbjct  407  ANGSVSELIQRDTILPATATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGIT  466

Query  155  PMPRGVPQVNVSFDIDANGI  174
            P+P+G  ++ V F +   G+
Sbjct  467  PLPKGDAEIEVIFTVSTKGV  486

>PYVX_17692
Length=551

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/80 (24%), Positives = 45/80 (56%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTF---SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G ++ L+  +  +    ++TF   +D+   V + +++G+R M ++N LL +  +  I 
Sbjct  394  ANGSVSELVHRDTVLPASATETFTTSADDQTAVFLQIYEGERLMAKDNTLLAQLAVTGIT  453

Query  155  PMPRGVPQVNVSFDIDANGI  174
             +P+G  +++V+F +   G+
Sbjct  454  ALPKGEAEIDVTFTVSTKGV  473

>PHYRA_72238
Length=601

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 45/82 (55%), Gaps = 3/82 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E  G    ++I  + T+ TK++  FS   DN   + + +F+G+      N LLG   +++
Sbjct  410  EVDGTNSLVVIYRHTTVPTKRTVPFSTSEDNQAVMRVRIFEGEHSDMSANCLLGTIEVDN  469

Query  153  IPPMPRGVPQVNVSFDIDANGI  174
            IP  PRG  ++ V+ DI+A+ I
Sbjct  470  IPLKPRGESEIEVTLDINADDI  491

>H310_03911
Length=570

 Score = 45.4 bits (106),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E A G M +LI  N  +    TK  +T  D+  G+ + VF+G++ + R+N  L  FN   
Sbjct  422  EKADGTMEVLIPKNSRIPIAVTKHFETLDDDQRGITVEVFEGEKPVARDNVFLTYFNFT-  480

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G  Q  V+  +DANGI
Sbjct  481  ---LPRHKAGKAGEFQHAVTLSMDANGI  505

>CCI47582
Length=582

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 44/79 (56%), Gaps = 4/79 (5%)

Query  99   GGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPP  155
            G V T LI  +  +  K ++TF+   DN   VLI +++G+R +   N LL +  ++ I P
Sbjct  422  GNVHT-LIHRDAILPAKMTETFTTWEDNQTEVLIEIYEGERAIAEKNTLLARMCVSGIAP  480

Query  156  MPRGVPQVNVSFDIDANGI  174
            +P+G  ++ +   + + G+
Sbjct  481  LPKGEAEIILQVQVSSKGV  499

>PHALS_00390
Length=569

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 42/80 (53%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G +  LI     +    ++ F+   DN   V + +++G+R M ++N L+ +  ++ I 
Sbjct  407  ANGSVAELIHRETILPATVTEIFTTSCDNQETVYLQIYEGQRIMAKDNTLVAQLKVSGIT  466

Query  155  PMPRGVPQVNVSFDIDANGI  174
            P+P+G   + V+F +   G+
Sbjct  467  PLPKGDAAIEVTFTVSTKGV  486

>PHYRA_71591
Length=570

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/80 (24%), Positives = 43/80 (54%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G ++ LI  +  +    ++ F+   DN   V + +++G+R M ++N L+ + +++ I 
Sbjct  408  ANGSVSELIQRDTVLPATATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGIT  467

Query  155  PMPRGVPQVNVSFDIDANGI  174
            P  +G  ++ V F +   G+
Sbjct  468  PKAKGEVEIEVDFTVSTKGV  487

>CCA20229
Length=583

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 42/80 (53%), Gaps = 3/80 (4%)

Query  98   AGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIP  154
            A G +  LI  +  +  K  +TF+   DN    LI +++G+R +   N LL +  ++ I 
Sbjct  420  AHGNVHTLIHRDVVLPAKMMETFTTWEDNQTEALIEIYEGERAIAEKNTLLAQMCISGIT  479

Query  155  PMPRGVPQVNVSFDIDANGI  174
            P+P+G  ++ +   + + G+
Sbjct  480  PLPKGEAEIIIELQVSSQGL  499

>PHYSO_525429
Length=610

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 45/74 (61%), Gaps = 6/74 (8%)

Query  103  TILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRG  159
            +++I  + T+ T+K++TFS   DN   V I + +G+     +N ++GK   + +P  PRG
Sbjct  404  SVMIPRSTTIPTRKTRTFSTSQDNQSVVQIELLEGE---DGDNRVIGKLKGDGLPLEPRG  460

Query  160  VPQVNVSFDIDANG  173
              ++ V+ ++DANG
Sbjct  461  EFKIEVTVEVDANG  474

>PHYSO_342817
Length=189

 Score = 42.7 bits (99),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 43/80 (54%), Gaps = 3/80 (4%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET G VM++LI  +  +  +K + ++   D    V + ++ G+R   + NN +G+FN++ 
Sbjct  60   ETVGKVMSVLIKRSTAIPVRKIRVYTTEEDYQTSVDVCIYDGERACVKPNNKVGEFNISG  119

Query  153  IPPMPRGVPQVNVSFDIDAN  172
            +    RG PQ    F I+ +
Sbjct  120  LERTKRGEPQYAGEFHIEKD  139

>PHYSO_530254
Length=70

 Score = 40.0 bits (92),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 28/44 (64%), Gaps = 0/44 (0%)

Query  131  VFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGI  174
            ++KG      +NN LGK N+ D+ P+ R  P + V+F+ID NG+
Sbjct  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGM  44

>PYIW_19165
Length=1124

 Score = 42.4 bits (98),  Expect = 0.001, Method: Composition-based stats.
 Identities = 15/54 (28%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  121   SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGI  174
             SDN   + + V++G+R M ++N LL   ++  I   P+   ++ V+F +   G+
Sbjct  991   SDNQTAIFLQVYEGERVMAKDNTLLASLSVTGIAAAPKSEAEIEVTFTVSTKGV  1044

>PHYKE_7077
Length=631

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 45/88 (51%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNK---TMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +++  N    T  TK  QTF D+  G+ + V++G+  + + N+ +  FN   
Sbjct  497  ETADGTMEVILPRNARIPTTVTKHFQTFEDDQRGLTVEVYEGENEIAKENDHISYFNF--  554

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++A+GI
Sbjct  555  --ALPRDKIGKAGEFAHPVTFTMNASGI  580

>PHYSO_383637
Length=81

 Score = 38.9 bits (89),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 28/44 (64%), Gaps = 0/44 (0%)

Query  131  VFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGI  174
            ++KG      +NN LG+ N+ D+ P+ R  P + V+F+ID NG+
Sbjct  17   IYKGGGVGVASNNKLGELNVWDLMPVKRSEPLIAVTFEIDVNGM  60

>PHYSO_339666
Length=585

 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 39/71 (55%), Gaps = 3/71 (4%)

Query  106  ITCNKTMTTKKSQTF---SDNHPGVLIYVFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQ  162
            ++ N T+  +KS+TF   + N   + I  F+G+      N LL +F ++ I   P  + +
Sbjct  386  VSKNSTLPMRKSRTFLTANANKSTMRIKAFEGEATTVATNRLLCEFEMDGITMTPGRLSE  445

Query  163  VNVSFDIDANG  173
            + V+ D+DANG
Sbjct  446  IEVAIDVDANG  456

>PHYSO_493381
Length=562

 Score = 40.8 bits (94),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNK---TMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +++  N    T  TK  QTF D+  G+ + V++G++ + + N+ +  FN   
Sbjct  429  ETADGSMEVILPRNARIPTTVTKYFQTFEDDQLGLTVEVYEGEKEIAKENDHICYFNF--  486

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++A+GI
Sbjct  487  --ALPRDKIGKAGEFAHPVTFTMNASGI  512

>PHYRA_79054
Length=563

 Score = 40.8 bits (94),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNK---TMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +++  N    T  TK  QTF D+  G+ + V++G++ + + N+ +  FN   
Sbjct  429  ETADGSMEVILPRNARIPTTVTKNFQTFEDDQRGLTVEVYEGEKDIAKENDHICYFNF--  486

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++A+GI
Sbjct  487  --ALPRDKIGKAGEFAHPVTFTMNASGI  512

>PPTG_05819
Length=561

 Score = 40.4 bits (93),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 46/88 (52%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNK---TMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +++  N    T  TK  QT+ D+  G+ + V++G++ + + N+ +  FN   
Sbjct  428  ETADGTMEVILPRNARIPTTVTKYFQTYEDDQRGLTVEVYEGEKEIAKENDHICYFNF--  485

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++A+GI
Sbjct  486  --ALPRDKIGKAGEFAHPVTFTMNASGI  511

>PYU1_G002895
Length=561

 Score = 40.0 bits (92),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 45/88 (51%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M ++I  N  +    TK  QTF DN  G+ I V++G+  + + N+ +  FN   
Sbjct  428  ETADGRMEVIIPKNARIPVSLTKYFQTFEDNQRGLTIEVYEGENEVAKENDHICYFNFT-  486

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++A+G+
Sbjct  487  ---LPRDKVGKAGEFAHPVTFTMNASGV  511

>PHALS_02692
Length=557

 Score = 40.0 bits (92),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 45/88 (51%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNK---TMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +++  N    T  TK   T+ DN  G+ I V++G++ + + N+ +  FN   
Sbjct  424  ETADGTMEVILPRNARIPTTVTKYFTTYEDNQRGITIEVYEGEKDIAKENDHICYFNF--  481

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++A+GI
Sbjct  482  --ALPRNKIGKAGEYSHPVTFTMNASGI  507

>PYAP_19903
Length=527

 Score = 39.7 bits (91),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 46/88 (52%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E A G M IL+  N  +    TK  +TF D+  G+ + V++G+  + + N+ +  FN   
Sbjct  393  EKADGEMEILLPKNSRIPVTMTKYFETFEDDQRGLTVQVYEGENAVAQENDHICDFNF--  450

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
              P+PR      G  +  V+F ++A+G+
Sbjct  451  --PIPRDKIGKAGEFKHPVTFTMNASGV  476

>PITG_16528
Length=561

 Score = 39.7 bits (91),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 45/88 (51%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNK---TMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +++  N    T  TK  QT+ D   G+ + V++G++ + + N+ +  FN   
Sbjct  428  ETADGSMEVILLRNARIPTTVTKYFQTYEDEQRGLTVEVYEGEKEVAKENDHICYFNF--  485

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++A+GI
Sbjct  486  --ALPRDKVGKAGEFAHPVTFTMNASGI  511

>H257_01680
Length=571

 Score = 38.9 bits (89),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 41/88 (47%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E A G M +LI  N  +    TK   T+ D+  G+ + VF+G   + R+N  L  FN   
Sbjct  425  EMADGRMEVLIPKNSRIPISVTKSFDTYEDHQKGITVEVFEGDHPVARDNVYLTYFNFT-  483

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G  Q  V+  ++ NG+
Sbjct  484  ---LPRHKLGKAGEFQHAVTLSMNENGV  508

>PYIR_13638
Length=543

 Score = 38.5 bits (88),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 45/88 (51%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET  G M ++I  N  +    TK  QTF DN  G+ + V++G++ + + N+ +  FN   
Sbjct  408  ETHDGTMEVIIPKNSRIPVSLTKYFQTFEDNQRGLTVEVYEGEQKVAKENDHICYFNF--  465

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++A+G+
Sbjct  466  --VLPRDKIGRAGEFAHPVTFTMNASGV  491

>CCI45261
Length=558

 Score = 38.5 bits (88),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 35/65 (54%), Gaps = 7/65 (11%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET  G M I+++ N  +    TK  QTF D+  G+ + V++G+  + R N  + +F+   
Sbjct  428  ETVDGRMEIILSKNSQIPAEVTKYFQTFEDDQRGISVDVYEGENSIARENEHICRFDF--  485

Query  153  IPPMP  157
              P+P
Sbjct  486  --PIP  488

>CCA22305
Length=561

 Score = 38.5 bits (88),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 35/65 (54%), Gaps = 7/65 (11%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +++  N  +    TK  QTF D+  G+ + V++G+  + R N  + +F+   
Sbjct  431  ETADGRMEVILPKNSQIPAQVTKYFQTFEDDQRGISVDVYEGEHPIARENEHICRFDF--  488

Query  153  IPPMP  157
              P+P
Sbjct  489  --PIP  491

>PHYCA_6458
Length=560

 Score = 37.7 bits (86),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 44/88 (50%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNK---TMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +++  N    T  TK  QT+ D   G+ + V++G++   + N+ +  FN   
Sbjct  427  ETADGTMEVILPRNARIPTTVTKYFQTYEDGQRGLTVEVYEGEKENAKENDHICYFNF--  484

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++A+GI
Sbjct  485  --ALPRDKIGKAGEFAHPVTFTMNASGI  510

>PYVX_13615
Length=585

 Score = 37.4 bits (85),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (52%), Gaps = 7/66 (11%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +L+  N  +    TK  +TF D   G+ + V++G+  + + N+ +  FN   
Sbjct  451  ETADGAMEVLLPKNSRIPVSLTKYFETFEDGQRGLTVEVYEGEHAVAKQNDHICYFNF--  508

Query  153  IPPMPR  158
               +PR
Sbjct  509  --ALPR  512

>SPRG_01255
Length=566

 Score = 37.4 bits (85),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 40/88 (45%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E A G M +LI  N  +    TK   T  D+  G  I VF+G+  + R N  L  F+   
Sbjct  425  EKADGAMEVLIQKNSRIPVSVTKYFDTAIDDQAGFTIEVFEGESPVARENTYLTYFDF--  482

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G  Q  V+  ++ANG+
Sbjct  483  --VLPRKVRGKAGAIQHPVTLSMNANGL  508

>HYAP_01857
Length=492

 Score = 37.0 bits (84),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 44/88 (50%), Gaps = 13/88 (15%)

Query  96   ETAGGVMTILITCNK---TMTTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ETA G M +++  N    T  TK  QT+ DN  G+ + V++G+  + +  + +  FN   
Sbjct  371  ETADGSMEVILPKNARIPTTMTKYFQTYEDNQRGLTVEVYEGENKIAKECDHICYFNF--  428

Query  153  IPPMPR------GVPQVNVSFDIDANGI  174
               +PR      G     V+F ++ANGI
Sbjct  429  --VLPRDKIGKAGEFAHPVTFTMNANGI  454

>SDRG_16621
Length=531

 Score = 36.6 bits (83),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            E A G M +LI  N  +    TK   T  D+  G  I VF+G+  + R N  L  F+   
Sbjct  384  EKADGAMEVLIPKNSRIPVSVTKYFDTAVDDQAGFTIEVFEGESPVARENTYLTYFDFV-  442

Query  153  IPPMPRGVP---QVNVSFDIDANGI  174
            +P   RG     Q  V+  ++ANG+
Sbjct  443  LPRKTRGKAGSIQHPVTLSMNANGL  467

>SPRG_11133
Length=676

 Score = 35.8 bits (81),  Expect = 0.15, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFSDNHP  125
            ET GGVMT LI+ N T+ +KKS+ F  + P
Sbjct  406  ETGGGVMTTLISRNTTIPSKKSEKFKISQP  435

>PYIW_17320
Length=563

 Score = 35.4 bits (80),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query  96   ETAGGVMTILITCNKTM---TTKKSQTFSDNHPGVLIYVFKGKRYMTRNNNLLGKFNLND  152
            ET  G M  +I  N  +    TK  QTF DN  G+ + V++G+  + + N+ +  FN   
Sbjct  428  ETHDGRMETIIPKNSRIPVSLTKYFQTFEDNQRGLTVEVYEGEHEVAKENDHICYFNF--  485

Query  153  IPPMPR----GVPQVNVSFDIDANGI  174
            + P  +    G     V+F ++A+G+
Sbjct  486  VLPHDKVGKAGEFAHPVTFTMNASGV  511

>SPRG_11007
Length=426

 Score = 32.7 bits (73),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  96   ETAGGVMTILITCNKTMTTKKSQTFSDNHP  125
            ET GGVMT +I+ N T+ +KKS+ F  + P
Sbjct  156  ETGGGVMTTVISRNTTIPSKKSEEFKISQP  185

Lambda      K        H        a         alpha
   0.320    0.132    0.397    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9640586016

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40